SimulationCraft 1027-01

for World of Warcraft 10.2.7.55261 Live (hotfix 2024-06-26/55261, git build 7c6490f2a3)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 51036 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
51036.3 51036.3 58.0 / 0.114% 9975.0 / 19.5% 4064.7
APS APS Error APS Range APR
171.6 4.0 / 2.324% 447.7 / 260.9% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.2 12.5 Runic Power 3.55% 53.4 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 51036
Abomination Limb 0 (612) 0.0% (1.2%) 3.0 120.95s 61123 49526

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 1.2344 0.0000 0.00 0.00 0.00% 49526.31 49526.31

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [f]:0.12
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
    cooldowns
    [g]:2.85
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
    Abomination Limb (_damage) 612 1.2% 38.0 6.76s 4782 0 Direct 38.0 3639 7284 4782 31.3% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.03 38.03 0.00 0.00 0.00 0.0000 0.0000 181860.61 181860.61 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.66% 26.11 12 36 3639.11 2343 7080 3641.21 2997 4553 95028 95028 0.00%
crit 31.34% 11.92 3 24 7284.07 4685 14161 7290.63 5291 9879 86833 86833 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
auto_attack_mh 2665 5.2% 192.2 1.82s 4157 2297 Direct 192.2 3608 7226 4157 31.5% 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 192.17 192.17 0.00 0.00 0.00 1.8094 0.0000 798781.19 1141145.09 30.00% 2297.22 2297.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.22% 100.36 60 143 3607.52 2447 7354 3608.24 3353 3893 362034 517204 30.00%
crit 31.45% 60.44 32 95 7225.61 4813 14872 7224.74 6415 8141 436747 623941 30.00%
miss 16.33% 31.37 13 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1298 2.5% 187.8 1.82s 2072 1145 Direct 187.8 1804 3611 2072 31.5% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 187.78 187.78 0.00 0.00 0.00 1.8093 0.0000 389065.94 555822.65 30.00% 1145.16 1145.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.82% 97.30 60 139 1803.58 1203 3718 1803.89 1665 1971 175490 250706 30.00%
crit 31.49% 59.14 30 90 3611.41 2447 7354 3610.91 3225 4041 213576 305117 30.00%
miss 16.69% 31.34 11 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 102 0.2% 2.0 179.94s 15107 0 Direct 2.0 11494 23042 15107 31.3% 0.0%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 30217.72 30217.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.71% 1.37 0 2 11493.86 10393 18165 10373.98 0 18165 15798 15798 0.00%
crit 31.29% 0.63 0 2 23041.69 20786 36331 12196.11 0 36331 14420 14420 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Breath of Sindragosa 0 (10187) 0.0% (19.9%) 2.9 120.98s 1035765 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [j]:2.94
  • if_expr:!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
    Breath of Sindragosa (_damage) 10187 19.9% 126.4 2.09s 24071 0 Direct 126.4 18321 36559 24071 31.5% 0.0%

Stats Details: Breath Of Sindragosa Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 126.40 126.40 0.00 0.00 0.00 0.0000 0.0000 3042516.49 3042516.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.47% 86.55 36 139 18321.40 9474 41486 18357.62 16260 21051 1585715 1585715 0.00%
crit 31.53% 39.85 10 69 36558.72 19204 81093 36628.75 31559 43859 1456802 1456802 0.00%

Action Details: Breath Of Sindragosa Damage

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Burnout Wave 734 1.4% 3.0 119.95s 74525 0 Direct 2.8 60242 120352 79292 31.7% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 2.77 0.00 0.00 0.00 0.0000 0.0000 220018.31 220018.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.30% 1.90 0 3 60241.57 22015 69346 57581.10 0 69346 114173 114173 0.00%
crit 31.70% 0.88 0 3 120352.13 44029 138692 77978.07 0 138692 105845 105845 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 15 0.0% 0.8 74.09s 6006 4668 Periodic 8.2 422 846 555 31.3% 0.0% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.76 0.00 0.00 8.21 0.00 1.2872 0.0000 4550.95 4550.95 0.00% 4667.64 4667.64
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.72% 5.64 0 45 422.10 312 712 224.33 0 606 2380 2380 0.00%
crit 31.28% 2.57 0 22 845.57 624 1389 441.66 0 1147 2171 2171 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    breath
    [X]:0.76
  • if_expr:(set_bonus.tier31_4pc&variable.st_planning&talent.unholy_ground&!death_and_decay.ticking&runic_power.deficit>=10)|runic_power<36&rune.time_to_2>runic_power%18

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Dragon Games Equipment 1022 2.0% 6.9 29.37s 44276 0 Direct 6.9 33776 67511 44299 31.2% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 0.00 0.0000 0.0000 306488.82 437852.34 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.80% 4.76 0 9 33775.84 33171 34829 33769.04 0 34829 160781 229693 29.98%
crit 31.20% 2.16 0 7 67510.82 66341 69658 61384.96 0 69658 145708 208159 27.27%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 2615 5.1% 59.1 5.05s 13266 0 Periodic 98.7 6057 12088 7951 31.4% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.15 0.00 98.69 98.69 58.13 0.0000 2.9997 784676.88 784676.88 0.00% 2650.74 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.58% 67.68 42 95 6056.57 33 15137 6056.57 5454 6601 409910 409910 0.00%
crit 31.42% 31.00 10 55 12087.51 119 30275 12085.57 10175 13814 374766 374766 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.33
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountFrost Death Knight1370065PCT0.280
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Frost Strike 2691 (4038) 5.3% (8.0%) 46.3 4.72s 26296 19706 Direct 46.3 (92.6) 13362 26631 17525 31.4% (31.4%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.30 46.30 0.00 0.00 0.00 1.3345 0.0000 811403.60 811403.60 0.00% 19705.58 19705.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.63% 31.77 13 60 13362.40 8010 26848 13341.96 11798 14911 424579 424579 0.00%
crit 31.37% 14.53 1 34 26631.13 16280 53025 26577.80 21361 32230 386824 386824 0.00%

Action Details: Frost Strike

  • id:222026
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}

Action Priority List

    high_prio_actions
    [m]:4.97
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [o]:21.74
  • if_expr:buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
    single_target
    [r]:3.25
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [v]:16.34
  • if_expr:!variable.pooling_runic_power

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountImproved Frost Strike3168031PCT0.200
    Frost Strike Off-Hand 1347 2.7% 46.3 4.72s 8772 0 Direct 46.3 6680 13316 8772 31.5% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.30 46.30 0.00 0.00 0.00 0.0000 0.0000 406105.69 406105.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.48% 31.70 11 59 6679.65 4070 13424 6669.01 5753 7412 211759 211759 0.00%
crit 31.52% 14.59 2 33 13316.39 8010 25887 13293.30 10693 16122 194347 194347 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Frost Strike3168031PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Howling Blast 6851 (8206) 13.4% (16.1%) 59.1 5.05s 41508 34518 Direct 59.1 (118.3) 26366 52708 34654 31.5% (31.5%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.15 59.15 0.00 0.00 0.00 1.2025 0.0000 2049690.26 2049690.26 0.00% 34517.56 34517.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.54% 40.54 20 62 26366.46 3129 62654 26372.75 23256 29683 1068890 1068890 0.00%
crit 31.46% 18.61 5 36 52707.86 5622 123885 52715.00 41258 67081 980801 980801 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [T]:36.41
  • if_expr:variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
    breath
    [Y]:0.28
  • if_expr:runic_power<36&rune.time_to_2>runic_power%18
    breath
    [a]:0.31
  • if_expr:buff.rime.react
    single_target
    [q]:22.15
  • if_expr:buff.rime.react&talent.icebreaker.rank=2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Rime5905223.000Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Percent Cost Rime590521-1.000Spell Data
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
    Avalanche 1355 2.7% 59.1 5.05s 6855 0 Direct 59.1 5215 10422 6855 31.5% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.14 59.14 0.00 0.00 0.00 0.0000 0.0000 405440.45 405440.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.50% 40.52 19 61 5215.46 2842 12417 5216.64 4586 5973 211303 211303 0.00%
crit 31.50% 18.63 5 37 10422.22 5684 24279 10420.39 7966 12853 194137 194137 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Obliterate 1356 (11618) 2.7% (22.8%) 45.0 6.49s 77313 27950 Direct 45.0 (204.8) 6841 13792 9014 31.3% (69.8%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 45.02 45.02 0.00 0.00 0.00 2.7661 0.0000 405874.76 579835.86 30.00% 27949.77 27949.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.73% 30.95 12 51 6841.21 4335 13967 6850.49 6026 8352 211709 302449 30.00%
crit 31.27% 14.08 3 30 13792.21 8670 43401 13796.07 10553 18076 194166 277387 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]

Action Priority List

    breath
    [V]:22.55
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [W]:30.04
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Z]:5.94
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [p]:29.48
  • if_expr:buff.killing_machine.react
    single_target
    [s]:14.37
  • if_expr:!variable.pooling_runes&buff.remorseless_winter.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
    Obliterate Off-Hand 681 1.3% 45.0 6.49s 4528 0 Direct 45.0 3420 6933 4528 31.5% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 45.02 45.02 0.00 0.00 0.00 0.0000 0.0000 203878.53 291262.47 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.46% 30.82 11 51 3420.32 2168 6983 3424.94 2987 4062 105419 150603 30.00%
crit 31.54% 14.20 3 31 6932.79 4335 22737 6939.25 5329 9213 98459 140660 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
    Obliterate (_km) 6387 12.5% 57.4 5.16s 33372 0 Direct 57.4 0 33372 33372 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.36 57.36 0.00 0.00 0.00 0.0000 0.0000 1914189.94 1914189.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 57.36 33 84 33372.41 18677 80695 33349.03 29738 37161 1914190 1914190 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
    Obliterate Off-Hand (_km) 3193 6.3% 57.4 5.16s 16685 0 Direct 57.4 0 16685 16685 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.36 57.36 0.00 0.00 0.00 0.0000 0.0000 957005.02 957005.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 57.36 33 84 16684.99 9339 40348 16673.29 14869 18580 957005 957005 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Raise Dead 0 (1382) 0.0% (2.7%) 3.0 121.62s 140111 0

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [k]:2.96
    auto_attack 1716  / 927 1.8% 95.0 2.90s 2928 1902 Direct 95.0 2225 4460 2928 31.4% 0.0%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.98 94.98 0.00 0.00 0.00 1.5395 0.0000 278055.02 397231.59 30.00% 1901.71 1901.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.57% 65.13 38 87 2225.39 1426 4449 2228.55 1973 2533 144940 207062 30.00%
crit 31.43% 29.85 10 50 4460.05 2716 8899 4466.19 3805 5580 133116 190170 30.00%

Action Details: Auto Attack

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:2.92
    Claw 839  / 454 0.9% 52.2 5.36s 2603 2603 Direct 52.2 1978 3959 2603 31.5% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.23 52.23 0.00 0.00 0.00 1.0000 0.0000 135931.69 194193.08 30.00% 2602.71 2602.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.45% 35.75 16 52 1977.52 1222 4004 1979.76 1675 2282 70696 100997 30.00%
crit 31.55% 16.48 3 30 3959.15 2444 8009 3963.22 3101 5076 65235 93196 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.23
  • if_expr:energy>70
    Gnaw 2  / 1 0.0% 2.9 121.63s 88 88 Direct 2.9 66 133 88 32.1% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.90 2.90 0.00 0.00 0.00 1.0000 0.0000 254.81 364.02 30.00% 87.80 87.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.89% 1.97 0 3 66.41 43 110 63.67 0 103 131 187 28.74%
crit 32.11% 0.93 0 3 133.02 91 216 88.93 0 216 124 177 20.05%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.90
Remorseless Winter 0 (6129) 0.0% (12.0%) 15.3 20.33s 120265 95657

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.27 0.00 0.00 0.00 0.00 1.2573 0.0000 0.00 0.00 0.00% 95656.57 95656.57

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    high_prio_actions
    [n]:15.27
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 6129 12.0% 242.7 1.24s 7564 0 Direct 242.7 5758 11503 7564 31.4% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 242.73 242.73 0.00 0.00 0.00 0.0000 0.0000 1836032.13 1836032.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.56% 166.42 113 221 5758.07 1254 17728 5759.72 4912 6673 958249 958249 0.00%
crit 31.44% 76.31 40 116 11503.41 2508 35457 11505.58 9240 13865 877783 877783 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Periodic AmountBiting Cold3770562PCT0.350
Spell Direct AmountBiting Cold3770563PCT0.350

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Gathering Storm21180510.100Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Everfrost37697410.060
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Strike Twice 207 0.4% 20.3 14.44s 3061 0 Direct 20.3 2323 4646 3061 31.8% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.25 20.25 0.00 0.00 0.00 0.0000 0.0000 61990.74 88560.46 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.24% 13.82 4 27 2322.96 2296 2411 2322.94 2296 2380 32105 45866 30.00%
crit 31.76% 6.43 0 19 4645.82 4593 4822 4641.26 0 4822 29885 42694 29.97%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 207 0.4% 20.3 14.32s 3055 0 Direct 20.3 2323 4646 3055 31.5% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.30 20.30 0.00 0.00 0.00 0.0000 0.0000 62011.47 88590.07 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.51% 13.91 3 30 2323.01 2296 2411 2322.94 2296 2377 32310 46158 30.00%
crit 31.49% 6.39 0 19 4646.15 4593 4822 4640.19 0 4822 29702 42432 29.97%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Frost 172
Anti-Magic Shell 174 101.0% 6.9 41.91s 7543 0 Direct 3.3 16014 0 16014 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.91 3.25 0.00 0.00 0.00 0.0000 0.0000 52104.58 52104.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.25 0 14 16013.62 16014 16014 13788.50 0 16014 52105 52105 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [l]:6.91
  • if_expr:runic_power.deficit>40&death_knight.first_ams_cast<time

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownAnti-Magic Barrier2057271ADD-20000.000
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Arcane Torrent 2.3 130.28s

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.31 0.00 0.00 0.00 0.00 1.2850 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [b]:0.79
  • if_expr:runic_power<60
    single_target
    [u]:1.51
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 4.0 82.90s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [d]:0.29
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
    cooldowns
    [e]:3.66
  • if_expr:buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929621SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929631SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382154
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 4.2 72.64s

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.16 0.00 0.00 0.00 0.00 1.1900 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [U]:2.93
  • if_expr:rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
    single_target
    [t]:1.23
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Pillar of Frost 8.7 35.88s

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.71 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [h]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [i]:8.39
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Elemental Potion of Ultimate Power 1.5 304.84s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [c]:1.45
  • if_expr:(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
Unholy Strength 20.2 14.41s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.21 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 121.0s 121.0s 11.8s 11.80% 0.00% 32.2 (32.2) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 123.9s
  • trigger_min/max:120.0s / 123.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:9.79% / 14.22%

Stack Uptimes

  • abomination_limb_1:11.80%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Anti-Magic Shell 6.9 0.0 41.9s 41.9s 6.9s 15.93% 19.23% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.40
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 85.5s
  • trigger_min/max:40.0s / 85.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:11.21% / 18.07%

Stack Uptimes

  • antimagic_shell_1:15.93%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 10.5 37.2 29.3s 6.2s 19.0s 66.33% 0.00% 0.0 (0.0) 3.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 73.7s
  • trigger_min/max:0.9s / 48.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.5s
  • uptime_min/max:50.17% / 84.74%

Stack Uptimes

  • bonegrinder_crit_1:17.21%
  • bonegrinder_crit_2:14.97%
  • bonegrinder_crit_3:12.84%
  • bonegrinder_crit_4:11.29%
  • bonegrinder_crit_5:10.02%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 6.0 0.0 48.1s 48.1s 9.8s 19.77% 16.57% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:18.3s / 243.1s
  • trigger_min/max:18.3s / 243.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.55% / 32.00%

Stack Uptimes

  • bonegrinder_frost_1:19.77%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 3.0 14.6 120.8s 15.1s 19.4s 19.22% 0.00% 2.0 (2.0) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 128.0s
  • trigger_min/max:0.0s / 119.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:16.13% / 22.70%

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.87%
  • bound_by_fire_and_blaze_2:4.39%
  • bound_by_fire_and_blaze_3:4.25%
  • bound_by_fire_and_blaze_4:3.66%
  • bound_by_fire_and_blaze_5:2.73%
  • bound_by_fire_and_blaze_6:3.34%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 121.0s 121.0s 43.0s 42.25% 0.00% 126.1 (126.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 127.5s
  • trigger_min/max:120.0s / 127.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 103.0s
  • uptime_min/max:21.13% / 63.49%

Stack Uptimes

  • breath_of_sindragosa_1:42.25%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.5s 59.0s 50.6s 80.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 335.0s
  • trigger_min/max:15.0s / 326.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.7s
  • uptime_min/max:48.07% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.34%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dragon Games Equipment 2.8 0.0 120.9s 120.9s 0.8s 0.72% 0.00% 6.9 (6.9) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.86
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 128.0s
  • trigger_min/max:120.0s / 128.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.9s
  • uptime_min/max:0.51% / 0.97%

Stack Uptimes

  • dragon_games_equipment_1:0.72%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 304.9s 304.9s 27.1s 12.87% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 330.2s
  • trigger_min/max:300.0s / 330.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.73% / 17.93%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.87%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 83.3s 82.8s 19.6s 25.85% 0.00% 11.6 (11.6) 3.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 263.0s
  • trigger_min/max:0.0s / 263.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.1s
  • uptime_min/max:15.15% / 30.19%

Stack Uptimes

  • empower_rune_weapon_1:25.85%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 8.4 0.0 35.9s 35.9s 12.6s 35.15% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.1s / 53.1s
  • trigger_min/max:26.1s / 53.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 26.0s
  • uptime_min/max:25.13% / 44.59%

Stack Uptimes

  • enduring_strength_1:35.15%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 8.6 20.6 36.2s 10.0s 9.9s 28.26% 98.71% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.3s / 89.3s
  • trigger_min/max:0.9s / 84.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:16.64% / 35.81%

Stack Uptimes

  • enduring_strength_builder_1:10.42%
  • enduring_strength_builder_2:8.65%
  • enduring_strength_builder_3:5.24%
  • enduring_strength_builder_4:2.46%
  • enduring_strength_builder_5:1.04%
  • enduring_strength_builder_6:0.35%
  • enduring_strength_builder_7:0.08%
  • enduring_strength_builder_8:0.01%
  • enduring_strength_builder_9:0.00%
  • enduring_strength_builder_10:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storm 12.9 124.8 24.1s 2.2s 15.8s 68.08% 86.91% 68.9 (109.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.9s / 102.0s
  • trigger_min/max:0.9s / 32.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 95.3s
  • uptime_min/max:57.72% / 79.13%

Stack Uptimes

  • gathering_storm_1:1.82%
  • gathering_storm_2:5.57%
  • gathering_storm_3:4.52%
  • gathering_storm_4:3.87%
  • gathering_storm_5:5.52%
  • gathering_storm_6:3.80%
  • gathering_storm_7:4.28%
  • gathering_storm_8:3.58%
  • gathering_storm_9:2.76%
  • gathering_storm_10:32.36%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 1.0 171.4 182.0s 1.7s 283.6s 97.94% 0.00% 169.3 (169.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:77.5s / 300.0s
  • trigger_min/max:1.0s / 14.3s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 354.7s
  • uptime_min/max:95.89% / 98.58%

Stack Uptimes

  • icy_talons_1:0.36%
  • icy_talons_2:0.35%
  • icy_talons_3:97.22%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 46.2 13.1 6.4s 5.0s 2.2s 33.79% 56.13% 1.5 (1.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 51.0s
  • trigger_min/max:0.0s / 45.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.8s
  • uptime_min/max:16.42% / 53.98%

Stack Uptimes

  • killing_machine_1:28.89%
  • killing_machine_2:4.91%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 8.7 0.0 35.9s 35.9s 11.8s 34.18% 36.32% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.1s / 53.1s
  • trigger_min/max:26.1s / 53.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:30.47% / 38.12%

Stack Uptimes

  • pillar_of_frost_1:34.18%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 8.7 55.7 36.0s 4.5s 11.3s 32.71% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:23.7s / 53.1s
  • trigger_min/max:0.9s / 45.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:24.19% / 37.22%

Stack Uptimes

  • pillar_of_frost_bonus_1:2.24%
  • pillar_of_frost_bonus_2:3.24%
  • pillar_of_frost_bonus_3:3.77%
  • pillar_of_frost_bonus_4:2.87%
  • pillar_of_frost_bonus_5:3.40%
  • pillar_of_frost_bonus_6:3.21%
  • pillar_of_frost_bonus_7:2.63%
  • pillar_of_frost_bonus_8:2.45%
  • pillar_of_frost_bonus_9:1.78%
  • pillar_of_frost_bonus_10:1.32%
  • pillar_of_frost_bonus_11:1.14%
  • pillar_of_frost_bonus_12:0.96%
  • pillar_of_frost_bonus_13:0.90%
  • pillar_of_frost_bonus_14:0.80%
  • pillar_of_frost_bonus_15:0.63%
  • pillar_of_frost_bonus_16:0.45%
  • pillar_of_frost_bonus_17:0.29%
  • pillar_of_frost_bonus_18:0.21%
  • pillar_of_frost_bonus_19:0.19%
  • pillar_of_frost_bonus_20:0.14%
  • pillar_of_frost_bonus_21:0.07%
  • pillar_of_frost_bonus_22:0.02%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 13.0 2.3 24.1s 20.3s 17.5s 75.94% 0.00% 223.0 (223.0) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 102.7s
  • trigger_min/max:20.0s / 26.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 97.3s
  • uptime_min/max:68.00% / 85.01%

Stack Uptimes

  • remorseless_winter_1:75.94%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 59.5 10.6 5.0s 4.3s 1.9s 37.15% 99.99% 10.6 (10.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 53.8s
  • trigger_min/max:0.0s / 53.8s
  • trigger_pct:63.17%
  • duration_min/max:0.0s / 29.5s
  • uptime_min/max:24.22% / 52.40%

Stack Uptimes

  • rime_1:37.15%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.3 13.3 22.6s 11.0s 11.5s 51.17% 0.00% 13.3 (13.3) 12.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 159.5s
  • trigger_min/max:0.9s / 148.8s
  • trigger_pct:14.97%
  • duration_min/max:0.0s / 75.8s
  • uptime_min/max:24.13% / 77.54%

Stack Uptimes

  • rune_mastery_1:51.17%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.5 23.2s 14.4s 10.1s 43.24% 42.05% 7.5 (7.5) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 101.7s
  • trigger_min/max:0.0s / 61.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.0s
  • uptime_min/max:23.81% / 67.88%

Stack Uptimes

  • rune_of_hysteria_1:43.24%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Ground 0.7 0.1 125.9s 74.4s 10.2s 2.23% 0.00% 0.1 (0.1) 0.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 241.4s
  • trigger_min/max:1.2s / 239.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 235.3s
  • uptime_min/max:0.00% / 46.24%

Stack Uptimes

  • unholy_ground_1:2.23%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 11.8 35.8s 14.4s 23.5s 66.23% 0.00% 11.8 (11.8) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 149.1s
  • trigger_min/max:0.0s / 65.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 139.4s
  • uptime_min/max:41.41% / 90.66%

Stack Uptimes

  • unholy_strength_1:66.23%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 1.0 171.4 182.0s 1.7s 283.6s 97.94% 0.00% 169.3 (169.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:77.5s / 300.0s
  • trigger_min/max:1.0s / 14.3s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 354.7s
  • uptime_min/max:95.89% / 98.58%

Stack Uptimes

  • unleashed_frenzy_1:0.36%
  • unleashed_frenzy_2:0.35%
  • unleashed_frenzy_3:97.22%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=10 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (sizzling_seafood_medley)

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_sizzling_seafood_medley
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382154
  • name:Well Fed
  • tooltip:Haste and mastery increased by {$=}w1.
  • description:Increases Haste and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 26.8 10.0 49.0 10.9s 1.3s 141.7s
Windfury (Off Hand) 22.4 7.0 42.0 13.0s 1.3s 160.6s
Killing Machine spent on Obliterate 57.4 33.0 84.0 5.2s 0.9s 47.0s
Killing Machine: Critical auto attacks 57.8 33.0 85.0 5.5s 1.3s 45.6s
Killing Machine wasted: Critical auto attacks 1.5 0.0 9.0 65.8s 1.3s 329.3s
Rune ready 217.4 153.0 281.0 1.5s 0.0s 19.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 1.74% 0.00% 8.02% 0.6s 0.0s 6.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Horn of Winter26.0640.000223.173124.43360.176269.216
Remorseless Winter0.3010.0006.7734.6050.47013.530
Death and Decay113.0620.000307.916278.563123.424359.960
Empower Rune Weapon1.3730.000127.5825.4234.118132.737
Abomination Limb0.9860.0003.9182.9391.0297.198
Pillar of Frost1.3710.0009.84611.9495.42128.414
Breath of Sindragosa2.3820.0007.5087.0154.12213.610
Raise Dead1.7730.0004.1245.2492.3689.004
Anti-Magic Shell6.1010.00055.25042.44020.82989.712

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=503063)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0851.865 / 1.3395.83028.108
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
29.68572.188125.082 / 122.762186.668325.609

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Anti-Magic ShellRunic Power3.2515.990.43%4.910.281.73%
Breath of SindragosaRune11.1510.724.93%0.960.433.86%
Empower Rune WeaponRunic Power19.1789.902.41%4.695.976.23%
Empower Rune WeaponRune19.1718.968.72%0.990.211.12%
Frost FeverRunic Power32.67157.644.22%4.835.693.48%
Horn of WinterRunic Power4.16103.972.78%25.000.000.00%
Horn of WinterRune8.328.323.83%1.000.000.01%
Murderous EfficiencyRune28.6728.6713.19%1.000.000.00%
Rage of the Frozen ChampionRunic Power59.14468.1112.53%7.925.021.06%
Rune RegenerationRune78.7678.7636.23%1.000.000.00%
Rune of HysteriaRunic Power155.16321.448.60%2.0721.036.14%
Runic AttenuationRunic Power71.54349.949.36%4.897.792.18%
Runic EmpowermentRune73.2271.9633.10%0.981.261.73%
Arcane TorrentRunic Power2.3146.171.24%20.000.000.00%
Death and DecayRunic Power0.767.580.20%10.000.000.00%
Howling BlastRunic Power59.150.060.00%0.000.000.00%
ObliterateRunic Power102.392026.8754.24%19.8020.841.02%
Remorseless WinterRunic Power15.27149.444.00%9.793.232.11%
pet - ghoul
Energy RegenEnergy1095.781920.86100.00%1.75166.497.98%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_damage)Runic Power 126.102269.8462.04%18.0017.961340.41
Death and DecayRune 0.760.760.34%1.001.006006.80
Frost StrikeRunic Power 46.301388.9837.96%30.0030.00876.55
Howling BlastRune 59.150.010.00%0.000.00409243010.19
ObliterateRune 102.39204.7792.74%2.004.5516999.26
Remorseless WinterRune 15.2715.276.91%1.001.00120265.44
pet - ghoul
ClawEnergy 52.232089.12100.00%40.0040.0065.07
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 330760.0 748.98 870.65 256707.5 294260.0 -71226.1 330760.0
Runic Power 0.0 12.46 12.20 69.9 78.3 0.1 124.0
Rune 6.0 0.72 0.74 0.0 2.6 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 51036.28
Minimum 42808.21
Maximum 61023.99
Spread ( max - min ) 18215.78
Range [ ( max - min ) / 2 * 100% ] 17.85%
Standard Deviation 2563.1454
5th Percentile 46945.22
95th Percentile 55234.11
( 95th Percentile - 5th Percentile ) 8288.89
Mean Distribution
Standard Deviation 29.5986
95.00% Confidence Interval ( 50978.26 - 51094.29 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 97
0.1% Error 9690
0.1 Scale Factor Error with Delta=300 56083
0.05 Scale Factor Error with Delta=300 224332
0.01 Scale Factor Error with Delta=300 5608287
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 51036.28
Minimum 42808.21
Maximum 61023.99
Spread ( max - min ) 18215.78
Range [ ( max - min ) / 2 * 100% ] 17.85%
Standard Deviation 2563.1454
5th Percentile 46945.22
95th Percentile 55234.11
( 95th Percentile - 5th Percentile ) 8288.89
Mean Distribution
Standard Deviation 29.5986
95.00% Confidence Interval ( 50978.26 - 51094.29 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 97
0.1% Error 9690
0.1 Scale Factor Error with Delta=300 56083
0.05 Scale Factor Error with Delta=300 224332
0.01 Scale Factor Error with Delta=300 5608287
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 51036.28
Minimum 42808.21
Maximum 61023.99
Spread ( max - min ) 18215.78
Range [ ( max - min ) / 2 * 100% ] 17.85%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 14871799.49
Minimum 10199629.94
Maximum 19159861.87
Spread ( max - min ) 8960231.93
Range [ ( max - min ) / 2 * 100% ] 30.12%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 870.22
Minimum 0.00
Maximum 2367.67
Spread ( max - min ) 2367.67
Range [ ( max - min ) / 2 * 100% ] 136.04%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 747.10
Minimum 0.00
Maximum 1886.05
Spread ( max - min ) 1886.05
Range [ ( max - min ) / 2 * 100% ] 126.22%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
B 0.00 variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
E 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
F 0.00 variable,name=2h_check,value=main_hand.2h
G 0.00 variable,name=erw_pooling_time,op=setif,value=30,value_else=45,condition=death_knight.ams_absorb_percent>0.59
Protects Breath from starving itself on ERW charges depending on anticipated resource gains. More resources enable more aggressive use.
Default action list Executed every time the actor is available.
# count action,conditions
H 1.00 auto_attack
I 0.00 call_action_list,name=variables
Choose Action list to run
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=high_prio_actions
L 0.00 call_action_list,name=cooldowns
M 0.00 call_action_list,name=racials
N 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
O 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
P 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
Q 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
R 0.00 call_action_list,name=aoe,if=active_enemies>=2
S 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
T 36.41 howling_blast,if=variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
Breath Active Rotation
U 2.93 horn_of_winter,if=rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
V 22.55 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&(buff.killing_machine.react|runic_power>45)
W 30.04 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up
0.00 remorseless_winter,if=runic_power<36&rune.time_to_2>runic_power%18
X 0.76 death_and_decay,if=(set_bonus.tier31_4pc&variable.st_planning&talent.unholy_ground&!death_and_decay.ticking&runic_power.deficit>=10)|runic_power<36&rune.time_to_2>runic_power%18
Y 0.28 howling_blast,if=runic_power<36&rune.time_to_2>runic_power%18
Z 5.94 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
a 0.31 howling_blast,if=buff.rime.react
b 0.79 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
c 1.45 potion,if=(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
Cooldowns
d 0.29 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
e 3.66 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
f 0.12 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
g 2.85 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=set_bonus.tier31_2pc&buff.chilling_rage.remains<3
0.00 chill_streak,if=!set_bonus.tier31_2pc&active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
h 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
i 8.39 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
j 2.94 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
k 2.96 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react&rune>2|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>50|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.high_prio_actions
# count action,conditions
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
l 6.91 antimagic_shell,if=runic_power.deficit>40&death_knight.first_ams_cast<time
0.00 antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.ready|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up))
0.00 antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&((!talent.obliteration|talent.obliteration&(!cooldown.pillar_of_frost.ready|buff.pillar_of_frost.up&!buff.killing_machine.react))|(equipped.fyralath_the_dreamrender&!dot.mark_of_fyralath.ticking))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
m 4.97 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
n 15.27 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target
# count action,conditions
o 21.74 frost_strike,if=buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
Single Target Rotation
0.00 howling_blast,if=buff.rime.react&set_bonus.tier30_2pc&buff.killing_machine.stack<2
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
p 29.48 obliterate,if=buff.killing_machine.react
q 22.15 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)&talent.obliteration&talent.breath_of_sindragosa
r 3.25 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
s 14.37 obliterate,if=!variable.pooling_runes&buff.remorseless_winter.up
t 1.23 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
u 1.51 arcane_torrent,if=runic_power.deficit>20
v 16.34 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.pillar_of_frost.up&!buff.empower_rune_weapon.up&!death_and_decay.ticking&(active_enemies<2|dot.frost_fever.ticking)
Trinkets
0.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
w 2.95 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&((variable.damage_trinket_priority=1|trinket.2.cooldown.remains)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
x 2.77 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&((variable.damage_trinket_priority=2|trinket.1.cooldown.remains)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGHngkqssjweicWTVTVVWTVUTVVTVVnVTVVxZVTZTZTZTilVTWneTWTbVTWTVTWTWTVnVTWUVTWTWisqlppqmnpoqsoqopvvvpqnmsiqpopqovpqolpongkqjwVWTZTeWWWTWTVWniWVxVUWTWTVVWTlWTnsqsqpmqrpuovvpniqsmqvpporvpqlvvnpqsmqvppvvvpipqvnmppqvpqlsogkpjwTZTneVTVTVTWTWiTVWxTVWTnUVWTVWTlssvsqvvpnsqmhsqr

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 4 trinket_1_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 5 trinket_2_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 6 trinket_1_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 7 trinket_2_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat A trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat B damage_trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat E rw_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat F 2h_check PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat G erw_pooling_time PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
0:00.000 default H auto_attack Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
0:00.000 high_prio_actions n remorseless_winter Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune		 bloodlust, corrupting_rage
0:01.031 cooldowns g abomination_limb Fluffy_Pillow 10.0/124: 8% runic_power
5.0/6: 83% rune		 bloodlust, remorseless_winter, corrupting_rage
0:02.061 cooldowns k raise_dead PR_Death_Knight_Frost 15.0/124: 12% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, remorseless_winter, rime, corrupting_rage
0:02.061 single_target q howling_blast Fluffy_Pillow 15.0/124: 12% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, remorseless_winter, rime, corrupting_rage
0:03.092 single_target s obliterate Fluffy_Pillow 23.0/124: 19% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, abomination_limb, gathering_storm, remorseless_winter, corrupting_rage
0:04.123 single_target s obliterate Fluffy_Pillow 43.0/124: 35% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, abomination_limb, gathering_storm(3), remorseless_winter, corrupting_rage
0:05.154 cooldowns j breath_of_sindragosa Fluffy_Pillow 68.0/124: 55% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, abomination_limb, gathering_storm(5), remorseless_winter, corrupting_rage
0:05.154 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 68.0/124: 55% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, corrupting_rage
0:05.154 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 68.0/124: 55% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, bound_by_fire_and_blaze, corrupting_rage
0:05.154 cooldowns i pillar_of_frost PR_Death_Knight_Frost 73.0/124: 59% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), remorseless_winter, bound_by_fire_and_blaze, corrupting_rage
0:05.154 cooldowns c potion Fluffy_Pillow 73.0/124: 59% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, bound_by_fire_and_blaze, corrupting_rage
0:05.154 breath W obliterate Fluffy_Pillow 73.0/124: 59% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, bound_by_fire_and_blaze, corrupting_rage, elemental_potion_of_ultimate_power
0:06.051 breath T howling_blast Fluffy_Pillow 98.0/124: 79% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(7), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, enduring_strength_builder, bound_by_fire_and_blaze(2), elemental_potion_of_ultimate_power
0:06.947 breath V obliterate Fluffy_Pillow 93.0/124: 75% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons, breath_of_sindragosa, gathering_storm(8), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, enduring_strength_builder, unleashed_frenzy, bound_by_fire_and_blaze(2), elemental_potion_of_ultimate_power
0:07.844 breath T howling_blast Fluffy_Pillow 95.0/124: 77% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(2), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(2), bound_by_fire_and_blaze(2), elemental_potion_of_ultimate_power
0:08.741 breath V obliterate Fluffy_Pillow 90.0/124: 73% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_potion_of_ultimate_power
0:09.637 breath V obliterate Fluffy_Pillow 92.0/124: 74% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:10.534 breath W obliterate Fluffy_Pillow 99.0/124: 80% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:11.431 breath T howling_blast Fluffy_Pillow 101.0/124: 81% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:12.326 breath V obliterate Fluffy_Pillow 91.0/124: 73% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:13.222 breath U horn_of_winter PR_Death_Knight_Frost 93.0/124: 75% runic_power
0.0/6: 0% rune		 bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(6), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:14.119 breath T howling_blast Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(6), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:15.016 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(6), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:15.912 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(7), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:16.808 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(20), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(8), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:17.705 Waiting     0.083s 110.3/124: 89% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:17.788 breath V obliterate Fluffy_Pillow 110.3/124: 89% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:18.685 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:19.582 Waiting     0.188s 106.0/124: 85% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:19.770 high_prio_actions n remorseless_winter Fluffy_Pillow 106.0/124: 85% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:20.897 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_potion_of_ultimate_power
0:21.793 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage, elemental_potion_of_ultimate_power
0:22.690 breath V obliterate Fluffy_Pillow 96.0/124: 77% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:23.586 breath V obliterate Fluffy_Pillow 103.0/124: 83% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:24.480 Waiting     0.710s 106.0/124: 85% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:25.190 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 93.0/124: 75% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.190 breath Z obliterate Fluffy_Pillow 93.0/124: 75% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, corrupting_rage, elemental_potion_of_ultimate_power
0:26.221 breath V obliterate Fluffy_Pillow 100.0/124: 81% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:27.252 breath T howling_blast Fluffy_Pillow 102.0/124: 82% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:28.283 breath Z obliterate Fluffy_Pillow 92.0/124: 74% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:29.314 breath T howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:30.345 breath Z obliterate Fluffy_Pillow 89.0/124: 72% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:31.376 breath T howling_blast Fluffy_Pillow 95.8/124: 77% runic_power
0.0/6: 0% rune		 bloodlust, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:32.407 breath Z obliterate Fluffy_Pillow 87.7/124: 71% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:33.438 breath T howling_blast Fluffy_Pillow 94.5/124: 76% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:34.469 Waiting     0.453s 92.6/124: 75% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:34.922 cooldowns i pillar_of_frost PR_Death_Knight_Frost 92.6/124: 75% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:35.154 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 74.6/124: 60% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
0:35.154 breath V obliterate Fluffy_Pillow 74.6/124: 60% runic_power
3.0/6: 50% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
0:36.184 breath T howling_blast Fluffy_Pillow 93.8/124: 76% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, enduring_strength, unleashed_frenzy(3)
0:37.215 Waiting     1.736s 85.8/124: 69% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, enduring_strength, unleashed_frenzy(3)
0:38.951 breath W obliterate Fluffy_Pillow 79.0/124: 64% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, enduring_strength, unleashed_frenzy(3)
0:39.982 high_prio_actions n remorseless_winter Fluffy_Pillow 87.2/124: 70% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3)
0:41.216 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 69.8/124: 56% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3)
0:41.340 breath T howling_blast Fluffy_Pillow 76.0/124: 61% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3)
0:42.505 breath W obliterate Fluffy_Pillow 74.1/124: 60% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:43.669 breath T howling_blast Fluffy_Pillow 80.9/124: 65% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:44.834 Waiting     1.336s 79.0/124: 64% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:46.170 breath b arcane_torrent PR_Death_Knight_Frost 49.2/124: 40% runic_power
1.0/6: 17% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:47.335 breath V obliterate Fluffy_Pillow 62.2/124: 50% runic_power
3.0/6: 50% rune		 rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:48.500 breath T howling_blast Fluffy_Pillow 69.0/124: 56% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:49.665 breath W obliterate Fluffy_Pillow 59.0/124: 48% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:50.830 breath T howling_blast Fluffy_Pillow 66.0/124: 53% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:51.995 breath V obliterate Fluffy_Pillow 61.0/124: 49% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:53.159 breath T howling_blast Fluffy_Pillow 51.2/124: 41% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:54.323 breath W obliterate Fluffy_Pillow 49.3/124: 40% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:55.488 breath T howling_blast Fluffy_Pillow 56.1/124: 45% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:56.652 breath W obliterate Fluffy_Pillow 54.2/124: 44% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:57.816 breath T howling_blast Fluffy_Pillow 67.2/124: 54% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:58.981 breath V obliterate Fluffy_Pillow 59.2/124: 48% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
1:00.145 high_prio_actions n remorseless_winter Fluffy_Pillow 66.0/124: 53% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(3), unleashed_frenzy(3)
1:01.309 breath V obliterate Fluffy_Pillow 45.0/124: 36% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3)
1:02.648 breath T howling_blast Fluffy_Pillow 47.0/124: 38% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3)
1:03.988 breath W obliterate Fluffy_Pillow 37.0/124: 30% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3)
1:05.328 breath U horn_of_winter PR_Death_Knight_Frost 25.8/124: 21% runic_power
1.0/6: 17% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3)
1:06.668 breath V obliterate Fluffy_Pillow 38.8/124: 31% runic_power
3.0/6: 50% rune		 rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3)
1:08.008 breath T howling_blast Fluffy_Pillow 51.8/124: 42% runic_power
3.0/6: 50% rune		 rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(7), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3)
1:09.348 breath W obliterate Fluffy_Pillow 31.9/124: 26% runic_power
3.0/6: 50% rune		 rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3)
1:10.687 breath T howling_blast Fluffy_Pillow 38.7/124: 31% runic_power
2.0/6: 33% rune		 icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3)
1:12.027 breath W obliterate Fluffy_Pillow 28.7/124: 23% runic_power
3.0/6: 50% rune		 icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3)
1:13.367 cooldowns i pillar_of_frost PR_Death_Knight_Frost 17.7/124: 14% runic_power
4.0/6: 67% rune		 icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
1:13.367 single_target s obliterate Fluffy_Pillow 17.7/124: 14% runic_power
4.0/6: 67% rune		 icy_talons(3), gathering_storm(10), pillar_of_frost, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
1:14.706 single_target q howling_blast Fluffy_Pillow 42.7/124: 34% runic_power
3.0/6: 50% rune		 icy_talons(3), gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:16.045 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 50.7/124: 41% runic_power
3.0/6: 50% rune		 icy_talons(3), gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:16.045 single_target p obliterate Fluffy_Pillow 50.7/124: 41% runic_power
3.0/6: 50% rune		 antimagic_shell, icy_talons(3), gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:17.384 single_target p obliterate Fluffy_Pillow 75.7/124: 61% runic_power
3.0/6: 50% rune		 antimagic_shell, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:18.723 single_target q howling_blast Fluffy_Pillow 95.7/124: 77% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
1:20.063 high_prio_actions m frost_strike Fluffy_Pillow 103.7/124: 84% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
1:21.403 high_prio_actions n remorseless_winter Fluffy_Pillow 73.7/124: 59% runic_power
2.0/6: 33% rune		 antimagic_shell, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
1:22.743 single_target p obliterate Fluffy_Pillow 88.7/124: 72% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
1:24.083 single_target o frost_strike Fluffy_Pillow 108.7/124: 88% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
1:25.422 single_target q howling_blast Fluffy_Pillow 83.7/124: 67% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:26.762 single_target s obliterate Fluffy_Pillow 91.7/124: 74% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:28.102 single_target o frost_strike Fluffy_Pillow 111.7/124: 90% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:29.442 single_target q howling_blast Fluffy_Pillow 91.7/124: 74% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:30.781 single_target o frost_strike Fluffy_Pillow 104.7/124: 84% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:32.121 single_target p obliterate Fluffy_Pillow 74.7/124: 60% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:33.460 single_target v frost_strike Fluffy_Pillow 94.7/124: 76% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:34.799 single_target v frost_strike Fluffy_Pillow 64.7/124: 52% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:36.139 single_target v frost_strike Fluffy_Pillow 34.7/124: 28% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:37.479 Waiting     1.373s 4.7/124: 4% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:38.852 single_target p obliterate Fluffy_Pillow 9.7/124: 8% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:40.191 single_target q howling_blast Fluffy_Pillow 29.7/124: 24% runic_power
5.0/6: 83% rune		 icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:41.531 high_prio_actions n remorseless_winter Fluffy_Pillow 50.1/124: 40% runic_power
5.0/6: 83% rune		 rune_of_hysteria, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:42.871 high_prio_actions m frost_strike Fluffy_Pillow 62.5/124: 50% runic_power
4.0/6: 67% rune		 rune_of_hysteria, icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:44.211 single_target s obliterate Fluffy_Pillow 32.5/124: 26% runic_power
4.0/6: 67% rune		 rune_of_hysteria, icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:45.551 cooldowns i pillar_of_frost PR_Death_Knight_Frost 57.3/124: 46% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:45.551 single_target q howling_blast Fluffy_Pillow 57.3/124: 46% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), gathering_storm(2), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:46.891 single_target p obliterate Fluffy_Pillow 73.4/124: 59% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:48.231 single_target o frost_strike Fluffy_Pillow 110.6/124: 89% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(5), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:49.570 single_target p obliterate Fluffy_Pillow 80.6/124: 65% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), gathering_storm(5), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:50.910 single_target q howling_blast Fluffy_Pillow 100.6/124: 81% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(7), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:52.250 single_target o frost_strike Fluffy_Pillow 113.6/124: 92% runic_power
1.0/6: 17% rune		 icy_talons(3), gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:53.590 single_target v frost_strike Fluffy_Pillow 83.6/124: 67% runic_power
3.0/6: 50% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:54.930 single_target p obliterate Fluffy_Pillow 53.6/124: 43% runic_power
4.0/6: 67% rune		 rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:56.270 single_target q howling_blast Fluffy_Pillow 90.8/124: 73% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
1:57.610 single_target o frost_strike Fluffy_Pillow 100.7/124: 81% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:58.950 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 70.7/124: 57% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:58.950 single_target p obliterate Fluffy_Pillow 70.7/124: 57% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:00.289 single_target o frost_strike Fluffy_Pillow 101.7/124: 82% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:01.629 high_prio_actions n remorseless_winter Fluffy_Pillow 71.7/124: 58% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:02.969 cooldowns g abomination_limb Fluffy_Pillow 86.7/124: 70% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:04.309 cooldowns k raise_dead PR_Death_Knight_Frost 91.7/124: 74% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, abomination_limb, icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:04.309 single_target q howling_blast Fluffy_Pillow 91.7/124: 74% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, abomination_limb, icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:05.647 cooldowns j breath_of_sindragosa Fluffy_Pillow 99.7/124: 80% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, abomination_limb, icy_talons(3), gathering_storm, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:05.647 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 99.7/124: 80% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:05.647 Waiting     0.450s 99.7/124: 80% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
2:06.097 breath V obliterate Fluffy_Pillow 99.7/124: 80% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:07.437 Waiting     0.282s 101.7/124: 82% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:07.719 breath W obliterate Fluffy_Pillow 83.7/124: 68% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:09.059 breath T howling_blast Fluffy_Pillow 90.7/124: 73% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:10.398 breath Z obliterate Fluffy_Pillow 85.7/124: 69% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:11.735 breath T howling_blast Fluffy_Pillow 79.7/124: 64% runic_power
2.0/6: 33% rune		 rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:12.669 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 69.7/124: 56% runic_power
2.0/6: 33% rune		 rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:13.075 breath W obliterate Fluffy_Pillow 74.7/124: 60% runic_power
3.0/6: 50% rune		 rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3)
2:14.239 breath W obliterate Fluffy_Pillow 76.7/124: 62% runic_power
2.0/6: 33% rune		 rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3)
2:15.404 breath W obliterate Fluffy_Pillow 83.7/124: 68% runic_power
3.0/6: 50% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3)
2:16.569 breath T howling_blast Fluffy_Pillow 85.7/124: 69% runic_power
3.0/6: 50% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3)
2:17.733 breath W obliterate Fluffy_Pillow 67.7/124: 55% runic_power
6.0/6: 100% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4)
2:18.898 breath T howling_blast Fluffy_Pillow 69.7/124: 56% runic_power
4.0/6: 67% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4)
2:20.062 breath V obliterate Fluffy_Pillow 61.6/124: 50% runic_power
5.0/6: 83% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4)
2:21.227 breath W obliterate Fluffy_Pillow 68.4/124: 55% runic_power
4.0/6: 67% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4)
2:22.392 high_prio_actions n remorseless_winter Fluffy_Pillow 75.2/124: 61% runic_power
3.0/6: 50% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4)
2:23.557 cooldowns i pillar_of_frost PR_Death_Knight_Frost 82.0/124: 66% runic_power
4.0/6: 67% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4)
2:23.557 breath W obliterate Fluffy_Pillow 82.0/124: 66% runic_power
4.0/6: 67% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4)
2:24.722 breath V obliterate Fluffy_Pillow 77.0/124: 62% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4)
2:25.669 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 83.8/124: 68% runic_power
3.0/6: 50% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3)
2:25.886 breath V obliterate Fluffy_Pillow 83.8/124: 68% runic_power
3.0/6: 50% rune		 rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), dragon_games_equipment
2:27.049 breath U horn_of_winter PR_Death_Knight_Frost 90.6/124: 73% runic_power
1.0/6: 17% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3)
2:28.214 breath W obliterate Fluffy_Pillow 102.6/124: 83% runic_power
5.0/6: 83% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
2:29.379 breath T howling_blast Fluffy_Pillow 114.6/124: 92% runic_power
3.0/6: 50% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:30.544 breath W obliterate Fluffy_Pillow 104.6/124: 84% runic_power
3.0/6: 50% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:31.708 breath T howling_blast Fluffy_Pillow 88.0/124: 71% runic_power
1.0/6: 17% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
2:32.873 breath V obliterate Fluffy_Pillow 83.0/124: 67% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
2:34.213 breath V obliterate Fluffy_Pillow 90.0/124: 73% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), corrupting_rage
2:35.553 Waiting     0.909s 92.0/124: 74% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_frost, enduring_strength_builder(6), unleashed_frenzy(3), corrupting_rage
2:36.462 breath W obliterate Fluffy_Pillow 74.0/124: 60% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:37.801 breath T howling_blast Fluffy_Pillow 58.0/124: 47% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:39.141 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 53.0/124: 43% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:39.141 breath W obliterate Fluffy_Pillow 53.0/124: 43% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:40.481 breath T howling_blast Fluffy_Pillow 55.0/124: 44% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:41.820 Waiting     0.475s 27.0/124: 22% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:42.295 high_prio_actions n remorseless_winter Fluffy_Pillow 32.0/124: 26% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:43.732 single_target s obliterate Fluffy_Pillow 8.4/124: 7% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:45.072 single_target q howling_blast Fluffy_Pillow 39.4/124: 32% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(2), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:46.412 single_target s obliterate Fluffy_Pillow 55.5/124: 45% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:47.751 single_target q howling_blast Fluffy_Pillow 80.3/124: 65% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:49.091 single_target p obliterate Fluffy_Pillow 96.4/124: 78% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(6), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:50.431 high_prio_actions m frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(8), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:51.771 single_target q howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(8), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:53.110 single_target r frost_strike Fluffy_Pillow 102.0/124: 82% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(9), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:54.450 single_target p obliterate Fluffy_Pillow 72.0/124: 58% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(9), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:55.790 single_target u arcane_torrent PR_Death_Knight_Frost 97.0/124: 78% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
2:57.129 single_target o frost_strike Fluffy_Pillow 117.0/124: 94% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
2:58.469 single_target v frost_strike Fluffy_Pillow 87.0/124: 70% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
2:59.809 single_target v frost_strike Fluffy_Pillow 62.0/124: 50% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:01.149 single_target p obliterate Fluffy_Pillow 32.0/124: 26% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:02.488 high_prio_actions n remorseless_winter Fluffy_Pillow 57.0/124: 46% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:03.828 cooldowns i pillar_of_frost PR_Death_Knight_Frost 72.0/124: 58% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:03.828 single_target q howling_blast Fluffy_Pillow 72.0/124: 58% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:05.168 single_target s obliterate Fluffy_Pillow 85.0/124: 69% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:06.508 high_prio_actions m frost_strike Fluffy_Pillow 111.2/124: 90% runic_power
0.0/6: 0% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:07.847 single_target q howling_blast Fluffy_Pillow 81.2/124: 65% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:09.187 single_target v frost_strike Fluffy_Pillow 91.1/124: 73% runic_power
1.0/6: 17% rune		 rune_of_hysteria, icy_talons(3), gathering_storm(4), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:10.526 single_target p obliterate Fluffy_Pillow 67.3/124: 54% runic_power
3.0/6: 50% rune		 rune_of_hysteria, icy_talons(3), gathering_storm(4), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:11.866 single_target p obliterate Fluffy_Pillow 98.3/124: 79% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), gathering_storm(6), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:13.206 single_target o frost_strike Fluffy_Pillow 123.1/124: 99% runic_power
3.0/6: 50% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:14.546 single_target r frost_strike Fluffy_Pillow 99.3/124: 80% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:15.885 single_target v frost_strike Fluffy_Pillow 69.3/124: 56% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:17.225 single_target p obliterate Fluffy_Pillow 39.3/124: 32% runic_power
5.0/6: 83% rune		 rune_mastery, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:18.565 single_target q howling_blast Fluffy_Pillow 59.3/124: 48% runic_power
4.0/6: 67% rune		 icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:19.903 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 67.3/124: 54% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:19.903 single_target v frost_strike Fluffy_Pillow 67.3/124: 54% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:21.242 single_target v frost_strike Fluffy_Pillow 42.3/124: 34% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:22.582 high_prio_actions n remorseless_winter Fluffy_Pillow 17.3/124: 14% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_strength, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:23.922 single_target p obliterate Fluffy_Pillow 27.3/124: 22% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:25.262 single_target q howling_blast Fluffy_Pillow 52.1/124: 42% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:26.601 single_target s obliterate Fluffy_Pillow 62.0/124: 50% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
3:27.939 high_prio_actions m frost_strike Fluffy_Pillow 86.8/124: 70% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
3:29.279 single_target q howling_blast Fluffy_Pillow 56.8/124: 46% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
3:30.618 single_target v frost_strike Fluffy_Pillow 66.8/124: 54% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), gathering_storm(6), killing_machine, remorseless_winter, unleashed_frenzy(3), corrupting_rage
3:31.958 single_target p obliterate Fluffy_Pillow 41.8/124: 34% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm(6), killing_machine(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
3:33.297 single_target p obliterate Fluffy_Pillow 61.8/124: 50% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), gathering_storm(8), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
3:34.637 single_target v frost_strike Fluffy_Pillow 81.8/124: 66% runic_power
1.0/6: 17% rune		 icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:35.977 single_target v frost_strike Fluffy_Pillow 56.8/124: 46% runic_power
1.0/6: 17% rune		 icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:37.317 Waiting     1.651s 26.8/124: 22% runic_power
1.0/6: 17% rune		 icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:38.968 single_target v frost_strike Fluffy_Pillow 31.8/124: 26% runic_power
1.0/6: 17% rune		 icy_talons(3), killing_machine(2), bonegrinder_crit(2), unleashed_frenzy(3)
3:40.308 Waiting     0.098s 1.8/124: 1% runic_power
1.0/6: 17% rune		 icy_talons(3), killing_machine(2), bonegrinder_crit(2), unleashed_frenzy(3)
3:40.406 single_target p obliterate Fluffy_Pillow 1.8/124: 1% runic_power
2.0/6: 33% rune		 icy_talons(3), killing_machine(2), bonegrinder_crit(2), unleashed_frenzy(3)
3:41.746 cooldowns i pillar_of_frost PR_Death_Knight_Frost 21.8/124: 18% runic_power
2.0/6: 33% rune		 icy_talons(3), killing_machine(2), bonegrinder_crit(3), unleashed_frenzy(3)
3:41.746 single_target p obliterate Fluffy_Pillow 21.8/124: 18% runic_power
2.0/6: 33% rune		 icy_talons(3), killing_machine(2), pillar_of_frost, bonegrinder_crit(3), unleashed_frenzy(3)
3:43.085 single_target q howling_blast Fluffy_Pillow 41.8/124: 34% runic_power
0.0/6: 0% rune		 icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3)
3:44.425 single_target v frost_strike Fluffy_Pillow 49.8/124: 40% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3)
3:45.765 Waiting     3.590s 19.8/124: 16% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3)
3:49.355 high_prio_actions n remorseless_winter Fluffy_Pillow 29.8/124: 24% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3)
3:50.693 high_prio_actions m frost_strike Fluffy_Pillow 44.8/124: 36% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3)
3:52.033 single_target p obliterate Fluffy_Pillow 14.8/124: 12% runic_power
3.0/6: 50% rune		 icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3)
3:53.373 single_target p obliterate Fluffy_Pillow 39.8/124: 32% runic_power
2.0/6: 33% rune		 icy_talons(3), gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3)
3:54.713 single_target q howling_blast Fluffy_Pillow 64.8/124: 52% runic_power
1.0/6: 17% rune		 icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:56.052 single_target v frost_strike Fluffy_Pillow 72.8/124: 59% runic_power
1.0/6: 17% rune		 icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:57.391 single_target p obliterate Fluffy_Pillow 47.8/124: 39% runic_power
2.0/6: 33% rune		 icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:58.731 single_target q howling_blast Fluffy_Pillow 72.8/124: 59% runic_power
1.0/6: 17% rune		 icy_talons(3), gathering_storm(7), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
4:00.069 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 80.8/124: 65% runic_power
3.0/6: 50% rune		 rune_of_hysteria, icy_talons(3), gathering_storm(8), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
4:00.069 single_target s obliterate Fluffy_Pillow 80.8/124: 65% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), gathering_storm(8), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
4:01.409 single_target o frost_strike Fluffy_Pillow 105.6/124: 85% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
4:02.748 cooldowns g abomination_limb Fluffy_Pillow 81.8/124: 66% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
4:04.309 cooldowns k raise_dead PR_Death_Knight_Frost 81.8/124: 66% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_of_hysteria, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
4:04.309 single_target p obliterate Fluffy_Pillow 81.8/124: 66% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_of_hysteria, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
4:05.648 cooldowns j breath_of_sindragosa Fluffy_Pillow 119.0/124: 96% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_of_hysteria, abomination_limb, icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
4:05.648 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 119.0/124: 96% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
4:05.648 breath T howling_blast Fluffy_Pillow 119.0/124: 96% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze
4:06.987 Waiting     0.710s 106.0/124: 85% runic_power
2.0/6: 33% rune		 antimagic_shell, abomination_limb, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2)
4:07.697 breath Z obliterate Fluffy_Pillow 88.0/124: 71% runic_power
3.0/6: 50% rune		 abomination_limb, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2)
4:09.037 breath T howling_blast Fluffy_Pillow 95.0/124: 77% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:10.377 high_prio_actions n remorseless_winter Fluffy_Pillow 85.0/124: 69% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:11.667 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 64.0/124: 52% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:11.717 breath V obliterate Fluffy_Pillow 69.0/124: 56% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:12.881 breath T howling_blast Fluffy_Pillow 77.2/124: 62% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:14.046 breath V obliterate Fluffy_Pillow 69.1/124: 56% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:15.209 breath T howling_blast Fluffy_Pillow 75.9/124: 61% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:16.374 breath V obliterate Fluffy_Pillow 67.8/124: 55% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:17.539 breath T howling_blast Fluffy_Pillow 87.0/124: 70% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:18.704 breath W obliterate Fluffy_Pillow 61.0/124: 49% runic_power
5.0/6: 83% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:19.867 breath T howling_blast Fluffy_Pillow 67.8/124: 55% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:21.032 breath W obliterate Fluffy_Pillow 59.7/124: 48% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:22.197 cooldowns i pillar_of_frost PR_Death_Knight_Frost 72.7/124: 59% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:22.197 breath T howling_blast Fluffy_Pillow 72.7/124: 59% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:23.362 breath V obliterate Fluffy_Pillow 77.0/124: 62% runic_power
4.0/6: 67% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:24.527 breath W obliterate Fluffy_Pillow 79.0/124: 64% runic_power
2.0/6: 33% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:25.692 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 63.0/124: 51% runic_power
0.0/6: 0% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
4:25.692 breath T howling_blast Fluffy_Pillow 63.0/124: 51% runic_power
0.0/6: 0% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, enduring_strength_builder(2), unleashed_frenzy(3), dragon_games_equipment, corrupting_rage
4:26.855 breath V obliterate Fluffy_Pillow 63.0/124: 51% runic_power
3.0/6: 50% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
4:28.020 breath W obliterate Fluffy_Pillow 65.0/124: 52% runic_power
2.0/6: 33% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3)
4:29.185 breath T howling_blast Fluffy_Pillow 67.0/124: 54% runic_power
1.0/6: 17% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3)
4:30.350 high_prio_actions n remorseless_winter Fluffy_Pillow 57.0/124: 46% runic_power
1.0/6: 17% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3)
4:31.540 breath U horn_of_winter PR_Death_Knight_Frost 49.0/124: 40% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3)
4:32.705 breath V obliterate Fluffy_Pillow 43.0/124: 35% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3)
4:34.045 breath W obliterate Fluffy_Pillow 45.0/124: 36% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(5), unleashed_frenzy(3)
4:35.385 breath T howling_blast Fluffy_Pillow 57.0/124: 46% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
4:36.723 breath V obliterate Fluffy_Pillow 29.0/124: 23% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
4:38.062 breath W obliterate Fluffy_Pillow 36.0/124: 29% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
4:39.402 breath T howling_blast Fluffy_Pillow 38.0/124: 31% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
4:40.741 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 11.9/124: 10% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
4:40.741 single_target s obliterate Fluffy_Pillow 11.9/124: 10% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
4:42.080 single_target s obliterate Fluffy_Pillow 36.7/124: 30% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
4:43.420 single_target v frost_strike Fluffy_Pillow 67.7/124: 55% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:44.760 single_target s obliterate Fluffy_Pillow 43.9/124: 35% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:46.100 single_target q howling_blast Fluffy_Pillow 68.7/124: 55% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:47.440 single_target v frost_strike Fluffy_Pillow 91.0/124: 73% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:48.780 single_target v frost_strike Fluffy_Pillow 67.2/124: 54% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:50.120 single_target p obliterate Fluffy_Pillow 43.4/124: 35% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:51.459 high_prio_actions n remorseless_winter Fluffy_Pillow 68.2/124: 55% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:52.799 single_target s obliterate Fluffy_Pillow 78.2/124: 63% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
4:54.139 single_target q howling_blast Fluffy_Pillow 98.2/124: 79% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
4:55.479 high_prio_actions m frost_strike Fluffy_Pillow 106.2/124: 86% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
4:56.818 cooldowns h pillar_of_frost PR_Death_Knight_Frost 81.2/124: 66% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
4:56.818 single_target s obliterate Fluffy_Pillow 81.2/124: 66% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
4:58.157 single_target q howling_blast Fluffy_Pillow 101.2/124: 82% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
4:59.497 single_target r frost_strike Fluffy_Pillow 114.2/124: 92% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(6), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5690 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3848 0 16538 15751 9278
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 330760 315020 0
Runic Power 124 124 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 30.85% 24.64% 2995
Haste 12.25% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 5974 5598 0
Mastery 46.03% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +923 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +111 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +519 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Talents

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowFrost Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=sizzling_seafood_medley
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
actions.precombat+=/variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h
# Protects Breath from starving itself on ERW charges depending on anticipated resource gains. More resources enable more aggressive use.
actions.precombat+=/variable,name=erw_pooling_time,op=setif,value=30,value_else=45,condition=death_knight.ams_absorb_percent>0.59

# Executed every time the actor is available.
actions=auto_attack
# Choose Action list to run
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/frostscythe,if=!death_and_decay.ticking&equipped.fyralath_the_dreamrender&(cooldown.rage_of_fyralath_417131.remains<3|!dot.mark_of_fyralath.ticking)
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=howling_blast,if=variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&(buff.killing_machine.react|runic_power>45)
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up
actions.breath+=/remorseless_winter,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/death_and_decay,if=(set_bonus.tier31_4pc&variable.st_planning&talent.unholy_ground&!death_and_decay.ticking&runic_power.deficit>=10)|runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/howling_blast,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=set_bonus.tier31_2pc&buff.chilling_rage.remains<3
actions.cooldowns+=/chill_streak,if=!set_bonus.tier31_2pc&active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react&rune>2|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>50|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
actions.high_prio_actions=invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions.high_prio_actions+=/mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40&death_knight.first_ams_cast<time
actions.high_prio_actions+=/antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.ready|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up))
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions.high_prio_actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&((!talent.obliteration|talent.obliteration&(!cooldown.pillar_of_frost.ready|buff.pillar_of_frost.up&!buff.killing_machine.react))|(equipped.fyralath_the_dreamrender&!dot.mark_of_fyralath.ticking))
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/remorseless_winter,if=variable.rw_buffs|variable.adds_remain

# Obliteration Active Rotation
actions.obliteration=howling_blast,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&buff.rime.react
actions.obliteration+=/frost_strike,if=(active_enemies<=1|!talent.glacial_advance)&buff.killing_machine.react<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/glacial_advance,if=buff.killing_machine.react<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&(variable.frostscythe_priority|active_enemies>3&!death_and_decay.ticking&equipped.fyralath_the_dreamrender&(cooldown.rage_of_fyralath_417131.remains<3|!dot.mark_of_fyralath.ticking))
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&(!dot.frost_fever.ticking|buff.rime.react&set_bonus.tier30_2pc&!variable.rp_buffs)
actions.obliteration+=/glacial_advance,if=!buff.killing_machine.react&(!death_knight.runeforge.razorice&(!talent.avalanche|debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)|((variable.rp_buffs|rune<2)&active_enemies>1))
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(rune<2|variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<30
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<30
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=frost_strike,if=buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
actions.single_target+=/howling_blast,if=buff.rime.react&set_bonus.tier30_2pc&buff.killing_machine.stack<2
actions.single_target+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes&buff.remorseless_winter.up
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets
actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.pillar_of_frost.up&!buff.empower_rune_weapon.up&!death_and_decay.ticking&(active_enemies<2|dot.frost_fever.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&((variable.damage_trinket_priority=1|trinket.2.cooldown.remains)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&((variable.damage_trinket_priority=2|trinket.1.cooldown.remains)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions.variables+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions.variables+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions.variables+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
actions.variables+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains>10|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up
actions.variables+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>8|!death_and_decay.ticking&active_enemies>4))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions.variables+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions.variables+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions.variables+=/variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions.variables+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=9278
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 56924 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
56924.3 56924.3 43.7 / 0.077% 7430.9 / 13.1% 4172.9
APS APS Error APS Range APR
163.4 3.9 / 2.363% 441.4 / 270.2% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.6 7.7 Runic Power 1.37% 52.6 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 56924
Apocalypse 239 (8119) 0.4% (14.3%) 6.8 46.29s 358023 292558 Direct 6.8 (535.1) 8768 17519 10551 20.4% (20.4%)

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.79 6.79 0.00 0.00 0.00 1.2238 0.0000 71652.21 71652.21 0.00% 292557.56 292557.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.63% 5.41 1 8 8767.63 6282 13296 8760.87 6910 11010 47414 47414 0.00%
crit 20.37% 1.38 0 7 17519.37 13820 26342 13788.30 0 26342 24239 24239 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for {$?a134735=false}[every {$s3=2} Festering {$=}LWound:Wounds;][each Festering Wound] you burst. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [U]:5.79
  • if_expr:variable.st_planning&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [Y]:1.00
  • if_expr:debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell CooldownArmy of the Damned2768373ADD-45000.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
    main_hand 9505  / 4169 7.3% 257.6 4.33s 4845 3219 Direct 257.6 4027 8054 4845 20.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 257.64 257.64 0.00 0.00 0.00 1.5050 0.0000 1248154.09 1783122.74 30.00% 3218.92 3218.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.69% 205.32 142 274 4026.90 1961 6631 4032.70 3625 4464 826805 1181180 30.00%
crit 20.31% 52.32 25 94 8053.59 3921 13262 8063.68 7072 9604 421349 601942 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 2264  / 993 1.7% 188.6 5.99s 1578 1578 Direct 188.6 1311 2619 1578 20.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 188.56 188.56 0.00 0.00 0.00 1.0000 0.0000 297536.82 425063.43 30.00% 1577.92 1577.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.58% 150.06 100 200 1310.66 655 2186 1312.13 1206 1444 196679 280978 30.00%
crit 20.42% 38.50 17 66 2619.47 1374 4372 2622.23 2261 3129 100858 144086 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:47.14
    default
    [ ]:47.14
    default
    [ ]:47.14
    default
    [ ]:47.14
    Frostbolt 1480  / 649 1.1% 19.7 14.92s 9854 6243 Direct 19.7 8188 16375 9858 20.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.75 19.74 0.00 0.00 0.00 1.5783 0.0000 194602.67 194602.67 0.00% 6243.27 6243.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.60% 15.71 6 24 8187.90 4271 13856 8195.29 6917 9387 128660 128660 0.00%
crit 20.40% 4.03 0 12 16374.95 8910 27712 16200.91 0 27712 65942 65942 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:19.85
    Shadow Bolt 4719  / 2070 3.6% 62.4 4.53s 9927 6608 Direct 62.4 8250 16517 9932 20.3%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.40 62.38 0.00 0.00 0.00 1.5023 0.0000 619500.07 619500.07 0.00% 6607.86 6607.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 49.68 31 72 8249.76 4190 13580 8259.62 7365 9204 409887 409887 0.00%
crit 20.35% 12.69 2 27 16516.89 8670 27159 16534.17 12867 21504 209613 209613 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:69.09
Army of the Dead 0 (6191) 0.0% (10.8%) 2.0 0.00s 916821 1392286

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6589 0.4688 0.00 0.00 0.00% 207966.55 1392286.29

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    high_prio_actions
    [h]:1.00
  • if_expr:talent.summon_gargoyle&cooldown.summon_gargoyle.remains<3*gcd|!talent.summon_gargoyle|fight_remains<35
    main_hand 17177  / 3879 6.7% 336.4 0.85s 3415 2622 Direct 336.4 2838 5666 3415 20.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 336.42 336.42 0.00 0.00 0.00 1.3027 0.0000 1148935.98 1641378.96 30.00% 2621.67 2621.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.58% 267.73 229 307 2837.60 1230 4229 2837.06 2343 3110 759717 1085338 30.00%
crit 20.42% 68.69 40 100 5666.04 2461 8459 5663.49 4284 6502 389219 556041 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 3275  / 740 1.3% 205.5 1.48s 1066 1066 Direct 205.5 885 1765 1066 20.5%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 205.53 205.53 0.00 0.00 0.00 1.0000 0.0000 219043.12 312926.72 30.00% 1065.74 1065.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.50% 163.39 132 188 885.45 411 1413 885.33 734 983 144677 206687 30.00%
crit 20.50% 42.14 20 65 1764.82 822 2827 1764.28 1379 2094 74366 106240 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:27.08
    default
    [ ]:25.95
    default
    [ ]:26.15
    default
    [ ]:27.01
    default
    [ ]:25.07
    default
    [ ]:24.60
    default
    [ ]:25.16
    default
    [ ]:24.50
    Frostbolt 1364  / 276 0.5% 8.0 30.87s 10233 7134 Direct 8.0 8520 16916 10233 20.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.00 1.4346 0.0000 81865.88 81865.88 0.00% 7133.66 7133.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.59% 6.37 1 8 8519.58 4203 13856 8525.02 5041 12887 54247 54247 0.00%
crit 20.41% 1.63 0 7 16915.53 8406 27712 14177.01 0 27712 27619 27619 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:8.00
    Shadow Bolt 6397  / 1296 2.3% 35.5 6.32s 10796 8141 Direct 35.5 8968 17895 10796 20.5%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.55 35.55 0.00 0.00 0.00 1.3262 0.0000 383796.07 383796.07 0.00% 8140.59 8140.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.52% 28.27 17 36 8968.19 3953 13580 8964.94 7197 10113 253531 253531 0.00%
crit 20.48% 7.28 0 17 17895.12 7905 27159 17880.32 0 24594 130265 130265 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:37.55
auto_attack_mh 2708 4.8% 147.0 2.46s 5524 2259 Direct 147.0 4589 9179 5524 20.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 146.99 146.99 0.00 0.00 0.00 2.4449 0.0000 811950.43 1159958.75 30.00% 2259.28 2259.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.64% 117.06 78 158 4589.23 3685 6722 4588.80 4357 4799 537228 767488 30.00%
crit 20.36% 29.93 10 54 9178.73 7371 13444 9177.34 8444 10044 274723 392471 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 96 0.2% 2.0 0.00s 14233 0 Direct 2.0 11772 23458 14232 21.1%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 28467.56 28467.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.95% 1.58 0 2 11772.41 10402 14824 11237.62 0 14824 18589 18589 0.00%
crit 21.05% 0.42 0 2 23458.16 20804 30094 8792.64 0 30094 9879 9879 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Clawing Shadows 7885 13.9% 70.5 4.12s 33511 28167 Direct 70.5 27850 55736 33511 20.3%

Stats Details: Clawing Shadows

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 70.49 70.49 0.00 0.00 0.00 1.1897 0.0000 2362108.81 2362108.81 0.00% 28167.29 28167.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.70% 56.18 32 80 27849.50 13786 53976 27876.36 23605 32485 1564487 1564487 0.00%
crit 20.30% 14.31 2 29 55735.70 27825 106420 55773.73 38454 77781 797622 797622 0.00%

Action Details: Clawing Shadows

  • id:207311
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207311
  • name:Clawing Shadows
  • school:shadow
  • tooltip:
  • description:Deals {$s2=0} Shadow damage and causes 1 Festering Wound to burst.

Action Priority List

    st
    [n]:70.18
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    st
    [q]:0.30
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Rotten Touch39027610.500
Crit Damage on Debuff Lingering Chill41087910.400
Dark Transformation 0 (210) 0.0% (0.4%) 6.9 46.21s 9084 7204

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.92 0.00 0.00 0.00 0.00 1.2611 0.0000 0.00 0.00 0.00% 7204.13 7204.13

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [T]:5.92
  • if_expr:cooldown.apocalypse.remains<5
    garg_setup
    [d]:1.00
  • if_expr:talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownUnholy Command3169411ADD-15000.000
    Dark Transformation (_damage) 210 0.4% 0.0 0.00s 0 0 Direct 6.9 7531 15072 9084 20.6%

Stats Details: Dark Transformation Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 6.92 0.00 0.00 0.00 0.0000 0.0000 62870.47 62870.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.40% 5.49 1 8 7530.86 6167 11077 7526.72 6182 9117 41382 41382 0.00%
crit 20.60% 1.43 0 6 15072.43 12363 21804 11969.80 0 20188 21488 21488 0.00%

Action Details: Dark Transformation Damage

  • id:344955
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344955
  • name:Dark Transformation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc63560=Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Death and Decay 270 0.5% 8.4 36.51s 9596 8069 Periodic 91.6 733 1465 883 20.5% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.43 0.00 0.00 91.65 0.00 1.1893 0.0000 80918.23 80918.23 0.00% 8069.23 8069.23
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.52% 72.87 40 113 732.96 479 1234 733.74 655 814 53414 53414 0.00%
crit 20.48% 18.77 4 38 1465.05 959 2467 1466.57 1203 1861 27504 27504 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    garg_setup
    [Z]:1.00
  • if_expr:!death_and_decay.ticking&debuff.festering_wound.stack>1
    st
    [m]:7.43
  • if_expr:!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Death Coil 7301 (9453) 12.8% (16.6%) 95.8 3.09s 29568 24463 Direct 95.8 (232.0) 18985 37979 22849 20.3% (20.3%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.80 95.76 0.00 0.00 0.00 1.2087 0.0000 2187949.07 2187949.07 0.00% 24463.32 24463.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.66% 76.28 46 106 18985.43 12006 32578 18995.52 17731 20456 1448180 1448180 0.00%
crit 20.34% 19.48 4 38 37979.10 24626 64231 38001.64 29673 45622 739770 739770 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Details: Death Coil Damage

  • id:47632
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47632
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fire a blast of unholy energy, causing Shadow damage to an enemy target or healing a friendly Undead target.

Action Priority List

    high_prio_actions
    [i]:6.93
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
    st
    [l]:80.79
  • if_expr:!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
    st
    [p]:8.08

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Death Coil3775801PCT0.300
Spell TargetsImproved Death Coil3775802ADD1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Percent Cost Sudden Doom813401-1.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
    Coil of Devastation 2152 3.8% 0.0 0.00s 0 0 Periodic 136.3 4732 0 4732 0.0% 90.8%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 136.26 136.26 81.23 0.0000 2.0000 644756.37 644756.37 0.00% 2365.84 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 136.26 105 172 4731.64 1801 21636 4738.60 4055 5700 644756 644756 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:unknown

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 1112 2.0% 8.2 28.96s 40860 0 Direct 8.2 33987 67958 40891 20.3%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.18 8.17 0.00 0.00 0.00 0.0000 0.0000 334125.96 477334.98 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.68% 6.51 1 9 33987.44 33373 35042 34008.60 33373 35042 221293 316140 30.00%
crit 20.32% 1.66 0 6 67957.63 66746 70083 56899.09 0 70083 112833 161195 25.11%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1548 2.7% 22.5 13.32s 20675 17004 Direct 22.5 17177 34336 20675 20.4%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.45 22.45 0.00 0.00 0.00 1.2159 0.0000 464241.74 663219.40 30.00% 17003.95 17003.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.61% 17.88 7 29 17176.64 12163 30699 17161.07 14171 19539 307052 438656 30.00%
crit 20.39% 4.58 0 13 34336.13 24325 59245 34087.13 0 54154 157190 224563 29.81%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [e]:1.00
  • if_expr:debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
    st
    [o]:21.45
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack<4
  • target_if_expr:debuff.festering_wound.stack

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Festering Strike3168671PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Festering Wound 2506 4.4% 97.7 3.79s 7691 0 Direct 97.7 6389 12791 7691 20.3%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.65 97.65 0.00 0.00 0.00 0.0000 0.0000 751020.93 751020.93 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.67% 77.80 51 105 6389.18 4229 11685 6390.86 5945 6827 497057 497057 0.00%
crit 20.33% 19.86 7 40 12790.56 8458 23369 12793.84 10585 15676 253964 253964 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Festering Strike3168671PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Outbreak 86 0.2% 11.6 27.02s 2228 1839 Direct 11.6 1853 3689 2228 20.4%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.2117 0.0000 25901.50 25901.50 0.00% 1838.94 1838.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.56% 9.25 3 14 1852.84 1319 3252 1853.59 1501 2310 17137 17137 0.00%
crit 20.44% 2.38 0 9 3688.78 2638 6503 3404.87 0 6503 8765 8765 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    high_prio_actions
    [j]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Raise Dead 0 (7909) 0.0% (13.9%) 1.0 0.00s 2368103 0

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
    auto_attack 5480  / 5480 9.6% 186.0 1.61s 8822 5485 Direct 186.0 7327 14664 8822 20.4%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 185.99 185.99 0.00 0.00 0.00 1.6086 0.0000 1640811.69 2344076.46 30.00% 5484.55 5484.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.63% 148.09 105 193 7327.44 2482 18960 7336.47 6511 8359 1085137 1550236 30.00%
crit 20.37% 37.89 18 64 14664.21 4964 37920 14680.58 9732 20004 555674 793841 30.00%

Action Details: Auto Attack

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:1.00
    Sweeping Claws 1987  / 1987 3.5% 62.6 4.67s 9503 9469 Direct 62.6 7891 15798 9503 20.4%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.60 62.60 0.00 0.00 0.00 1.0036 0.0000 594860.78 594860.78 0.00% 9468.84 9468.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.61% 49.83 32 70 7891.14 5505 14017 7894.54 7125 8574 393249 393249 0.00%
crit 20.39% 12.76 2 28 15797.51 11010 28034 15801.56 12427 20511 201612 201612 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:62.60
    Claw 440  / 440 0.8% 40.0 7.61s 3301 3289 Direct 40.0 2743 5482 3301 20.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.99 39.99 0.00 0.00 0.00 1.0036 0.0000 132021.22 188606.55 30.00% 3289.10 3289.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.63% 31.85 17 48 2743.18 2234 9684 2741.53 2511 3014 87360 124803 30.00%
crit 20.37% 8.15 1 22 5481.54 4468 20183 5477.97 4468 7086 44661 63803 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:39.99
  • if_expr:energy>70
    Gnaw 1  / 1 0.0% 3.7 90.08s 110 109 Direct 3.7 91 183 110 20.1%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0036 0.0000 409.50 585.02 30.00% 109.38 109.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.90% 2.98 0 4 91.43 79 114 91.09 0 111 273 389 29.89%
crit 20.10% 0.75 0 4 182.61 158 225 102.95 0 225 137 196 16.92%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:3.73
Soul Reaper 732 (4117) 1.3% (7.3%) 15.4 6.97s 80467 63641 Direct 15.4 (30.8) 11869 23740 14300 20.5% (20.4%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.38 15.38 0.00 0.00 0.00 1.2644 0.0000 219924.83 219924.83 0.00% 63640.87 63640.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.52% 12.23 4 20 11869.00 7133 18448 11879.49 10267 13860 145164 145164 0.00%
crit 20.48% 3.15 0 12 23740.19 14265 36896 22904.83 0 35325 74761 74761 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [X]:15.38
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370075PCT0.150
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
    Soul Reaper (_execute) 3385 6.0% 15.4 6.97s 66170 0 Direct 15.4 54976 109885 66169 20.4%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.38 15.38 0.00 0.00 0.00 0.0000 0.0000 1017635.46 1017635.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.61% 12.24 5 19 54976.02 42544 84643 55048.32 48082 63451 673108 673108 0.00%
crit 20.39% 3.14 0 10 109884.86 85087 166884 106120.99 0 164481 344528 344528 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370075PCT0.150
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Summon Gargoyle 0 (3054) 0.0% (5.3%) 2.0 185.36s 452281 0

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [S]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead
    garg_setup
    [a]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
    Gargoyle Strike 18091  / 3054 5.3% 27.1 7.85s 33333 21269 Direct 27.1 27673 55329 33332 20.5%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.14 27.14 0.00 0.00 0.00 1.5672 0.0000 904562.19 904562.19 0.00% 21269.30 21269.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.54% 21.58 11 28 27672.86 8288 60798 27667.78 21769 33415 597292 597292 0.00%
crit 20.46% 5.55 0 16 55329.18 16576 123273 55141.19 0 109056 307270 307270 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.
Unholy Assault 392 0.7% 3.6 91.83s 32354 28503 Direct 3.6 26874 53787 32354 20.4%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.63 3.63 0.00 0.00 0.00 1.1351 0.0000 117459.24 117459.24 0.00% 28502.61 28502.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.64% 2.89 0 4 26874.17 20686 36264 26790.99 0 35237 77702 77702 0.00%
crit 20.36% 0.74 0 4 53786.60 42321 71843 30199.35 0 71843 39757 39757 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Damage increased by {$s4=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing all damage done by {$s4=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [W]:3.37
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [c]:0.26
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Virulent Plague 1269 2.2% 11.6 27.02s 32738 0 Periodic 99.5 3176 6350 3825 20.4% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.50 99.50 10.62 0.0000 3.0000 380575.53 380575.53 0.00% 1274.99 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.55% 79.16 54 106 3175.95 2295 6069 3176.12 3000 3356 251394 251394 0.00%
crit 20.45% 20.34 4 37 6350.22 4551 12139 6351.47 5434 7436 129182 129182 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.172500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Tick Time Plaguebringer3901781-0.500Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 163
Anti-Magic Shell 165 100.8% 6.9 45.42s 7099 0 Direct 3.1 15824 0 15824 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.95 3.12 0.00 0.00 0.00 0.0000 0.0000 49324.39 49324.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.12 0 14 15823.90 15824 15824 13361.37 0 15824 49324 49324 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [f]:6.95
  • if_expr:runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownAnti-Magic Barrier2057271ADD-20000.000
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Algeth'ar Puzzle (_box_channel) 2.0 182.56s

Stats Details: Algethar Puzzle Box Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 2.00 0.00 0.00 1.5530 1.5530 0.00 0.00 0.00% 0.00 0.00

Action Details: Algethar Puzzle Box Channel

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 185.01s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [k]:2.00
  • if_expr:(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
Empower Rune Weapon 2.4 168.70s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.38 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [V]:2.12
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
    garg_setup
    [b]:0.26
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929621SET1.000
Festering Wound (_application) 101.4 5.28s

Stats Details: Festering Wound Application

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 101.42 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Festering Wound Application

  • id:197147
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:197147
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:Festering Strike applies a pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$195757s1=3} Runic Power. Stacks up to {$194310u=6} times on any target.
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382154
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Outbreak (_aoe) 11.6 27.02s

Stats Details: Outbreak Aoe

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Outbreak Aoe

  • id:196780
  • school:shadow
  • range:200.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196780
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:{$@spelldesc77575=Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}}
Elemental Potion of Ultimate Power 1.5 302.59s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    high_prio_actions
    [g]:1.45
  • if_expr:(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Unholy Strength 20.6 14.16s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.63 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 183.0s 183.0s 30.0s 20.27% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1411.05

Trigger Details

  • interval_min/max:181.8s / 185.7s
  • trigger_min/max:181.8s / 185.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s
  • uptime_min/max:16.67% / 25.00%

Stack Uptimes

  • algethar_puzzle_1:20.27%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Anti-Magic Shell 6.9 0.0 45.5s 45.5s 6.9s 16.07% 18.62% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.40
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 132.4s
  • trigger_min/max:40.0s / 132.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:11.46% / 17.71%

Stack Uptimes

  • antimagic_shell_1:16.07%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Berserking 2.0 0.0 185.0s 185.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.3s / 192.7s
  • trigger_min/max:181.3s / 192.7s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Commander of the Dead 6.9 0.0 46.2s 46.2s 28.5s 65.81% 86.57% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 61.0s
  • trigger_min/max:45.0s / 61.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:61.71% / 68.79%

Stack Uptimes

  • commander_of_the_dead_1:65.81%

Spelldata

  • id:390260
  • name:Commander of the Dead
  • tooltip:Your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead ghouls deal {$390264s1=35}% increased damage.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 61.9s 58.4s 50.3s 80.31% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 350.0s
  • trigger_min/max:15.0s / 312.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 342.4s
  • uptime_min/max:48.53% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.31%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Transformation 6.9 0.0 46.2s 46.2s 21.8s 50.38% 54.82% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 61.0s
  • trigger_min/max:45.0s / 61.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.0s
  • uptime_min/max:44.78% / 57.34%

Stack Uptimes

  • dark_transformation_1:50.38%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Dragon Games Equipment 2.7 0.0 120.0s 120.0s 0.8s 0.74% 0.00% 8.2 (8.2) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.87
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.2s
  • trigger_min/max:120.0s / 120.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.9s
  • uptime_min/max:0.56% / 0.96%

Stack Uptimes

  • dragon_games_equipment_1:0.74%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.6s 302.6s 27.4s 13.02% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.9s
  • trigger_min/max:300.0s / 325.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.80% / 17.89%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.02%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 168.7s 168.7s 19.3s 15.26% 0.00% 6.9 (6.9) 2.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 193.7s
  • trigger_min/max:120.0s / 193.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:12.51% / 18.13%

Stack Uptimes

  • empower_rune_weapon_1:15.26%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Festermight 13.0 64.3 23.4s 3.8s 19.2s 83.36% 0.00% 0.0 (0.0) 12.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 44.0s
  • trigger_min/max:0.8s / 28.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:73.14% / 90.67%

Stack Uptimes

  • festermight_1:7.62%
  • festermight_2:8.01%
  • festermight_3:8.41%
  • festermight_4:16.22%
  • festermight_5:11.09%
  • festermight_6:9.93%
  • festermight_7:7.89%
  • festermight_8:5.62%
  • festermight_9:3.91%
  • festermight_10:2.04%
  • festermight_11:0.87%
  • festermight_12:0.63%
  • festermight_13:0.58%
  • festermight_14:0.43%
  • festermight_15:0.12%
  • festermight_16:0.01%
  • festermight_17:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 94.8 157.0s 3.1s 292.2s 98.18% 0.00% 92.8 (92.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:46.7s / 287.4s
  • trigger_min/max:0.8s / 14.9s
  • trigger_pct:100.00%
  • duration_min/max:24.8s / 354.6s
  • uptime_min/max:96.81% / 98.52%

Stack Uptimes

  • icy_talons_1:0.33%
  • icy_talons_2:0.34%
  • icy_talons_3:97.51%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 11.8 7.7 25.1s 14.8s 10.6s 41.68% 0.00% 7.7 (7.7) 11.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 184.6s
  • trigger_min/max:0.8s / 177.9s
  • trigger_pct:14.97%
  • duration_min/max:0.0s / 69.8s
  • uptime_min/max:17.50% / 69.38%

Stack Uptimes

  • rune_mastery_1:41.68%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 39.4 6.5 7.5s 6.4s 2.8s 36.69% 0.00% 6.5 (6.5) 39.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 76.3s
  • trigger_min/max:0.8s / 76.3s
  • trigger_pct:47.93%
  • duration_min/max:0.0s / 23.7s
  • uptime_min/max:19.23% / 51.91%

Stack Uptimes

  • runic_corruption_1:36.69%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 19.5 0.7 15.0s 14.4s 1.4s 9.43% 0.00% 0.7 (0.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.6s / 58.4s
  • trigger_min/max:1.6s / 58.4s
  • trigger_pct:14.15%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:1.87% / 22.33%

Stack Uptimes

  • sudden_doom_1:9.43%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.6 0.0 91.8s 91.8s 19.5s 23.63% 28.79% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.6s
  • trigger_min/max:90.0s / 98.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.74% / 26.69%

Stack Uptimes

  • unholy_assault_1:23.63%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Damage increased by {$s4=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing all damage done by {$s4=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Ground 8.4 0.0 36.5s 36.5s 9.9s 27.77% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 136.3s
  • trigger_min/max:10.0s / 136.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.8s
  • uptime_min/max:17.94% / 37.84%

Stack Uptimes

  • unholy_ground_1:27.77%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 12.1 35.8s 14.2s 23.8s 67.58% 0.00% 12.1 (12.1) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 165.4s
  • trigger_min/max:0.0s / 60.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 145.9s
  • uptime_min/max:42.28% / 89.92%

Stack Uptimes

  • unholy_strength_1:67.58%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 184.4s 184.4s 24.5s 98.06% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.4s / 192.6s
  • trigger_min/max:180.4s / 192.6s
  • trigger_pct:100.00%
  • duration_min/max:21.2s / 25.0s
  • uptime_min/max:90.49% / 98.07%

Stack Uptimes

  • dark_empowerment_1:98.06%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (sizzling_seafood_medley)

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sizzling_seafood_medley
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382154
  • name:Well Fed
  • tooltip:Haste and mastery increased by {$=}w1.
  • description:Increases Haste and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 24.6 8.0 43.0 11.9s 1.6s 130.3s
Rune ready 150.0 115.0 188.0 2.1s 0.0s 13.7s
Runic Corruption from Runic Power Spent 45.9 23.0 73.0 6.4s 0.8s 76.3s
Festering Wound from Festering Strike 56.1 36.0 79.0 13.3s 1.1s 80.1s
Festering Wound from Infected Claws 30.8 12.0 54.0 9.6s 1.0s 101.3s
Festering Wound from Unholy Assault 14.5 12.0 16.0 91.8s 90.0s 98.6s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.13% 0.00% 10.60% 1.5s 0.0s 11.6s
ghoul - Energy Cap 0.45% 0.05% 1.56% 0.2s 0.0s 1.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Raise Dead0.0000.0000.000300.000240.015359.992
Army of the Dead4.7380.000139.4069.4680.000139.406
Summon Gargoyle4.8751.32613.6099.7515.72718.009
Apocalypse2.4100.00015.54316.5329.39632.645
Unholy Assault3.8970.00010.20914.1518.26921.566
Dark Transformation1.6700.00016.03911.5835.57527.425
Empower Rune Weapon32.1860.00073.65276.70369.204100.517
Death and Decay6.6370.00087.73960.5103.383153.240
Soul Reaper13.3510.000233.602207.799157.511256.192
Anti-Magic Shell5.7660.00092.44240.67627.235119.240

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=341189)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1262.088 / 1.3216.34721.740
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
37.66662.60294.975 / 93.415133.352184.826

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
Anti-Magic ShellRunic Power3.1215.450.67%4.950.140.91%
ApocalypseRune13.5812.068.04%0.891.5211.23%
Empower Rune WeaponRunic Power11.4255.492.40%4.861.612.82%
Empower Rune WeaponRune11.4210.356.90%0.911.069.32%
Festering WoundRunic Power97.65290.5912.55%2.982.370.81%
Rune RegenerationRune127.60127.6085.06%1.000.000.00%
Runic AttenuationRunic Power71.57348.1815.04%4.869.682.71%
Army of the DeadRunic Power2.0019.750.85%9.880.251.24%
Clawing ShadowsRunic Power70.49704.8730.45%10.000.000.00%
Death and DecayRunic Power8.4384.323.64%10.000.000.00%
Festering StrikeRunic Power22.45449.0719.40%20.000.000.00%
OutbreakRunic Power11.62112.364.85%9.673.893.34%
Soul ReaperRunic Power15.38147.216.36%9.576.594.28%
Summon GargoyleRunic Power2.0087.453.78%43.7312.5512.55%
pet - ghoul
Dark TransformationEnergy6.92337.578.37%48.78354.5051.22%
Energy RegenEnergy1349.303697.8491.63%2.7431.390.84%
pet - army_ghoul
Energy RegenEnergy840.356884.36100.00%8.19463.296.31%
pet - apoc_ghoul
Energy RegenEnergy671.025224.54100.00%7.791548.5522.86%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.31%1.001.00916820.52
Clawing ShadowsRune 70.4970.4946.12%1.001.0033511.39
Death and DecayRune 8.438.435.52%1.001.009596.17
Death CoilRunic Power 95.802289.32100.00%23.9023.901237.36
Festering StrikeRune 22.4544.9129.38%2.002.0010337.77
OutbreakRune 11.6211.627.61%1.001.002228.09
Soul ReaperRune 15.3815.3810.06%1.001.0080465.82
pet - ghoul
ClawEnergy 39.991599.7438.98%40.0040.0082.53
Sweeping ClawsEnergy 62.602503.8761.02%40.0040.00237.58
pet - army_ghoul
ClawEnergy 205.538221.09100.00%40.0040.0026.64
pet - apoc_ghoul
ClawEnergy 188.577542.61100.00%40.0040.0039.45
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 327940.0 754.00 870.07 261016.3 293117.1 1936.0 327940.0
Runic Power 8.0 7.72 7.64 37.1 23.4 0.0 75.0
Rune 5.0 0.50 0.51 0.0 3.2 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 56924.29
Minimum 50188.61
Maximum 63434.06
Spread ( max - min ) 13245.45
Range [ ( max - min ) / 2 * 100% ] 11.63%
Standard Deviation 1932.5232
5th Percentile 54025.34
95th Percentile 60340.59
( 95th Percentile - 5th Percentile ) 6315.25
Mean Distribution
Standard Deviation 22.3163
95.00% Confidence Interval ( 56880.55 - 56968.03 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4428
0.1 Scale Factor Error with Delta=300 31882
0.05 Scale Factor Error with Delta=300 127525
0.01 Scale Factor Error with Delta=300 3188109
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 56924.29
Minimum 50188.61
Maximum 63434.06
Spread ( max - min ) 13245.45
Range [ ( max - min ) / 2 * 100% ] 11.63%
Standard Deviation 1932.5232
5th Percentile 54025.34
95th Percentile 60340.59
( 95th Percentile - 5th Percentile ) 6315.25
Mean Distribution
Standard Deviation 22.3163
95.00% Confidence Interval ( 56880.55 - 56968.03 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4428
0.1 Scale Factor Error with Delta=300 31882
0.05 Scale Factor Error with Delta=300 127525
0.01 Scale Factor Error with Delta=300 3188109
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 56924.29
Minimum 50188.61
Maximum 63434.06
Spread ( max - min ) 13245.45
Range [ ( max - min ) / 2 * 100% ] 11.63%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 9561558.34
Minimum 7177665.52
Maximum 12054982.93
Spread ( max - min ) 4877317.41
Range [ ( max - min ) / 2 * 100% ] 25.50%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 868.93
Minimum 0.00
Maximum 2412.99
Spread ( max - min ) 2412.99
Range [ ( max - min ) / 2 * 100% ] 138.85%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 751.43
Minimum 0.00
Maximum 1739.07
Spread ( max - min ) 1739.07
Range [ ( max - min ) / 2 * 100% ] 115.72%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2,if=!equipped.fyralath_the_dreamrender|raid_event.adds.exists
6 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
7 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
A 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
B 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
E 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
F 0.00 variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
Default action list Executed every time the actor is available.
# count action,conditions
G 1.00 auto_attack
H 0.00 call_action_list,name=variables
Call Action Lists
I 0.00 call_action_list,name=high_prio_actions
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=racials
L 0.00 run_action_list,name=garg_setup,if=variable.garg_setup_complete=0
M 0.00 call_action_list,name=cooldowns,if=variable.st_planning
N 0.00 call_action_list,name=aoe_cooldowns,if=variable.adds_remain
O 0.00 call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
P 0.00 call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
Q 0.00 call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
R 0.00 call_action_list,name=st,if=active_enemies<=3
actions.cooldowns
# count action,conditions
S 1.00 summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
ST/Cleave Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
T 5.92 dark_transformation,if=cooldown.apocalypse.remains<5
U 5.79 apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
V 2.12 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 abomination_limb,if=rune<3&variable.st_planning
W 3.37 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
X 15.38 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.garg_setup
# count action,conditions
Y 1.00 apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)
Garg Setup
0.00 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
Z 1.00 any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>1
a 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
b 0.26 empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=23
c 0.26 unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=23
d 1.00 dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
e 1.00 festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
0.00 death_coil,if=rune<=1
actions.high_prio_actions
# count action,conditions
0.00 mind_freeze,if=target.debuff.casting.react
Priority Actions
f 6.95 antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
0.00 antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle))
0.00 antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
0.00 invoke_external_buff,name=power_infusion,if=(variable.st_planning|variable.adds_remain)&(pet.gargoyle.active&pet.gargoyle.remains<=22|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.army_ghoul.remains<=18|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+10>cooldown.invoke_external_buff_power_infusion.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
g 1.45 potion,if=(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
0.00 any_dnd,if=variable.adds_remain&!death_and_decay.ticking&!talent.bursting_sores&talent.defile&buff.defile.remains<gcd
h 1.00 army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<3*gcd|!talent.summon_gargoyle|fight_remains<35
i 6.93 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|cooldown.unholy_assault.ready|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains|!talent.summon_gargoyle)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
j 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd&time>15|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration+3
k 2.00 berserking,if=(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(18>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=18|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|active_enemies>=2&death_and_decay.ticking)|fight_remains<=18
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration+3
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.st
# count action,conditions
l 80.79 death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
Single Target
0.00 epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
m 7.43 any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)
n 70.18 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
o 21.45 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4
p 8.08 death_coil
q 0.30 wound_spender,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack>=4
actions.trinkets
# count action,conditions
0.00 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&(active_enemies<5|active_enemies>21|fight_remains<4)&(debuff.festering_wound.stack>=2|time>15)
Trinkets
r 2.00 use_item,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<16|!talent.summon_gargoyle&pet.army_ghoul.active&pet.army_ghoul.remains<16)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(variable.damage_trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
s 2.73 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(variable.damage_trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGjreZdagiiiifYVWnnlmknlllnnjlnlnllnnlnnlnllsnnlolnnllnloljofTlmqUlnlonlnponnlpjlolnpnpolfnnpnTnpjWUlmlnnlnlnonpnpolnljnflnlnpopnTolmUlnnsnjllonllnlnolnllnlnnlhjrlmlTSifiVWUXnmkllnXlnnloXjllnnXlnnlXolnlXlnlfoXTjlUXlmnlXnlonXpnpnXljlnXlnposfpXnnlnTXWUllXjllnnlon

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 4 raise_dead PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 5 army_of_the_dead PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 6 trinket_1_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat 7 trinket_2_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat A trinket_1_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat B trinket_2_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat E trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat F damage_trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
0:00.000 default G auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
0:00.000 high_prio_actions j outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, corrupting_rage
0:01.017 trinkets r use_item_algethar_puzzle_box Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, corrupting_rage
0:02.367 garg_setup e festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, algethar_puzzle, corrupting_rage
0:03.384 garg_setup Z death_and_decay Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, algethar_puzzle, corrupting_rage
0:04.399 garg_setup d dark_transformation PR_Death_Knight_Unholy 53.0/100: 53% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, algethar_puzzle, corrupting_rage
0:04.399 garg_setup a summon_gargoyle PR_Death_Knight_Unholy 53.0/100: 53% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:05.366 high_prio_actions g potion Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:05.366 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.334 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons, dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.302 high_prio_actions i death_coil Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons(2), dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:08.270 high_prio_actions i death_coil Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.236 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 40.0/100: 40% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.236 garg_setup Y apocalypse Fluffy_Pillow 40.0/100: 40% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:10.202 cooldowns V empower_rune_weapon PR_Death_Knight_Unholy 52.0/100: 52% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:10.202 cooldowns W unholy_assault Fluffy_Pillow 57.0/100: 57% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:11.044 st n clawing_shadows Fluffy_Pillow 62.0/100: 62% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:11.887 st n clawing_shadows Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:12.730 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.573 st m death_and_decay Fluffy_Pillow 63.0/100: 63% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:14.458 racials k berserking PR_Death_Knight_Unholy 73.0/100: 73% runic_power
3.0/6: 50% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:14.458 st n clawing_shadows Fluffy_Pillow 73.0/100: 73% runic_power
3.0/6: 50% rune		 bloodlust, berserking, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:15.224 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
3.0/6: 50% rune		 bloodlust, berserking, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:15.990 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
4.0/6: 67% rune		 bloodlust, berserking, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:16.756 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
5.0/6: 83% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:17.522 st n clawing_shadows Fluffy_Pillow 66.0/100: 66% runic_power
6.0/6: 100% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:18.288 st n clawing_shadows Fluffy_Pillow 79.0/100: 79% runic_power
5.0/6: 83% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:19.054 high_prio_actions j outbreak Fluffy_Pillow 92.0/100: 92% runic_power
4.0/6: 67% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:19.820 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:20.586 st n clawing_shadows Fluffy_Pillow 80.0/100: 80% runic_power
4.0/6: 67% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:21.352 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:22.118 st n clawing_shadows Fluffy_Pillow 68.0/100: 68% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:22.884 st l death_coil Fluffy_Pillow 81.0/100: 81% runic_power
2.0/6: 33% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:23.650 st l death_coil Fluffy_Pillow 86.0/100: 86% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:24.454 st n clawing_shadows Fluffy_Pillow 56.0/100: 56% runic_power
4.0/6: 67% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:25.258 st n clawing_shadows Fluffy_Pillow 79.0/100: 79% runic_power
4.0/6: 67% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:26.062 st l death_coil Fluffy_Pillow 92.0/100: 92% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:26.866 st n clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:27.751 st n clawing_shadows Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:28.635 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(15), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:29.520 st n clawing_shadows Fluffy_Pillow 68.0/100: 68% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:30.405 st l death_coil Fluffy_Pillow 86.0/100: 86% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:31.422 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:32.437 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 61.0/100: 61% runic_power
6.0/6: 100% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, corrupting_rage, elemental_potion_of_ultimate_power
0:32.439 st n clawing_shadows Fluffy_Pillow 61.0/100: 61% runic_power
6.0/6: 100% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, dragon_games_equipment, corrupting_rage, elemental_potion_of_ultimate_power
0:33.456 st n clawing_shadows Fluffy_Pillow 74.0/100: 74% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(2), commander_of_the_dead, corrupting_rage, elemental_potion_of_ultimate_power
0:34.472 st l death_coil Fluffy_Pillow 87.0/100: 87% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(3), corrupting_rage, elemental_potion_of_ultimate_power
0:35.489 st o festering_strike Fluffy_Pillow 62.0/100: 62% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(3), corrupting_rage
0:36.506 st l death_coil Fluffy_Pillow 82.0/100: 82% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
0:37.523 st n clawing_shadows Fluffy_Pillow 57.0/100: 57% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
0:38.540 st n clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
0:39.557 st l death_coil Fluffy_Pillow 83.0/100: 83% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
0:40.574 st l death_coil Fluffy_Pillow 53.0/100: 53% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
0:41.895 st n clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
0:43.216 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
0:44.537 st o festering_strike Fluffy_Pillow 11.0/100: 11% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
0:45.858 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(6), corrupting_rage
0:47.179 high_prio_actions j outbreak Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(6), corrupting_rage
0:48.499 st o festering_strike Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(6), corrupting_rage
0:49.820 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 41.0/100: 41% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), corrupting_rage
0:49.820 cooldowns T dark_transformation PR_Death_Knight_Unholy 41.0/100: 41% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), corrupting_rage
0:51.139 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:52.460 st m death_and_decay Fluffy_Pillow 11.0/100: 11% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, corrupting_rage
0:53.781 st q clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:55.038 cooldowns U apocalypse Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, corrupting_rage
0:56.296 st l death_coil Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
0:57.553 st n clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
0:58.811 st l death_coil Fluffy_Pillow 34.0/100: 34% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:00.068 st o festering_strike Fluffy_Pillow 9.0/100: 9% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:01.326 st n clawing_shadows Fluffy_Pillow 29.0/100: 29% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:02.584 st l death_coil Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(7), commander_of_the_dead, corrupting_rage
1:03.904 st n clawing_shadows Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
1:05.225 st p death_coil Fluffy_Pillow 60.0/100: 60% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, corrupting_rage
1:06.546 st o festering_strike Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(8), commander_of_the_dead, corrupting_rage
1:07.866 st n clawing_shadows Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, corrupting_rage
1:09.187 st n clawing_shadows Fluffy_Pillow 68.0/100: 68% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, corrupting_rage
1:10.507 st l death_coil Fluffy_Pillow 81.0/100: 81% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(10), commander_of_the_dead, corrupting_rage
1:11.828 st p death_coil Fluffy_Pillow 51.0/100: 51% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(10), commander_of_the_dead, corrupting_rage
1:13.149 high_prio_actions j outbreak Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(10), commander_of_the_dead, corrupting_rage
1:14.470 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), commander_of_the_dead, corrupting_rage
1:15.790 st o festering_strike Fluffy_Pillow 6.0/100: 6% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), commander_of_the_dead, corrupting_rage
1:17.111 Waiting     0.933s 26.0/100: 26% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
1:18.044 st l death_coil Fluffy_Pillow 26.0/100: 26% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), sudden_doom, commander_of_the_dead, corrupting_rage
1:19.364 Waiting     1.654s 26.0/100: 26% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
1:21.018 st n clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), corrupting_rage
1:22.339 st p death_coil Fluffy_Pillow 39.0/100: 39% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, corrupting_rage
1:23.658 st n clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, corrupting_rage
1:24.979 Waiting     1.070s 27.0/100: 27% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
1:26.049 st p death_coil Fluffy_Pillow 32.0/100: 32% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
1:27.370 st o festering_strike Fluffy_Pillow 2.0/100: 2% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
1:28.691 Waiting     0.097s 22.0/100: 22% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
1:28.788 st l death_coil Fluffy_Pillow 22.0/100: 22% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(2), corrupting_rage
1:30.109 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 22.0/100: 22% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
1:30.109 st n clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
1:31.429 st n clawing_shadows Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
1:32.750 st p death_coil Fluffy_Pillow 53.0/100: 53% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
1:34.071 st n clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
1:35.392 cooldowns T dark_transformation PR_Death_Knight_Unholy 36.0/100: 36% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
1:36.712 st n clawing_shadows Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
1:38.033 st p death_coil Fluffy_Pillow 54.0/100: 54% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:39.354 Waiting     0.628s 24.0/100: 24% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:39.982 high_prio_actions j outbreak Fluffy_Pillow 24.0/100: 24% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:41.303 cooldowns W unholy_assault Fluffy_Pillow 34.0/100: 34% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
1:42.623 cooldowns U apocalypse Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
1:43.944 st l death_coil Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:45.265 st m death_and_decay Fluffy_Pillow 21.0/100: 21% runic_power
5.0/6: 83% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:46.584 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:47.842 st n clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:49.099 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
1:50.357 st l death_coil Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
1:51.615 st n clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
1:52.873 st l death_coil Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:54.130 st n clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:55.387 st o festering_strike Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, corrupting_rage
1:56.707 st n clawing_shadows Fluffy_Pillow 53.0/100: 53% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), unholy_assault, festermight(8), commander_of_the_dead, corrupting_rage
1:58.026 st p death_coil Fluffy_Pillow 71.0/100: 71% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), unholy_assault, festermight(9), commander_of_the_dead, corrupting_rage
1:59.347 st n clawing_shadows Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), unholy_assault, festermight(9), commander_of_the_dead, corrupting_rage
2:00.668 st p death_coil Fluffy_Pillow 54.0/100: 54% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), unholy_assault, festermight(10), commander_of_the_dead, corrupting_rage
2:01.988 Waiting     0.929s 24.0/100: 24% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(10), commander_of_the_dead, corrupting_rage
2:02.917 st o festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, commander_of_the_dead, corrupting_rage
2:04.238 st l death_coil Fluffy_Pillow 49.0/100: 49% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
2:05.559 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), corrupting_rage
2:06.878 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight, corrupting_rage
2:08.198 high_prio_actions j outbreak Fluffy_Pillow 2.0/100: 2% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight, corrupting_rage
2:09.518 st n clawing_shadows Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight, corrupting_rage
2:10.839 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 25.0/100: 25% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
2:10.839 Waiting     0.259s 25.0/100: 25% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
2:11.098 st l death_coil Fluffy_Pillow 30.0/100: 30% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
2:12.418 st n clawing_shadows Fluffy_Pillow 0.0/100: 0% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
2:13.739 st l death_coil Fluffy_Pillow 18.0/100: 18% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(3), corrupting_rage
2:15.060 st n clawing_shadows Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
2:16.380 st p death_coil Fluffy_Pillow 31.0/100: 31% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:17.701 st o festering_strike Fluffy_Pillow 6.0/100: 6% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:19.022 Waiting     0.094s 26.0/100: 26% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(4), corrupting_rage
2:19.116 st p death_coil Fluffy_Pillow 31.0/100: 31% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(4), corrupting_rage
2:20.436 st n clawing_shadows Fluffy_Pillow 1.0/100: 1% runic_power
1.0/6: 17% rune		 icy_talons(3), runic_corruption, festermight(4), corrupting_rage
2:21.756 Waiting     0.920s 19.0/100: 19% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(5), corrupting_rage
2:22.676 cooldowns T dark_transformation PR_Death_Knight_Unholy 19.0/100: 19% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(5), corrupting_rage
2:23.996 st o festering_strike Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:25.317 st l death_coil Fluffy_Pillow 44.0/100: 44% runic_power
0.0/6: 0% rune		 icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead
2:26.638 st m death_and_decay Fluffy_Pillow 14.0/100: 14% runic_power
1.0/6: 17% rune		 icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead
2:27.959 cooldowns U apocalypse Fluffy_Pillow 24.0/100: 24% runic_power
1.0/6: 17% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead
2:29.217 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(4), commander_of_the_dead
2:30.475 st n clawing_shadows Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead
2:31.733 st n clawing_shadows Fluffy_Pillow 49.0/100: 49% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead
2:32.437 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead
2:32.991 st n clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, dragon_games_equipment
2:34.249 high_prio_actions j outbreak Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(7), commander_of_the_dead
2:35.505 st l death_coil Fluffy_Pillow 90.0/100: 90% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(7), commander_of_the_dead
2:36.763 st l death_coil Fluffy_Pillow 90.0/100: 90% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead
2:38.084 st o festering_strike Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(7), commander_of_the_dead
2:39.404 st n clawing_shadows Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(7), commander_of_the_dead, corrupting_rage
2:40.725 st l death_coil Fluffy_Pillow 98.0/100: 98% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(8), commander_of_the_dead, corrupting_rage
2:42.046 st l death_coil Fluffy_Pillow 98.0/100: 98% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(8), commander_of_the_dead, corrupting_rage
2:43.367 st n clawing_shadows Fluffy_Pillow 73.0/100: 73% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, corrupting_rage
2:44.688 st l death_coil Fluffy_Pillow 86.0/100: 86% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), festermight(9), commander_of_the_dead, corrupting_rage
2:46.009 st n clawing_shadows Fluffy_Pillow 61.0/100: 61% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(9), commander_of_the_dead, corrupting_rage
2:47.330 st o festering_strike Fluffy_Pillow 74.0/100: 74% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(10), commander_of_the_dead, corrupting_rage
2:48.650 st l death_coil Fluffy_Pillow 99.0/100: 99% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
2:49.971 st n clawing_shadows Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
2:51.292 st l death_coil Fluffy_Pillow 82.0/100: 82% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
2:52.613 st l death_coil Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
2:53.934 st n clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, corrupting_rage
2:55.255 st l death_coil Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
2:56.576 st n clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
2:57.896 st n clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), festermight(3), corrupting_rage
2:59.217 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:00.538 high_prio_actions h army_of_the_dead PR_Death_Knight_Unholy 11.0/100: 11% runic_power
4.0/6: 67% rune		 icy_talons(3), runic_corruption, festermight(4), corrupting_rage
3:01.859 high_prio_actions j outbreak Fluffy_Pillow 21.0/100: 21% runic_power
4.0/6: 67% rune		 icy_talons(3), festermight(4), corrupting_rage
3:03.180 trinkets r use_item_algethar_puzzle_box Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune		 icy_talons(3), festermight(4), corrupting_rage
3:04.936 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune		 icy_talons(3), festermight(4), algethar_puzzle, corrupting_rage
3:06.257 st m death_and_decay Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune		 icy_talons(3), festermight(4), algethar_puzzle, corrupting_rage
3:07.577 st l death_coil Fluffy_Pillow 16.0/100: 16% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), sudden_doom, festermight(4), algethar_puzzle, corrupting_rage
3:08.835 cooldowns T dark_transformation PR_Death_Knight_Unholy 16.0/100: 16% runic_power
4.0/6: 67% rune		 unholy_ground, icy_talons(3), runic_corruption, festermight(4), algethar_puzzle, corrupting_rage
3:10.092 cooldowns S summon_gargoyle PR_Death_Knight_Unholy 21.0/100: 21% runic_power
5.0/6: 83% rune		 unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:10.092 high_prio_actions i death_coil Fluffy_Pillow 71.0/100: 71% runic_power
5.0/6: 83% rune		 unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:11.350 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 41.0/100: 41% runic_power
6.0/6: 100% rune		 unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:11.350 high_prio_actions i death_coil Fluffy_Pillow 41.0/100: 41% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:12.608 cooldowns V empower_rune_weapon PR_Death_Knight_Unholy 11.0/100: 11% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:12.608 cooldowns W unholy_assault Fluffy_Pillow 16.0/100: 16% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:13.702 cooldowns U apocalypse Fluffy_Pillow 16.0/100: 16% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:14.796 cooldowns X soul_reaper Fluffy_Pillow 28.0/100: 28% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:15.890 st n clawing_shadows Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:16.984 st m death_and_decay Fluffy_Pillow 56.0/100: 56% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:18.133 racials k berserking PR_Death_Knight_Unholy 71.0/100: 71% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:18.133 st l death_coil Fluffy_Pillow 71.0/100: 71% runic_power
4.0/6: 67% rune		 berserking, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:19.127 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:20.122 st n clawing_shadows Fluffy_Pillow 11.0/100: 11% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:21.117 cooldowns X soul_reaper Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:22.112 st l death_coil Fluffy_Pillow 34.0/100: 34% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:23.107 st n clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
5.0/6: 83% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:24.100 st n clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:25.095 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:26.090 st o festering_strike Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:27.085 cooldowns X soul_reaper Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:28.161 high_prio_actions j outbreak Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:29.206 st l death_coil Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:30.251 st l death_coil Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:31.400 st n clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:32.549 st n clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:33.698 cooldowns X soul_reaper Fluffy_Pillow 41.0/100: 41% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:35.019 st l death_coil Fluffy_Pillow 51.0/100: 51% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), sudden_doom, commander_of_the_dead, corrupting_rage
3:36.339 st n clawing_shadows Fluffy_Pillow 51.0/100: 51% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
3:37.660 st n clawing_shadows Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
3:38.981 st l death_coil Fluffy_Pillow 82.0/100: 82% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
3:40.302 cooldowns X soul_reaper Fluffy_Pillow 52.0/100: 52% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
3:41.623 st o festering_strike Fluffy_Pillow 62.0/100: 62% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
3:42.944 st l death_coil Fluffy_Pillow 82.0/100: 82% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
3:44.265 st n clawing_shadows Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
3:45.586 st l death_coil Fluffy_Pillow 65.0/100: 65% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:46.906 cooldowns X soul_reaper Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:48.227 st l death_coil Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:49.548 st n clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
3:50.869 st l death_coil Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:52.189 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 8.0/100: 8% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
3:52.189 st o festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
3:53.510 cooldowns X soul_reaper Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:54.830 cooldowns T dark_transformation PR_Death_Knight_Unholy 38.0/100: 38% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:56.149 high_prio_actions j outbreak Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
3:57.470 st l death_coil Fluffy_Pillow 48.0/100: 48% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:58.791 cooldowns U apocalypse Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, corrupting_rage
4:00.112 cooldowns X soul_reaper Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:01.433 st l death_coil Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:02.753 st m death_and_decay Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:04.074 st n clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:05.332 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:06.590 cooldowns X soul_reaper Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(5), commander_of_the_dead, corrupting_rage
4:07.848 st n clawing_shadows Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:09.106 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, corrupting_rage
4:10.364 st o festering_strike Fluffy_Pillow 31.0/100: 31% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
4:11.622 st n clawing_shadows Fluffy_Pillow 56.0/100: 56% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
4:12.880 cooldowns X soul_reaper Fluffy_Pillow 69.0/100: 69% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
4:14.201 st p death_coil Fluffy_Pillow 79.0/100: 79% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(7), commander_of_the_dead, corrupting_rage
4:15.522 st n clawing_shadows Fluffy_Pillow 49.0/100: 49% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(7), commander_of_the_dead, corrupting_rage
4:16.843 st p death_coil Fluffy_Pillow 67.0/100: 67% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(8), commander_of_the_dead, corrupting_rage
4:18.163 st n clawing_shadows Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(8), commander_of_the_dead, corrupting_rage
4:19.484 cooldowns X soul_reaper Fluffy_Pillow 50.0/100: 50% runic_power
1.0/6: 17% rune		 icy_talons(3), commander_of_the_dead, corrupting_rage
4:20.805 st l death_coil Fluffy_Pillow 60.0/100: 60% runic_power
0.0/6: 0% rune		 icy_talons(3), commander_of_the_dead, corrupting_rage
4:22.126 high_prio_actions j outbreak Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune		 icy_talons(3), runic_corruption, commander_of_the_dead, corrupting_rage
4:23.447 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune		 icy_talons(3), commander_of_the_dead, corrupting_rage
4:24.767 st n clawing_shadows Fluffy_Pillow 15.0/100: 15% runic_power
1.0/6: 17% rune		 icy_talons(3), commander_of_the_dead, corrupting_rage
4:26.088 cooldowns X soul_reaper Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight, corrupting_rage
4:27.408 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), sudden_doom, festermight, corrupting_rage
4:28.728 st n clawing_shadows Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), runic_corruption, festermight, corrupting_rage
4:30.049 st p death_coil Fluffy_Pillow 51.0/100: 51% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
4:31.370 st o festering_strike Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
4:32.437 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 46.0/100: 46% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
4:32.690 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 46.0/100: 46% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), dragon_games_equipment, corrupting_rage
4:32.690 st p death_coil Fluffy_Pillow 46.0/100: 46% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(2), dragon_games_equipment, corrupting_rage
4:34.010 cooldowns X soul_reaper Fluffy_Pillow 16.0/100: 16% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
4:35.331 st n clawing_shadows Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
4:36.652 st n clawing_shadows Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
4:37.973 st l death_coil Fluffy_Pillow 57.0/100: 57% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
4:39.293 st n clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
4:40.614 cooldowns T dark_transformation PR_Death_Knight_Unholy 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(5), corrupting_rage
4:41.935 cooldowns X soul_reaper Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:43.256 cooldowns W unholy_assault Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:44.577 cooldowns U apocalypse Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:45.898 st l death_coil Fluffy_Pillow 67.0/100: 67% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:47.219 st l death_coil Fluffy_Pillow 37.0/100: 37% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, commander_of_the_dead, corrupting_rage
4:48.539 cooldowns X soul_reaper Fluffy_Pillow 12.0/100: 12% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, commander_of_the_dead, corrupting_rage
4:49.860 high_prio_actions j outbreak Fluffy_Pillow 22.0/100: 22% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, commander_of_the_dead, corrupting_rage
4:51.180 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, commander_of_the_dead, corrupting_rage
4:52.500 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, commander_of_the_dead, corrupting_rage
4:53.820 st n clawing_shadows Fluffy_Pillow 2.0/100: 2% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:55.141 st n clawing_shadows Fluffy_Pillow 15.0/100: 15% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight, commander_of_the_dead, corrupting_rage
4:56.461 st l death_coil Fluffy_Pillow 33.0/100: 33% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
4:57.781 st o festering_strike Fluffy_Pillow 3.0/100: 3% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
4:59.102 st n clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6014 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3848 0 16397 15616 9166
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 327940 312320 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 21.57% 15.36% 1504
Haste 13.88% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6314 5922 0
Mastery 44.93% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +923 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +923 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Talents

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowUnholy Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=sizzling_seafood_medley
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2,if=!equipped.fyralath_the_dreamrender|raid_event.adds.exists
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
actions.precombat+=/variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl

# Executed every time the actor is available.
actions=auto_attack
# Call Action Lists
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup_complete=0
actions+=/call_action_list,name=cooldowns,if=variable.st_planning
actions+=/call_action_list,name=aoe_cooldowns,if=variable.adds_remain
actions+=/call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
actions+=/call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
actions+=/call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
actions+=/call_action_list,name=st,if=active_enemies<=3

# Generic AoE
actions.aoe=epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# AoE Burst
actions.aoe_burst=epidemic,if=(rune<1|talent.bursting_sores&death_knight.fwounded_targets=0|!talent.bursting_sores)&!variable.pooling_runic_power&(active_enemies>=6|runic_power.deficit<30|buff.festermight.stack=20)
actions.aoe_burst+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=1
actions.aoe_burst+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_burst+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe_burst+=/wound_spender

# AoE Cooldowns
actions.aoe_cooldowns=vile_contagion,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.aoe_cooldowns+=/summon_gargoyle
actions.aoe_cooldowns+=/abomination_limb,if=rune<2|buff.festermight.stack>10|!talent.festermight|buff.festermight.up&buff.festermight.remains<12
actions.aoe_cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=talent.bursting_sores&debuff.festering_wound.up&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
actions.aoe_cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=!talent.bursting_sores&debuff.festering_wound.stack>=4|set_bonus.tier31_2pc&debuff.festering_wound.stack>=1
actions.aoe_cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.stack<=2|buff.dark_transformation.up
actions.aoe_cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.aoe_cooldowns+=/dark_transformation,if=(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.aoe_cooldowns+=/empower_rune_weapon,if=buff.dark_transformation.up
actions.aoe_cooldowns+=/sacrificial_pact,if=!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# AoE Setup
actions.aoe_setup=any_dnd,if=(!talent.bursting_sores|death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets>=8|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5)&(!talent.defile|talent.defile&buff.defile.remains<gcd)
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies&talent.bursting_sores
actions.aoe_setup+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies
actions.aoe_setup+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=cooldown.apocalypse.remains<variable.apoc_timing&debuff.festering_wound.stack<4
actions.aoe_setup+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# ST/Cleave Cooldowns
actions.cooldowns=summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=cooldown.apocalypse.remains<5
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)

# Garg Setup
actions.garg_setup=apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.garg_setup+=/any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>1
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
actions.garg_setup+=/empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=23
actions.garg_setup+=/unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=23
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
actions.garg_setup+=/festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
actions.garg_setup+=/death_coil,if=rune<=1

# Priority Actions
actions.high_prio_actions=mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
actions.high_prio_actions+=/antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle))
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
actions.high_prio_actions+=/invoke_external_buff,name=power_infusion,if=(variable.st_planning|variable.adds_remain)&(pet.gargoyle.active&pet.gargoyle.remains<=22|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.army_ghoul.remains<=18|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+10>cooldown.invoke_external_buff_power_infusion.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))
actions.high_prio_actions+=/potion,if=(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
actions.high_prio_actions+=/any_dnd,if=variable.adds_remain&!death_and_decay.ticking&!talent.bursting_sores&talent.defile&buff.defile.remains<gcd
actions.high_prio_actions+=/army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<3*gcd|!talent.summon_gargoyle|fight_remains<35
actions.high_prio_actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|cooldown.unholy_assault.ready|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
actions.high_prio_actions+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains|!talent.summon_gargoyle)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
actions.high_prio_actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd&time>15|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration+3
actions.racials+=/berserking,if=(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(18>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=18|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|active_enemies>=2&death_and_decay.ticking)|fight_remains<=18
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration+3
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Single Target
actions.st=death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
actions.st+=/epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
actions.st+=/any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)
actions.st+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.st+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4
actions.st+=/death_coil
actions.st+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack>=4

# Trinkets
actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&(active_enemies<5|active_enemies>21|fight_remains<4)&(debuff.festering_wound.stack>=2|time>15)
actions.trinkets+=/use_item,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<16|!talent.summon_gargoyle&pet.army_ghoul.active&pet.army_ghoul.remains<16)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(variable.damage_trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(variable.damage_trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
actions.variables+=/variable,name=garg_setup_complete,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&(cooldown.apocalypse.remains>1|!talent.apocalypse)|!talent.summon_gargoyle|time>20
actions.variables+=/variable,name=apoc_timing,op=setif,value=7,value_else=3,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
actions.variables+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
actions.variables+=/variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4|set_bonus.tier31_4pc&(pet.apoc_magus.active|pet.army_magus.active)&debuff.festering_wound.stack>=1)|fight_remains<5&debuff.festering_wound.stack>=1
actions.variables+=/variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions.variables+=/variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies=1&(!raid_event.adds.exists|raid_event.adds.in>15)
actions.variables+=/variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
actions.variables+=/variable,name=spend_rp,op=setif,value=1,value_else=0,condition=(!talent.rotten_touch|talent.rotten_touch&!debuff.rotten_touch.up|runic_power.deficit<20)&(!set_bonus.tier31_4pc|set_bonus.tier31_4pc&!(pet.apoc_magus.active|pet.army_magus.active)|runic_power.deficit<20|rune<3)&((talent.improved_death_coil&(active_enemies=2|talent.coil_of_devastation)|rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3|!variable.pop_wounds&debuff.festering_wound.stack>=4))

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=9166
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 18081 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
18080.6 18080.6 10.9 / 0.061% 1902.0 / 10.5% 190.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
92.2 91.7 Mana 0.00% 51.9 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 18081
Devouring Plague 4401 24.3% 21.0 14.24s 62788 53927 Direct 21.0 25042 50189 28362 13.2%
Periodic 65.1 9800 19599 11102 13.3% 41.5%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.00 21.00 65.12 65.12 0.00 1.1644 1.9097 1318560.59 1318560.59 0.00% 8860.34 53926.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.80% 18.23 10 25 25042.17 23608 34132 25047.11 23978 26564 456458 456458 0.00%
crit 13.20% 2.77 0 10 50189.15 47215 68264 47606.77 0 68264 139151 139151 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.72% 56.47 40 74 9799.97 2435 16211 9802.43 9031 10761 553416 553416 0.00%
crit 13.28% 8.65 1 21 19598.56 4870 32421 19605.95 4870 26132 169535 169535 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.912450
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.06

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.908300
  • base_td:0.00
  • base_td_mult:1.06
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 191.2%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [P]:21.00
  • if_expr:remains<=gcd.max|insanity.deficit<=16
  • target_if_expr:!talent.distorted_reality|active_enemies=1|remains<=gcd.max

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Percent Cost Mind Devourer3732041-1.000Spell Data
Mind Blast 2692 14.9% 36.0 8.41s 22447 19169 Direct 36.0 19810 39645 22448 13.3%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.95 35.95 0.00 0.00 0.00 1.1710 0.0000 807008.00 807008.00 0.00% 19169.29 19169.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.70% 31.17 18 43 19809.60 18267 28539 19815.93 19078 20787 617465 617465 0.00%
crit 13.30% 4.78 0 14 39644.67 36535 57078 39419.22 0 56973 189543 189543 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:625
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.16

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage{$?s424509=false}[ and increases your spell damage to the target by {$424509s1=10}% for {$214621d=9 seconds}.][.]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s2=0}/100} Insanity.|r][]

Action Priority List

    main
    [S]:36.10
  • if_expr:(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703313PCT0.490
Spell Direct AmountShadow Priest13703322PCT0.370
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Mind Spike 6773 37.5% 179.3 1.66s 11327 9674 Direct 179.3 9993 20026 11327 13.3%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 179.26 179.26 0.00 0.00 0.00 1.1710 0.0000 2030503.04 2030503.04 0.00% 9673.62 9673.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.70% 155.41 112 197 9992.93 9238 14432 9995.57 9737 10403 1553035 1553035 0.00%
crit 13.30% 23.84 6 44 20025.72 18476 28864 20033.01 18844 22694 477468 477468 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.808652
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.06

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage. |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity.|r

Action Priority List

    filler
    [M]:179.95
  • target_if_expr:dot.devouring_plague.remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Shadow Weaving 61 0.3% 33.0 6.42s 545 0 Direct 33.0 545 0 545 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.00 33.00 0.00 0.00 0.00 0.0000 0.0000 17985.87 17985.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 33.00 33 33 545.02 326 1603 545.03 472 706 17986 17986 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:651.62
  • base_dd_max:651.62
  • base_dd_mult:1.06

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Shadow Word: Death 605 3.3% 4.1 15.00s 43632 36044 Direct 4.1 38240 77031 43633 13.9%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.14 4.14 0.00 0.00 0.00 1.2106 0.0000 180799.03 180799.03 0.00% 36044.46 36044.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.10% 3.57 0 5 38240.10 34080 49273 38249.95 0 49273 136434 136434 0.00%
crit 13.90% 0.58 0 4 77031.43 68160 98545 35403.05 0 98545 44365 44365 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.98

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to your target. If your target is not killed by Shadow Word: Death, you take backlash damage equal to {$s5=8}% of your maximum health.{$?=}A364675[ Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][ Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s4=0}/100} Insanity.|r][]

Action Priority List

    filler
    [J]:4.14
  • target_if_expr:(target.health.pct<20|buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703315PCT0.600
Spell Direct AmountShadow Priest13703320PCT-0.420
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Soulseeker Arrow 1043 5.8% 7.0 37.93s 44518 0 Periodic 79.9 3916 0 3916 0.0% 37.7%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 0.00 79.88 79.88 2.33 0.0000 1.4161 312817.76 312817.76 0.00% 2765.26 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 79.88 14 180 3915.88 121 4407 3911.80 3813 4148 312818 312818 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3629.20
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1730}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 2009 11.1% 13.5 21.06s 44691 37966 Periodic 127.8 4159 8335 4713 13.3% 99.4%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.48 0.00 127.81 127.81 13.48 1.1772 2.3334 602400.11 602400.11 0.00% 1917.89 37965.60
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.73% 110.85 77 143 4159.33 9 5947 4160.39 4040 4331 461059 461059 0.00%
crit 13.27% 16.96 3 37 8334.85 19 11895 8338.08 7260 9267 141341 141341 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.59
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [R]:13.48
  • if_expr:refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash|!talent.whispering_shadows)&(!action.shadow_crash.in_flight|!talent.whispering_shadows)
  • target_if_expr:remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Periodic AmountShadow Priest1370334PCT0.500
Spell Direct AmountShadow Priest1370335PCT0.500
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
pet - shadowfiend 4193 / 496
melee 4193 2.7% 33.0 6.42s 4448 4300 Direct 33.0 3935 7863 4447 13.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.00 33.00 0.00 0.00 0.00 1.0344 0.0000 146768.22 146768.22 0.00% 4299.77 4299.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.95% 28.69 21 33 3934.68 3718 4573 3934.76 3799 4307 112894 112894 0.00%
crit 13.05% 4.31 0 12 7862.95 7435 9147 7789.71 0 9147 33874 33874 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 1.0 0.00s

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    cds
    [F]:1.00
  • if_expr:buff.power_infusion.up|fight_remains<=15
Devouring Plague (_heal) 86.1 3.40s

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 86.12 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 191.2%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Percent Cost Mind Devourer3732041-1.000Spell Data
Phial of Static Empowerment 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.00
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Shadowfiend 2.0 0.00s

Stats Details: Shadowfiend

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0791 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowfiend

  • id:34433
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:343726
  • description:Summons a shadowy fiend to attack the target for {$d=15 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$262485s1=200}/100} Insanity each time the Shadowfiend attacks.|r][ |cFFFFFFFFGenerates {$=}{{$s4=5}/10}.1% Mana each time the Shadowfiend attacks.|r]

Action Priority List

    main
    [O]:2.00
  • if_expr:variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
Shadowform 1.0 0.00s

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 1.0 0.00s

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 127.8 2.33s

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 127.81 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Periodic AmountShadow Priest1370334PCT0.500
Spell Direct AmountShadow Priest1370335PCT0.500
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 1.0 0.0 0.0s 0.0s 14.4s 4.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.8s / 15.0s
  • uptime_min/max:3.84% / 6.22%

Stack Uptimes

  • blood_fury_1:4.86%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Devoured Pride 1.0 0.0 0.0s 0.0s 15.0s 5.07% 5.84% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s
  • uptime_min/max:4.17% / 6.25%

Stack Uptimes

  • devoured_pride_1:5.07%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0s 0.0s 29.4s 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.8s / 30.0s
  • uptime_min/max:8.01% / 12.49%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0s 0.0s 300.0s 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 60.5s 45.4s 16.5s 23.75% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 221.3s
  • trigger_min/max:0.0s / 204.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.9s
  • uptime_min/max:4.92% / 57.43%

Stack Uptimes

  • sophic_devotion_1:23.75%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.2 0.0 0.0s 0.0s 19.4s 1.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.8s / 20.0s
  • uptime_min/max:0.00% / 8.26%

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:1.62%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.2 0.0 0.0s 0.0s 19.4s 1.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.8s / 20.0s
  • uptime_min/max:0.00% / 8.26%

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:1.59%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.3 0.0 0.0s 0.0s 19.4s 1.69% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.8s / 20.0s
  • uptime_min/max:0.00% / 8.25%

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:1.69%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.3 0.0 0.0s 0.0s 19.4s 1.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.8s / 20.0s
  • uptime_min/max:0.00% / 8.22%

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:1.65%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0s 0.0s 300.0s 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:Primary stat is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Idol of Y'Shaarj Devoured Violence procs 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 85.77% 83.37% 87.42% 6.6s 0.0s 8.9s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Shadow Word: Death62.9740.000294.158261.817201.160316.358
Shadowfiend0.3500.0000.7290.7000.6680.729
Mind Blast0.221-0.0001.9038.0507.7669.318

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Mana RegenMana714.1027516.70100.00%38.53739270.7796.41%
ShadowfiendInsanity33.0066.006.15%2.000.000.00%
Mind BlastInsanity35.95215.7120.10%6.000.000.00%
Mind SpikeInsanity179.26717.0266.81%4.000.000.00%
Shadow Word: DeathInsanity4.1416.571.54%4.000.000.00%
Vampiric TouchInsanity14.4857.925.40%4.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 21.001050.01100.00%50.0050.001255.76
Mind BlastMana 35.9522469.4281.27%625.00625.0035.92
Shadow Word: DeathMana 4.145179.6418.73%1250.001249.9934.91
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 273300.0 268.01 288.15 495880.0 267256.3 252018.9 273300.0
Mana 250000.0 91.72 92.16 739271.1 249867.6 248130.1 250000.0
Insanity 4.0 3.58 3.50 0.0 23.2 0.0 50.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 18080.57
Minimum 16536.04
Maximum 20114.78
Spread ( max - min ) 3578.74
Range [ ( max - min ) / 2 * 100% ] 9.90%
Standard Deviation 483.7120
5th Percentile 17332.08
95th Percentile 18911.94
( 95th Percentile - 5th Percentile ) 1579.86
Mean Distribution
Standard Deviation 5.5858
95.00% Confidence Interval ( 18069.62 - 18091.52 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2750
0.1 Scale Factor Error with Delta=300 1998
0.05 Scale Factor Error with Delta=300 7990
0.01 Scale Factor Error with Delta=300 199737
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 18080.57
Minimum 16536.04
Maximum 20114.78
Spread ( max - min ) 3578.74
Range [ ( max - min ) / 2 * 100% ] 9.90%
Standard Deviation 483.7120
5th Percentile 17332.08
95th Percentile 18911.94
( 95th Percentile - 5th Percentile ) 1579.86
Mean Distribution
Standard Deviation 5.5858
95.00% Confidence Interval ( 18069.62 - 18091.52 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2750
0.1 Scale Factor Error with Delta=300 1998
0.05 Scale Factor Error with Delta=300 7990
0.01 Scale Factor Error with Delta=300 199737
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 18080.57
Minimum 16536.04
Maximum 20114.78
Spread ( max - min ) 3578.74
Range [ ( max - min ) / 2 * 100% ] 9.90%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 5270074.41
Minimum 4029780.59
Maximum 6611540.59
Spread ( max - min ) 2581760.00
Range [ ( max - min ) / 2 * 100% ] 24.49%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 288.85
Minimum 212.56
Maximum 354.66
Spread ( max - min ) 142.10
Range [ ( max - min ) / 2 * 100% ] 24.60%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 268.49
Minimum 207.52
Maximum 354.30
Spread ( max - min ) 146.77
Range [ ( max - min ) / 2 * 100% ] 27.33%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 shadowform,if=!buff.shadowform.up
5 0.00 arcane_torrent
6 0.00 shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(!set_bonus.tier31_4pc|spell_targets.shadow_crash>1)
7 0.00 vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice|set_bonus.tier31_4pc&spell_targets.shadow_crash=1
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=holding_crash,op=set,value=raid_event.adds.in<15
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
8 0.00 run_action_list,name=aoe,if=active_enemies>2
9 0.00 run_action_list,name=main
actions.cds
# count action,conditions
E 1.00 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
TODO: Check VE/DA enter conditions based on dots
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
F 1.00 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 use_item,name=nymues_unraveling_spindle,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<3+gcd.max|fight_remains<15)
Use Nymue's before we go into our cooldowns
0.00 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
Sync Power Infusion with Voidform or Dark Ascension
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
0.00 dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
G 0.00 call_action_list,name=trinkets
0.00 desperate_prayer,if=health.pct<=75
Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.filler
# count action,conditions
0.00 vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
H 0.00 call_action_list,name=heal_for_tof,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&(talent.rhapsody|talent.divine_star|talent.halo)
0.00 power_word_shield,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&talent.crystalline_reflection
Use PWS with CR talented to trigger TOF if there are no better alternatives available to do this as we still get insanity for a PWS cast.
I 0.00 call_action_list,name=empowered_filler,if=dot.devouring_plague.remains>action.mind_spike.cast_time|!talent.mind_spike
J 4.14 shadow_word_death,target_if=(target.health.pct<20|buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking
Cast Shadow Word: Death if the target is in execute, you have a Deathspeaker proc or you have the Season 3 2-piece bonus
0.00 shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
0.00 mindgames,target_if=max:dot.devouring_plague.remains
0.00 devouring_plague,if=buff.voidform.up|cooldown.dark_ascension.up|buff.mind_devourer.up
0.00 halo,if=spell_targets>1
Save up to 20s if adds are coming soon.
0.00 power_word_life,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up
Using a heal with no damage kickbacks for TOF is damage neutral, so we will do it.
K 0.00 call_action_list,name=empowered_filler
L 0.00 call_action_list,name=heal_for_tof,if=equipped.rashoks_molten_heart&(active_allies-(10-buff.molten_radiance.value))>=10&buff.molten_radiance.up,line_cd=5
M 179.95 mind_spike,target_if=max:dot.devouring_plague.remains
0.00 mind_flay,target_if=max:dot.devouring_plague.remains,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 divine_star
0.00 shadow_crash,if=raid_event.adds.in>20&!set_bonus.tier31_4pc
Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 shadow_word_death,target_if=max:dot.devouring_plague.remains
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain,target_if=max:dot.devouring_plague.remains,if=set_bonus.tier31_4pc
Use Shadow Word: Pain while moving as a low-priority action with T31 4pc
0.00 shadow_word_pain,target_if=min:remains,if=!set_bonus.tier31_4pc
Use Shadow Word: Pain while moving as a low-priority action without T31 4pc
actions.main
# count action,conditions
0.00 variable,name=dots_up,op=set,value=active_dot.vampiric_touch=active_enemies|action.shadow_crash.in_flight&talent.whispering_shadows
N 0.00 call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
O 2.00 mindbender,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active and sync with Dark Ascension
0.00 void_bolt,if=variable.dots_up
Use Void Bolt at the highest priority
P 21.00 devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=remains<=gcd.max|insanity.deficit<=16
0.00 shadow_word_death,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)&dot.devouring_plague.ticking
0.00 mind_blast,target_if=dot.devouring_plague.remains>execute_time&(cooldown.mind_blast.full_recharge_time<=gcd.max+execute_time)|pet.fiend.remains<=execute_time+gcd.max,if=pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>execute_time&active_enemies<=7
High priority Mind Blast action when using Inescapable Torment
0.00 shadow_word_death,target_if=dot.devouring_plague.ticking&pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
Q 0.00 call_action_list,name=heal_for_tof,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&(talent.rhapsody|talent.divine_star|talent.halo)
0.00 devouring_plague,if=fight_remains<=duration+4
Spend your Insanity on Devouring Plague at will if the fight will end in less than 10s
0.00 devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=insanity.deficit<=35&talent.distorted_reality|buff.dark_ascension.up|buff.mind_devourer.up&cooldown.mind_blast.up
Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
0.00 void_torrent,if=!variable.holding_crash&talent.idol_of_cthun&cooldown.mind_blast.full_recharge_time>=3&talent.void_eruption,target_if=dot.devouring_plague.remains>=2.5
0.00 shadow_word_death,if=set_bonus.tier31_2pc
0.00 shadow_crash,if=!variable.holding_crash&(dot.vampiric_touch.refreshable|buff.deaths_torment.stack>9&set_bonus.tier31_4pc&active_enemies>1)
Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
0.00 shadow_word_pain,if=buff.deaths_torment.stack>9&set_bonus.tier31_4pc&active_enemies=1
Consume T31 4pc SWPs
0.00 shadow_word_death,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
R 13.48 vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash|!talent.whispering_shadows)&(!action.shadow_crash.in_flight|!talent.whispering_shadows)
Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
S 36.10 mind_blast,if=(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
0.00 void_torrent,if=!variable.holding_crash&(!talent.idol_of_cthun|!talent.void_eruption),target_if=dot.devouring_plague.remains>=2.5,interrupt_if=cooldown.shadow_word_death.ready&pet.fiend.active&set_bonus.tier31_2pc
Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
T 0.00 call_action_list,name=filler
Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=(buff.power_infusion.up|fight_remains<20)&equipped.voidmenders_shadowgem
0.00 use_item,name=iridal_the_earths_master,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
0.00 use_item,name=dreambinder_loom_of_the_great_cycle,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno,if=equipped.darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime,if=equipped.darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance,if=equipped.darkmoon_deck_box_dance
0.00 use_item,name=conjured_chillglobe
0.00 use_item,name=iceblood_deathsnare,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.iceblood_deathsnare>=5)|fight_remains<20
0.00 use_item,name=erupting_spear_fragment,if=(buff.power_infusion.up|raid_event.adds.up|fight_remains<20)&equipped.erupting_spear_fragment
Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
0.00 use_item,name=belorrelos_the_suncaller,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5|fight_remains<20)&equipped.belorrelos_the_suncaller
Use Belor'relos on cooldown except to hold for incoming adds or if already facing 5 or more targets
0.00 use_item,name=beacon_to_the_beyond,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20)&equipped.beacon_to_the_beyond
Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
U 1.00 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex,if=equipped.desperate_invokers_codex

Sample Sequence

01247OSMMMMMMPSMMMMMMRPSMMMMMMSMMMPMMSMMMMMMRSMPMMMMSMMMMMMSPMRMMMSMMMMMPSMMMMMRSMMMMPMSMMMMMMSMRPMMMSMMMMMMSMPMMRMSMMMMMMSPMMMMMSMRMMMPSMMMMMMSMMMMPRSMMMMMMSMMPMMOSRMMMMMPSMMMMMMPSMRMMMMSMMMMPMSMMMMMRSMMPMMMSMMMMMMSMPRJMMSMMMMMMSPJMMRMSEMMMMMPSJUMMMMFMSRMMMPJSMMM

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 4 shadowform PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 7 vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment
0:00.000 main O shadowfiend Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, static_empowerment
0:00.939 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment
0:01.878 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
16.0/100: 16% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(2)
0:02.817 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(3)
0:03.755 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(4)
0:04.693 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:05.632 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:06.571 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:07.508 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:08.446 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:09.385 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:10.324 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:11.263 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:12.201 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:13.139 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:14.078 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:15.017 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:15.956 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:16.895 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:17.833 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:18.772 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:19.711 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:20.650 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:21.588 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:22.527 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:23.465 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:24.403 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
38.0/100: 38% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:25.342 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:26.280 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:27.219 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 bloodlust, shadowform, static_empowerment(5)
0:28.158 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 bloodlust, shadowform, static_empowerment(5)
0:29.096 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, static_empowerment(5)
0:30.035 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, static_empowerment(5)
0:30.973 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
14.0/100: 14% insanity		 bloodlust, shadowform, static_empowerment(5)
0:31.912 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 bloodlust, shadowform, static_empowerment(5)
0:32.850 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 bloodlust, shadowform, static_empowerment(5)
0:33.789 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 bloodlust, shadowform, static_empowerment(5)
0:34.727 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 bloodlust, shadowform, static_empowerment(5)
0:35.666 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 bloodlust, shadowform, static_empowerment(5)
0:36.605 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 bloodlust, shadowform, static_empowerment(5)
0:37.543 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, static_empowerment(5)
0:38.481 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
48.0/100: 48% insanity		 bloodlust, shadowform, static_empowerment(5)
0:39.419 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, static_empowerment(5)
0:40.357 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
0:41.577 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
0:42.797 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
0:44.017 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
0:45.237 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
0:46.537 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
0:47.756 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
0:48.976 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
0:50.196 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
0:51.415 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
0:52.635 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
0:53.855 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
0:55.075 main P devouring_plague Fluffy_Pillow 249385.2/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
0:56.294 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
0:57.513 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
0:58.733 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
0:59.952 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
1:01.172 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
1:02.392 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
1:03.612 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:04.832 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
1:06.052 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
1:07.271 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:08.489 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
1:09.709 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
1:10.929 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
1:12.148 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:13.367 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
1:14.587 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
1:15.805 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
1:17.024 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
1:18.244 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
1:19.464 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:20.684 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
1:21.904 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
1:23.123 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
1:24.343 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
1:25.563 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
1:26.781 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
1:28.000 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:29.218 filler M mind_spike Fluffy_Pillow 249380.1/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
1:30.436 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
1:31.656 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
1:32.876 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
1:34.093 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
1:35.312 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
1:36.532 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
1:37.752 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:38.972 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
1:40.192 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
1:41.412 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
1:42.631 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
1:43.851 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
1:45.070 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
1:46.289 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
1:47.509 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
1:48.728 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
1:49.947 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:51.166 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
1:52.386 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
1:53.606 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:54.826 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
1:56.045 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
1:57.263 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
1:58.483 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:59.703 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:00.922 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:02.140 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:03.360 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:04.580 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:05.798 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:07.017 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:08.237 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:09.456 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:10.676 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:11.896 main P devouring_plague Fluffy_Pillow 249385.2/250000: 100% mana
54.0/100: 54% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:13.116 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:14.336 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
2:15.556 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
2:16.776 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
2:17.995 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
2:19.215 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
2:20.434 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
2:21.654 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
2:22.874 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
2:24.094 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
2:25.313 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
2:26.531 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
2:27.750 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
2:28.970 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
2:30.189 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
2:31.409 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
2:32.628 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
2:33.847 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
2:35.067 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
2:36.286 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:37.506 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:38.725 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:39.944 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:41.162 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:42.382 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:43.601 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:44.820 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:46.039 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
12.0/100: 12% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:47.259 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:48.479 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:49.699 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:50.918 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:52.138 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
2:53.356 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
2:54.576 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
2:55.796 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
2:57.015 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
2:58.235 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
2:59.455 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
3:00.674 main O shadowfiend Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
3:01.893 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
3:03.113 main R vampiric_touch Fluffy_Pillow 249385.2/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
3:04.333 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
3:05.553 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
3:06.773 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
3:07.993 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
3:09.213 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
3:10.432 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
3:11.652 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:12.872 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
3:14.092 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
3:15.312 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
3:16.532 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
3:17.752 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
3:18.971 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
3:20.190 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
3:21.410 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
3:22.629 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:23.849 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
3:25.068 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
3:26.288 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
3:27.508 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
3:28.728 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
3:29.948 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
3:31.167 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
3:32.387 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
3:33.606 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
3:34.826 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
3:36.046 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
3:37.266 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
3:38.486 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:39.705 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
3:40.925 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
3:42.144 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
3:43.364 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
3:44.584 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
3:45.803 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
3:47.022 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
3:48.241 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
3:49.461 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
3:50.680 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
3:51.900 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
3:53.120 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
3:54.340 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
3:55.559 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
3:56.779 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
3:57.999 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
3:59.218 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
4:00.438 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
4:01.658 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
4:02.878 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
4:04.098 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
4:05.317 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
4:06.537 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
4:07.757 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
4:08.976 filler J shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
4:10.196 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
4:11.414 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
4:12.634 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
4:13.854 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
4:15.074 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
4:16.293 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
4:17.513 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
4:18.733 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
4:19.953 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
4:21.173 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
4:22.393 main P devouring_plague Fluffy_Pillow 249385.2/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
4:23.613 filler J shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
4:24.833 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
4:26.053 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
4:27.272 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
4:28.492 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
4:29.711 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
4:30.931 cds E potion Fluffy_Pillow 249385.2/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
4:30.931 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:32.150 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:33.369 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:34.589 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:35.809 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:37.029 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:38.248 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:39.468 filler J shadow_word_death Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.688 trinkets U use_items Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.688 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:41.907 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:43.127 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:44.347 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.565 cds F blood_fury PR_Priest_Shadow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.565 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:46.785 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:48.004 main R vampiric_touch Fluffy_Pillow 249382.7/250000: 100% mana
36.0/100: 36% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:49.224 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:50.444 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:51.664 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:52.884 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:54.104 filler J shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:55.324 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:56.542 filler M mind_spike Fluffy_Pillow 249380.1/250000: 100% mana
12.0/100: 12% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:57.762 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:58.981 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3848 1 13665 13015 9166
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 273300 260300 0
Mana 250000 250000 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 2560 2560 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +923 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +692 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +923 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +923 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +111 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +692 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +519 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +519 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +923 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Talents

RowPriest Talents [1]
1
2
3
4
5
6
7
8
9
10
RowShadow Talents [2]
1
2
3
4
5
6
7
8
9
10

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(!set_bonus.tier31_4pc|spell_targets.shadow_crash>1)
actions.precombat+=/vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice|set_bonus.tier31_4pc&spell_targets.shadow_crash=1

# Executed every time the actor is available.
actions=variable,name=holding_crash,op=set,value=raid_event.adds.in<15
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
actions+=/run_action_list,name=aoe,if=active_enemies>2
actions+=/run_action_list,name=main

actions.aoe=call_action_list,name=aoe_variables
# High Priority action to put out Vampiric Touch on enemies that will live at least 18 seconds, up to 12 targets manually while prepping AoE
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.dots_up),if=variable.max_vts>0&!variable.manual_vts_applied&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Crash to apply Vampiric Touch to as many adds as possible while being efficient with Vampiric Touch refresh windows
actions.aoe+=/shadow_crash,if=!variable.holding_crash,target_if=dot.vampiric_touch.refreshable|dot.vampiric_touch.remains<=target.time_to_die&!buff.voidform.up&(raid_event.adds.in-dot.vampiric_touch.remains)<15
actions.aoe+=/call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend or Mindbender on cooldown if DoTs are active and sync with Dark Ascension
actions.aoe+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.dots_up|action.shadow_crash.in_flight&talent.whispering_shadows)&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
# Use Void Bolt at the highest priority
actions.aoe+=/void_bolt,target_if=max:target.time_to_die
actions.aoe+=/devouring_plague,target_if=max:target.time_to_die*(!dot.devouring_plague.ticking),if=talent.distorted_reality&(active_dot.devouring_plague=0|insanity.deficit<=20)
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff or if Inescapable Torment is talented with Mindbender active. Only use when facing 3-7 targets.
actions.aoe+=/mind_blast,target_if=max:dot.devouring_plague.remains,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&active_enemies<=7&!buff.mind_devourer.up&dot.devouring_plague.remains>execute_time
# High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
actions.aoe+=/call_action_list,name=heal_for_tof,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&(talent.rhapsody|talent.divine_star|talent.halo)
# Use Devouring Plague on enemies that will live the longest with distorted reality.
actions.aoe+=/devouring_plague,target_if=max:target.time_to_die*(!dot.devouring_plague.ticking),if=talent.distorted_reality
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.aoe+=/devouring_plague,if=(remains<=gcd.max&!variable.pool_for_cds|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2)&!talent.distorted_reality
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.dots_up),if=variable.max_vts>0&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash)&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
# High Priority Mind Spike: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up&variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# # Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.aoe+=/mind_blast,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent action list for AoE
actions.aoe+=/void_torrent,target_if=max:dot.devouring_plague.remains,if=(!variable.holding_crash|raid_event.adds.count%(active_dot.vampiric_touch+raid_event.adds.count)<1.5)&(dot.devouring_plague.remains>=2.5|buff.voidform.up)
# High priority action for Mind Flay: Insanity to fish for Idol of C'Thun procs, cancel as soon as something else is more important and most of the channel has completed
actions.aoe+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up&talent.idol_of_cthun,interrupt_if=ticks>=2,interrupt_immediate=1
actions.aoe+=/call_action_list,name=filler

actions.aoe_variables=variable,name=max_vts,op=set,default=12,value=spell_targets.vampiric_touch>?12
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
# TODO: Revamp to fix undesired behaviour with unstacked fights
actions.aoe_variables+=/variable,name=dots_up,op=set,value=(active_dot.vampiric_touch+8*(action.shadow_crash.in_flight&talent.whispering_shadows))>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=holding_crash,op=set,value=(variable.max_vts-active_dot.vampiric_touch)<4|raid_event.adds.in<10&raid_event.adds.count>(variable.max_vts-active_dot.vampiric_touch),if=variable.holding_crash&talent.whispering_shadows
actions.aoe_variables+=/variable,name=manual_vts_applied,op=set,value=(active_dot.vampiric_touch+8*!variable.holding_crash)>=variable.max_vts|!variable.is_vt_possible

# TODO: Check VE/DA enter conditions based on dots
actions.cds=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
actions.cds+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions.cds+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions.cds+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions.cds+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
# Use Nymue's before we go into our cooldowns
actions.cds+=/use_item,name=nymues_unraveling_spindle,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<3+gcd.max|fight_remains<15)
# Sync Power Infusion with Voidform or Dark Ascension
actions.cds+=/power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
# Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
# Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
actions.cds+=/call_action_list,name=trinkets
# Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.cds+=/desperate_prayer,if=health.pct<=75

actions.empowered_filler=mind_spike_insanity,target_if=max:dot.devouring_plague.remains
actions.empowered_filler+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up

# Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
actions.filler=vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
actions.filler+=/call_action_list,name=heal_for_tof,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&(talent.rhapsody|talent.divine_star|talent.halo)
# Use PWS with CR talented to trigger TOF if there are no better alternatives available to do this as we still get insanity for a PWS cast.
actions.filler+=/power_word_shield,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&talent.crystalline_reflection
actions.filler+=/call_action_list,name=empowered_filler,if=dot.devouring_plague.remains>action.mind_spike.cast_time|!talent.mind_spike
# Cast Shadow Word: Death if the target is in execute, you have a Deathspeaker proc or you have the Season 3 2-piece bonus
actions.filler+=/shadow_word_death,target_if=(target.health.pct<20|buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking
actions.filler+=/shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
actions.filler+=/mindgames,target_if=max:dot.devouring_plague.remains
actions.filler+=/devouring_plague,if=buff.voidform.up|cooldown.dark_ascension.up|buff.mind_devourer.up
# Save up to 20s if adds are coming soon.
actions.filler+=/halo,if=spell_targets>1
# Using a heal with no damage kickbacks for TOF is damage neutral, so we will do it.
actions.filler+=/power_word_life,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up
actions.filler+=/call_action_list,name=empowered_filler
actions.filler+=/call_action_list,name=heal_for_tof,if=equipped.rashoks_molten_heart&(active_allies-(10-buff.molten_radiance.value))>=10&buff.molten_radiance.up,line_cd=5
actions.filler+=/mind_spike,target_if=max:dot.devouring_plague.remains
actions.filler+=/mind_flay,target_if=max:dot.devouring_plague.remains,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
actions.filler+=/divine_star
# Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
actions.filler+=/shadow_crash,if=raid_event.adds.in>20&!set_bonus.tier31_4pc
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.filler+=/shadow_word_death,target_if=target.health.pct<20
# Use Shadow Word: Death while moving as a low-priority action
actions.filler+=/shadow_word_death,target_if=max:dot.devouring_plague.remains
# Use Shadow Word: Pain while moving as a low-priority action with T31 4pc
actions.filler+=/shadow_word_pain,target_if=max:dot.devouring_plague.remains,if=set_bonus.tier31_4pc
# Use Shadow Word: Pain while moving as a low-priority action without T31 4pc
actions.filler+=/shadow_word_pain,target_if=min:remains,if=!set_bonus.tier31_4pc

# Use Halo to acquire Twist of Fate if an ally can be healed for it and it is not currently up.
actions.heal_for_tof=halo
# Use Divine Star to acquire Twist of Fate if an ally can be healed for it and it is not currently up.
actions.heal_for_tof+=/divine_star
# Use Holy Nova when Rhapsody is fully stacked to acquire Twist of Fate if an ally can be healed for it and it is not currently up.
actions.heal_for_tof+=/holy_nova,if=buff.rhapsody.stack=20&talent.rhapsody

actions.main=variable,name=dots_up,op=set,value=active_dot.vampiric_touch=active_enemies|action.shadow_crash.in_flight&talent.whispering_shadows
actions.main+=/call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active and sync with Dark Ascension
actions.main+=/mindbender,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
# Use Void Bolt at the highest priority
actions.main+=/void_bolt,if=variable.dots_up
actions.main+=/devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=remains<=gcd.max|insanity.deficit<=16
actions.main+=/shadow_word_death,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)&dot.devouring_plague.ticking
# High priority Mind Blast action when using Inescapable Torment
actions.main+=/mind_blast,target_if=dot.devouring_plague.remains>execute_time&(cooldown.mind_blast.full_recharge_time<=gcd.max+execute_time)|pet.fiend.remains<=execute_time+gcd.max,if=pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>execute_time&active_enemies<=7
# High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
actions.main+=/shadow_word_death,target_if=dot.devouring_plague.ticking&pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
actions.main+=/call_action_list,name=heal_for_tof,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&(talent.rhapsody|talent.divine_star|talent.halo)
# Spend your Insanity on Devouring Plague at will if the fight will end in less than 10s
actions.main+=/devouring_plague,if=fight_remains<=duration+4
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.main+=/devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=insanity.deficit<=35&talent.distorted_reality|buff.dark_ascension.up|buff.mind_devourer.up&cooldown.mind_blast.up
actions.main+=/void_torrent,if=!variable.holding_crash&talent.idol_of_cthun&cooldown.mind_blast.full_recharge_time>=3&talent.void_eruption,target_if=dot.devouring_plague.remains>=2.5
actions.main+=/shadow_word_death,if=set_bonus.tier31_2pc
# Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
actions.main+=/shadow_crash,if=!variable.holding_crash&(dot.vampiric_touch.refreshable|buff.deaths_torment.stack>9&set_bonus.tier31_4pc&active_enemies>1)
# Consume T31 4pc SWPs
actions.main+=/shadow_word_pain,if=buff.deaths_torment.stack>9&set_bonus.tier31_4pc&active_enemies=1
# Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
actions.main+=/shadow_word_death,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
# Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
actions.main+=/vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash|!talent.whispering_shadows)&(!action.shadow_crash.in_flight|!talent.whispering_shadows)
# Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.main+=/mind_blast,if=(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
actions.main+=/void_torrent,if=!variable.holding_crash&(!talent.idol_of_cthun|!talent.void_eruption),target_if=dot.devouring_plague.remains>=2.5,interrupt_if=cooldown.shadow_word_death.ready&pet.fiend.active&set_bonus.tier31_2pc
# Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.main+=/call_action_list,name=filler

actions.trinkets=use_item,name=voidmenders_shadowgem,if=(buff.power_infusion.up|fight_remains<20)&equipped.voidmenders_shadowgem
actions.trinkets+=/use_item,name=iridal_the_earths_master,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
actions.trinkets+=/use_item,name=dreambinder_loom_of_the_great_cycle,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno,if=equipped.darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime,if=equipped.darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance,if=equipped.darkmoon_deck_box_dance
actions.trinkets+=/use_item,name=conjured_chillglobe
actions.trinkets+=/use_item,name=iceblood_deathsnare,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.iceblood_deathsnare>=5)|fight_remains<20
# Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
actions.trinkets+=/use_item,name=erupting_spear_fragment,if=(buff.power_infusion.up|raid_event.adds.up|fight_remains<20)&equipped.erupting_spear_fragment
# Use Belor'relos on cooldown except to hold for incoming adds or if already facing 5 or more targets
actions.trinkets+=/use_item,name=belorrelos_the_suncaller,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5|fight_remains<20)&equipped.belorrelos_the_suncaller
# Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
actions.trinkets+=/use_item,name=beacon_to_the_beyond,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20)&equipped.beacon_to_the_beyond
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
actions.trinkets+=/use_item,name=desperate_invokers_codex,if=equipped.desperate_invokers_codex

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=9166
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 50033 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
50033.4 50033.4 51.8 / 0.104% 9012.5 / 18.0% 69.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
677.9 676.3 Mana 0.90% 52.1 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQJJSIAAAAAAAAAAAAgSESCJkioQSDAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 50033
Doom Winds 101 0.2% 3.7 90.42s 8076 7293 Direct 3.7 6658 13390 8077 21.1% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.1077 0.0000 30155.16 43079.90 30.00% 7292.66 7292.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.93% 2.95 0 4 6658.11 3767 12981 6646.21 0 10145 19621 28031 29.87%
crit 21.07% 0.79 0 4 13389.68 7534 25963 7825.63 0 23490 10534 15049 17.50%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.73
  • if_expr:raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Flame Shock 1678 3.4% 29.6 10.04s 17032 44971 Direct 29.6 3012 6020 3634 20.7% 0.0%
Periodic 184.2 1783 3564 2150 20.6% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.56 29.56 184.23 184.23 27.96 0.3787 1.5777 503499.39 503499.39 0.00% 1668.02 44971.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.32% 23.45 11 37 3012.05 2557 4879 3011.78 2677 3453 70627 70627 0.00%
crit 20.68% 6.11 0 18 6020.50 5113 9681 6001.59 0 8349 36812 36812 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.40% 146.27 103 193 1782.68 2 2868 1782.22 1634 1955 260759 260759 0.00%
crit 20.60% 37.96 16 64 3564.47 4 5735 3563.10 3100 4067 135301 135301 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.08

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:1.08
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Volcanic damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Volcanic damage and then an additional {$=}o2 Volcanic damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Volcanic damage and knocking them into the air.]

Action Priority List

    single
    [O]:1.60
  • if_expr:!ticking
    single
    [W]:7.92

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.090
Spell Periodic AmountEnhancement Shaman13704115PCT-0.090
Spell Direct AmountFire and Ice3828861PCT0.030
Spell Periodic AmountFire and Ice3828862PCT0.030
Flametongue Weapon 0 (1368) 0.0% (2.7%) 1.0 0.00s 410086 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFire and Ice3828861PCT0.030
    Flametongue Attack 1368 2.7% 991.8 0.68s 413 0 Direct 991.8 343 686 413 20.6% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 991.76 991.76 0.00 0.00 0.00 0.0000 0.0000 410086.48 410086.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 786.96 544 1069 342.60 285 555 342.66 319 377 269608 269608 0.00%
crit 20.65% 204.80 114 298 685.94 569 1110 686.08 631 769 140478 140478 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Forgestorm Ignited (_damage) 1239 2.5% 28.5 7.74s 13054 0 Direct 28.5 10808 21617 13054 20.8% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.47 28.47 0.00 0.00 0.00 0.0000 0.0000 371597.13 371597.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.22% 22.55 2 64 10808.47 10705 11241 10800.32 10705 11151 243741 243741 0.00%
crit 20.78% 5.91 0 21 21617.36 21411 22481 21298.65 0 22481 127857 127857 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1063 2.1% 14.3 19.51s 22324 18665 Direct 14.3 18557 37047 22324 20.4% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.29 14.29 0.00 0.00 0.00 1.1961 0.0000 319066.40 319066.40 0.00% 18665.40 18665.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.63% 11.38 3 25 18557.25 8260 32545 18615.76 13617 25475 211192 211192 0.00%
crit 20.37% 2.91 0 10 37047.00 16520 65091 35323.71 0 65091 107875 107875 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.08

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [U]:14.29

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownEnhancement Shaman1370417ADD6000.000
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.090
Spell Periodic AmountEnhancement Shaman13704115PCT-0.090
Spell Direct AmountFire and Ice3828861PCT0.030
Ice Strike 1877 3.8% 21.5 13.80s 26135 22039 Direct 21.5 21683 43447 26135 20.5% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.54 21.54 0.00 0.00 0.00 1.1859 0.0000 563064.37 563064.37 0.00% 22038.61 22038.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.54% 17.14 8 26 21683.22 17716 34905 21677.24 19225 24695 371592 371592 0.00%
crit 20.46% 4.41 0 13 43447.00 35433 69810 43042.68 0 63096 191473 191473 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [P]:20.51
  • if_expr:!buff.ice_strike.up
    single
    [R]:1.03

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Lava Lash 1762 3.5% 20.0 14.72s 26372 22171 Direct 20.0 21869 43715 26372 20.6% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.04 20.04 0.00 0.00 0.00 1.1895 0.0000 528488.88 528488.88 0.00% 22170.95 22170.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.39% 15.91 7 24 21868.65 18658 35108 21859.32 19029 25255 347898 347898 0.00%
crit 20.61% 4.13 0 13 43715.12 37316 70019 43224.89 0 63577 180591 180591 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [Q]:20.04

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownMolten Assault3340331ADD-3000.000
Spell Direct AmountFire and Ice3828861PCT0.030
Lightning Bolt 13775 27.5% 68.1 4.36s 60613 51254 Direct 68.1 50239 100476 60614 20.7% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.15 68.15 0.00 0.00 0.00 1.1826 0.0000 4130695.73 4130695.73 0.00% 51253.78 51253.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 54.08 32 79 50238.83 34014 100963 50243.39 43491 58381 2716689 2716689 0.00%
crit 20.65% 14.07 3 31 100475.75 68027 200352 100485.72 78111 135297 1414006 1414006 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.09

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [N]:68.15
  • if_expr:((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
Spell Direct AmountThorim's Invocation3844442PCT0.200
main_hand 1789 3.6% 193.3 1.81s 2775 1557 Direct 193.3 2660 5324 2775 20.7% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.31 193.31 0.00 0.00 0.00 1.7822 0.0000 536360.86 766249.34 30.00% 1556.91 1556.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.92% 121.64 76 175 2659.81 2257 4294 2659.69 2439 2951 323528 462195 30.00%
crit 20.68% 39.98 15 67 5323.80 4513 8506 5323.40 4743 5975 212833 304055 30.00%
miss 16.39% 31.69 13 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 896 1.8% 193.5 1.80s 1389 779 Direct 193.5 1332 2665 1389 20.6% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.46 193.46 0.00 0.00 0.00 1.7836 0.0000 268736.51 383919.09 30.00% 778.84 778.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.05% 121.98 77 170 1331.80 1128 2151 1331.73 1224 1467 162449 232075 30.00%
crit 20.62% 39.88 18 67 2665.02 2257 4302 2664.82 2305 3013 106288 151844 30.00%
miss 16.33% 31.60 14 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (9716) 0.0% (19.4%) 90.8 3.29s 32078 27340

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.77 0.00 0.00 0.00 0.00 1.1733 0.0000 0.00 0.00 0.00% 27339.71 27339.71

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:57.25
  • if_expr:buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
    single
    [S]:33.52

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
    Stormstrike (_mh) 5266 (6479) 10.5% (12.9%) 120.9 2.47s 16061 0 Direct 120.9 (173.4) 10817 21650 13054 20.6% (14.4%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.89 120.89 0.00 0.00 0.00 0.0000 0.0000 1578052.10 2254417.63 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 95.93 56 155 10816.93 3255 27719 10836.36 8788 12986 1037646 1482390 30.00%
crit 20.65% 24.96 8 48 21649.98 6510 54797 21689.70 14533 28806 540406 772028 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
        Stormblast (_stormstrike_mh) 1213 2.4% 52.6 5.62s 6917 0 Direct 52.6 6917 0 6917 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.56 52.56 0.00 0.00 0.00 0.0000 0.0000 363530.08 363530.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 52.56 27 92 6917.06 3572 24214 6918.53 5426 8710 363530 363530 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2631 (3238) 5.3% (6.5%) 120.9 2.47s 8026 0 Direct 120.9 (173.4) 5409 10821 6524 20.6% (14.4%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.89 120.89 0.00 0.00 0.00 0.0000 0.0000 788617.78 1126625.56 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.41% 95.99 54 150 5408.98 1627 13860 5418.40 4551 6543 519231 741778 30.00%
crit 20.59% 24.89 8 50 10821.02 3255 27398 10841.60 7454 14539 269386 384847 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
        Stormblast (_stormstrike_offhand) 606 1.2% 52.6 5.62s 3455 0 Direct 52.6 3455 0 3455 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.56 52.56 0.00 0.00 0.00 0.0000 0.0000 181588.50 181588.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 52.56 27 92 3455.24 1786 12182 3456.10 2776 4389 181588 181588 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 977 2.0% 6.0 50.57s 48608 40880 Direct 6.0 40204 80290 48608 21.0% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.03 6.03 0.00 0.00 0.00 1.1891 0.0000 293112.46 293112.46 0.00% 40880.40 40880.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.04% 4.77 1 8 40204.35 26247 83385 40225.46 26247 61929 191615 191615 0.00%
crit 20.96% 1.26 0 5 80289.51 52493 163165 60702.12 0 155553 101498 101498 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [T]:6.03
  • if_expr:raid_event.adds.in>=action.sundering.cooldown

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Tempest Strikes 3777 7.5% 162.5 1.84s 6969 0 Direct 162.5 5778 11563 6969 20.6% 0.0%

Stats Details: Tempest Strikes

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 162.46 162.46 0.00 0.00 0.00 0.0000 0.0000 1132156.59 1132156.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.42% 129.02 78 195 5778.49 4847 9378 5778.69 5336 6338 745548 745548 0.00%
crit 20.58% 33.44 13 57 11563.11 9694 18576 11563.10 10305 13393 386608 386608 0.00%

Action Details: Tempest Strikes

  • id:428078
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:428078
  • name:Tempest Strikes
  • school:nature
  • tooltip:
  • description:{$@spelldesc428071=Stormstrike, Ice Strike, and Lava Lash have a {$h=100}% chance to discharge electricity at your target, dealing {$428078s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Windfury Weapon 0 (6897) 0.0% (13.8%) 1.0 0.00s 2064645 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6897 13.8% 375.2 2.49s 5503 0 Direct 375.2 4554 9135 5503 20.7% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 375.16 375.16 0.00 0.00 0.00 0.0000 0.0000 2064644.91 2949567.93 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.28% 297.41 166 437 4554.07 1878 11981 4554.82 3957 5458 1354431 1934951 30.00%
crit 20.72% 77.74 37 131 9135.45 3756 23183 9136.27 7626 11530 710214 1014617 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
pet - greater_earth_elemental 430 / 89
melee 430 0.2% 38.9 2.28s 681 437 Direct 38.9 564 1129 681 20.7% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.87 38.87 0.00 0.00 0.00 1.5592 0.0000 26474.09 37821.10 30.00% 436.77 436.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 30.85 0 55 564.49 488 884 563.67 0 727 17412 24876 30.00%
crit 20.65% 8.03 0 22 1128.74 976 1775 1127.06 0 1578 9062 12945 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4090 / 3027
melee 4090 6.0% 383.2 1.56s 2367 2039 Direct 383.2 1961 3928 2367 20.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 383.22 383.22 0.00 0.00 0.00 1.1606 0.0000 906954.15 1295681.82 30.00% 2039.28 2039.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.37% 304.15 209 424 1960.88 1630 3124 1961.15 1797 2173 596398 852018 30.00%
crit 20.63% 79.07 39 133 3927.81 3260 6247 3928.23 3537 4451 310557 443663 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.1 307.90s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.12 0.00 0.00 0.00 0.00 1.0411 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [V]:1.12
Feral Spirit 15.5 20.41s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.50 0.00 0.00 0.00 0.00 1.1690 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:15.50

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 301.83s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 3.1 114.09s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.09 0.00 0.00 0.00 0.00 0.5582 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Action Priority List

    single
    [M]:1.48
  • if_expr:!buff.windfury_totem.up
    single
    [X]:0.61
  • if_expr:buff.windfury_totem.remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.8s 58.3s 50.0s 80.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 344.0s
  • trigger_min/max:15.0s / 306.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.8s
  • uptime_min/max:44.21% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.11%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Crumbling Power 2.0 0.0 180.4s 5.4s 18.4s 12.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.3s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s
  • uptime_min/max:10.24% / 15.39%

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.36%
  • crumbling_power_3:0.72%
  • crumbling_power_4:0.75%
  • crumbling_power_5:0.75%
  • crumbling_power_6:0.71%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.67%
  • crumbling_power_19:0.70%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4s 90.4s 7.9s 9.88% 12.58% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.3s
  • trigger_min/max:90.0s / 92.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:8.79% / 11.46%

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 15.5 0.0 22.2s 19.9s 16.9s 74.01% 100.00% 0.0 (0.0) 12.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 85.4s
  • trigger_min/max:4.8s / 38.3s
  • trigger_pct:49.99%
  • duration_min/max:0.0s / 75.5s
  • uptime_min/max:60.46% / 85.57%

Stack Uptimes

  • earthen_weapon_2:72.30%
  • earthen_weapon_4:1.71%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 301.1s 301.9s 27.5s 13.45% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 316.2s
  • trigger_min/max:300.0s / 316.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.98% / 18.18%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.45%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 13.1 2.4 23.7s 20.4s 16.9s 74.02% 0.00% 62.2 (62.2) 12.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 85.4s
  • trigger_min/max:4.8s / 38.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 75.5s
  • uptime_min/max:60.47% / 85.58%

Stack Uptimes

  • feral_spirit_1:74.02%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 36.7 446.5 8.2s 0.6s 7.2s 88.18% 92.43% 446.5 (1083.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 94.9s
  • trigger_min/max:0.0s / 16.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 94.9s
  • uptime_min/max:77.82% / 95.42%

Stack Uptimes

  • flurry_1:18.98%
  • flurry_2:36.09%
  • flurry_3:33.12%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 107.9 17.9s 2.4s 14.6s 83.79% 100.00% 47.8 (47.8) 16.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 47.9s
  • trigger_min/max:0.0s / 39.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:67.27% / 93.87%

Stack Uptimes

  • forceful_winds_1:16.19%
  • forceful_winds_2:15.02%
  • forceful_winds_3:13.11%
  • forceful_winds_4:10.65%
  • forceful_winds_5:28.82%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=20}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.4s 46.2s 13.0s 19.52% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 216.7s
  • trigger_min/max:0.1s / 216.7s
  • trigger_pct:98.86%
  • duration_min/max:0.0s / 49.0s
  • uptime_min/max:4.03% / 53.32%

Stack Uptimes

  • forgestorm_ignited_1:19.52%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.5 1.0 14.5s 13.8s 8.9s 60.86% 87.64% 1.0 (1.0) 7.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.7s / 58.8s
  • trigger_min/max:8.7s / 45.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.6s
  • uptime_min/max:41.13% / 79.13%

Stack Uptimes

  • ice_strike_1:60.86%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 25.1 23.6 11.9s 6.1s 8.1s 67.89% 100.00% 23.6 (23.6) 24.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 66.3s
  • trigger_min/max:0.9s / 28.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 59.6s
  • uptime_min/max:55.27% / 81.78%

Stack Uptimes

  • legacy_of_the_frost_witch_1:67.89%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your Physical and Frost abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 69.0 400.4 4.4s 0.6s 3.6s 83.91% 100.00% 58.5 (58.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 22.2s
  • trigger_min/max:0.0s / 7.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.0s
  • uptime_min/max:78.91% / 89.18%

Stack Uptimes

  • maelstrom_weapon_1:9.86%
  • maelstrom_weapon_2:10.46%
  • maelstrom_weapon_3:11.51%
  • maelstrom_weapon_4:11.96%
  • maelstrom_weapon_5:9.97%
  • maelstrom_weapon_6:7.31%
  • maelstrom_weapon_7:5.10%
  • maelstrom_weapon_8:3.74%
  • maelstrom_weapon_9:2.84%
  • maelstrom_weapon_10:11.16%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.4s 45.2s 16.5s 23.67% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 218.5s
  • trigger_min/max:0.1s / 218.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.9s
  • uptime_min/max:4.70% / 57.81%

Stack Uptimes

  • sophic_devotion_1:23.67%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.4s 45.7s 32.2s 38.09% 0.00% 25.6 (25.6) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 249.8s
  • trigger_min/max:0.1s / 222.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 178.6s
  • uptime_min/max:8.14% / 86.17%

Stack Uptimes

  • spiraling_winds_1:2.34%
  • spiraling_winds_2:2.31%
  • spiraling_winds_3:2.30%
  • spiraling_winds_4:2.27%
  • spiraling_winds_5:2.26%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.23%
  • spiraling_winds_8:2.22%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.70%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Stormbringer 52.7 15.1 5.6s 4.4s 1.1s 19.46% 57.68% 15.1 (15.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 115.3s
  • trigger_min/max:0.0s / 115.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.1s
  • uptime_min/max:9.93% / 32.44%

Stack Uptimes

  • stormbringer_1:19.46%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.5 36.0 66.0 17.9s 15.0s 47.9s
Windfury-ForcefulWinds: 2 50.6 33.0 66.0 18.2s 0.4s 71.0s
Windfury-ForcefulWinds: 3 48.3 27.0 66.0 19.0s 1.0s 87.5s
Windfury-ForcefulWinds: 4 43.8 21.0 63.0 20.9s 1.2s 92.6s
Windfury-ForcefulWinds: 5 180.9 72.0 303.0 5.0s 0.0s 90.4s
Windfury (Main Hand) 26.7 9.0 47.0 11.0s 1.3s 125.0s
Windfury (Off Hand) 26.7 8.0 51.0 10.9s 1.3s 126.1s
Windfury: Unruly Winds 125.1 72.0 179.0 2.5s 0.0s 39.8s
Stormflurry 30.1 6.0 65.0 9.5s 0.0s 191.0s
Flametongue: Windfury Attack 375.2 216.0 537.0 2.5s 0.0s 39.8s
Stormbringer: Windfury Attack 38.3 13.0 70.0 8.6s 0.0s 148.4s
Flametongue: main_hand 161.6 115.0 213.0 2.2s 1.3s 18.9s
Windfury: main_hand 61.0 27.0 94.0 5.3s 1.3s 75.2s
Flametongue: offhand 161.9 115.0 226.0 2.2s 1.3s 18.8s
Flametongue: Doom Winds 3.7 3.0 4.0 90.4s 90.0s 92.3s
Windfury: Doom Winds 3.7 3.0 4.0 90.4s 90.0s 92.3s
Flametongue: Lava Lash 20.0 13.0 27.0 14.7s 8.7s 52.2s
Stormbringer: Lava Lash 2.0 0.0 8.0 77.7s 8.8s 335.8s
Flametongue: Sundering 6.0 3.0 8.0 50.5s 40.0s 155.2s
Stormbringer: Sundering 0.6 0.0 5.0 113.6s 40.0s 334.2s
Windfury: Sundering 1.9 0.0 6.0 94.3s 40.0s 337.5s
Flametongue: Ice Strike 21.5 15.0 28.0 13.8s 8.7s 45.8s
Stormbringer: Ice Strike 2.2 0.0 8.0 75.4s 8.7s 346.4s
Windfury: Ice Strike 7.1 0.0 17.0 38.6s 8.7s 298.1s
Flametongue: Stormstrike 120.9 74.0 182.0 2.5s 0.0s 21.0s
Stormbringer: Stormstrike 12.4 2.0 36.0 22.2s 0.1s 256.8s
Windfury: Stormstrike 51.3 23.0 87.0 5.8s 0.0s 85.0s
Flametongue: Stormstrike Off-Hand 120.9 74.0 182.0 2.5s 0.0s 21.0s
Stormbringer: Stormstrike Off-Hand 12.3 0.0 30.0 22.4s 0.0s 250.4s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 36.07% 22.71% 44.26% 0.6s 0.0s 5.8s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike
Stormstrike		1.3220.0007.625120.54972.579177.339
Feral Spirit0.7850.0001.62012.1894.06120.148
Doom Winds0.5370.0002.2932.0050.8645.769
Lava Lash3.2640.00039.81466.11030.096132.299
Sundering11.9840.000115.23474.68324.128181.170
Ice Strike2.2540.00033.45248.95618.25893.829
Frost Shock15.3850.000189.984232.233152.830322.054
Flame Shock24.4640.000249.944255.531176.139341.040
Earth Elemental31.8570.000270.43036.93710.387270.430

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack73.616.414.86%27.98%
main_hand34.74.17.00%7.07%
offhand34.54.46.97%7.45%
Feral Spirit76.29.315.38%15.86%
Doom Winds0.80.10.17%0.11%
Lightning Bolt98.10.019.80%0.00%
Lava Lash24.80.05.01%0.00%
Sundering1.50.00.29%0.00%
Ice Strike26.70.05.39%0.00%
Stormstrike75.914.915.32%25.39%
Stormstrike (_mh)24.44.64.94%7.88%
Stormstrike Off-Hand24.14.84.86%8.27%
Overflow Stacks0.058.50.00%10.57%
Actual Stacks495.30.089.43%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt491.3100.00%
Total Spent491.3100.00%
Casts per Maelstrom Weapon Stack Consumed
Ability 0 1 2 3 4 5 6 7 8 9 10
Lightning Bolt          18.45 13.42 9.09 6.25 4.52 16.42
Total           18.45
(27.07%)		 13.42
(19.69%)		 9.09
(13.33%)		 6.25
(9.17%)		 4.52
(6.64%)		 16.42
(24.10%)

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
Mana RegenMana652.63202879.55100.00%310.87564152.4973.55%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 270980.0 0.00 876.47 0.0 8038.9 -459565.5 270980.0
Mana 250000.0 676.26 677.85 564153.0 249523.1 247000.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.001000.000.49%1000.001000.000.00
Flame ShockMana 9.527142.353.51%750.00241.6070.49
Frost ShockMana 14.297146.253.51%500.00500.0144.65
Ice StrikeMana 21.5435548.3617.48%1650.001650.0115.84
Lava LashMana 20.048015.943.94%400.00400.0165.93
Lightning BoltMana 68.1534074.5216.76%500.00500.00121.23
StormstrikeMana 90.7790772.8344.64%1000.001000.0032.08
SunderingMana 6.0318090.798.90%3000.003000.0616.20
Windfury TotemMana 3.091565.390.77%507.06507.060.00

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 50033.41
Minimum 42973.18
Maximum 59751.11
Spread ( max - min ) 16777.93
Range [ ( max - min ) / 2 * 100% ] 16.77%
Standard Deviation 2288.1285
5th Percentile 46366.16
95th Percentile 53900.71
( 95th Percentile - 5th Percentile ) 7534.55
Mean Distribution
Standard Deviation 26.4228
95.00% Confidence Interval ( 49981.62 - 50085.20 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8035
0.1 Scale Factor Error with Delta=300 44694
0.05 Scale Factor Error with Delta=300 178775
0.01 Scale Factor Error with Delta=300 4469352
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 50033.41
Minimum 42973.18
Maximum 59751.11
Spread ( max - min ) 16777.93
Range [ ( max - min ) / 2 * 100% ] 16.77%
Standard Deviation 2288.1285
5th Percentile 46366.16
95th Percentile 53900.71
( 95th Percentile - 5th Percentile ) 7534.55
Mean Distribution
Standard Deviation 26.4228
95.00% Confidence Interval ( 49981.62 - 50085.20 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8035
0.1 Scale Factor Error with Delta=300 44694
0.05 Scale Factor Error with Delta=300 178775
0.01 Scale Factor Error with Delta=300 4469352
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 50033.41
Minimum 42973.18
Maximum 59751.11
Spread ( max - min ) 16777.93
Range [ ( max - min ) / 2 * 100% ] 16.77%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 14063453.35
Minimum 10203003.57
Maximum 18866846.95
Spread ( max - min ) 8663843.38
Range [ ( max - min ) / 2 * 100% ] 30.80%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 875.92
Minimum 0.00
Maximum 2470.08
Spread ( max - min ) 2470.08
Range [ ( max - min ) / 2 * 100% ] 141.00%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
0.00 primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
G 15.50 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
H 3.73 doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
J 0.00 call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
K 0.00 call_action_list,name=funnel,if=active_enemies>1&rotation.funnel
actions.single
# count action,conditions
0.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
L 57.25 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
0.00 lava_lash,if=buff.hot_hand.up
M 1.48 windfury_totem,if=!buff.windfury_totem.up
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
N 68.15 lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
0.00 primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
O 1.60 flame_shock,if=!ticking
0.00 ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
0.00 lava_lash,if=talent.lashing_flames.enabled
P 20.51 ice_strike,if=!buff.ice_strike.up
0.00 frost_shock,if=buff.hailstorm.up
Q 20.04 lava_lash
R 1.03 ice_strike
0.00 windstrike
S 33.52 stormstrike
T 6.03 sundering,if=raid_event.adds.in>=action.sundering.cooldown
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
0.00 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
U 14.29 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
V 1.12 earth_elemental
W 7.92 flame_shock
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
X 0.61 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGHLLLLNLOPLNQTNSLUVNLLGNPQNSLNNNNSRQNUSGNSUWPNQSNSLNLTLNPQGNLNSLNSPNQUNSLUGNPSLLNQSNSHNLLGNLNPQLLNNGNSLLNPQSLMNSTUWPLNQLUWGLNPLNLNQNSUNPSNSGQLNSLPNTUSLNQLNPUEFWHLGLNLNLLNPNQSNSLLLGNPNQSLLNSLNPSNGLNNQSNNPSNGNSQMNNSLLNNGNPNQSLLNSLLNPQSLHNLGNLLNPLNQNSTUNNPGNQS

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 250000.0/250000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 2 augmentation PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 3 windfury_weapon PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 4 flametongue_weapon PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 6 windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana corrupting_rage
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
0:00.000 default B bloodlust Fluffy_Pillow 250000.0/250000: 100% mana corrupting_rage
0:00.000 default C potion Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, corrupting_rage
0:00.000 default D auto_attack Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default F berserking PR_Shaman_Enhancement 249000.0/250000: 100% mana bloodlust, crumbling_power(20), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, berserking, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:00.866 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:01.731 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), doom_winds, crumbling_power(18), corrupting_rage, elemental_potion_of_ultimate_power
0:02.597 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, crumbling_power(17), corrupting_rage, elemental_potion_of_ultimate_power
0:03.463 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(16), corrupting_rage, elemental_potion_of_ultimate_power
0:04.329 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(15), corrupting_rage, elemental_potion_of_ultimate_power
0:05.194 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(14), corrupting_rage, elemental_potion_of_ultimate_power
0:06.060 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, crumbling_power(13), corrupting_rage, elemental_potion_of_ultimate_power
0:06.926 single O flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), doom_winds, legacy_of_the_frost_witch, crumbling_power(12), corrupting_rage, elemental_potion_of_ultimate_power
0:07.792 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), doom_winds, legacy_of_the_frost_witch, crumbling_power(11), corrupting_rage, elemental_potion_of_ultimate_power
0:08.658 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), corrupting_rage, elemental_potion_of_ultimate_power
0:09.524 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, crumbling_power(9), corrupting_rage, elemental_potion_of_ultimate_power
0:10.390 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, crumbling_power(8), spiraling_winds, corrupting_rage, elemental_potion_of_ultimate_power
0:11.256 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, crumbling_power(7), spiraling_winds, corrupting_rage, elemental_potion_of_ultimate_power
0:12.121 single N lightning_bolt Fluffy_Pillow 249214.4/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, crumbling_power(6), spiraling_winds(2), corrupting_rage, elemental_potion_of_ultimate_power
0:13.074 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(2), corrupting_rage, elemental_potion_of_ultimate_power
0:14.026 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(3), corrupting_rage, elemental_potion_of_ultimate_power
0:14.978 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), spiraling_winds(3), corrupting_rage, elemental_potion_of_ultimate_power
0:15.931 single V earth_elemental Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), maelstrom_weapon(4), legacy_of_the_frost_witch, crumbling_power(2), spiraling_winds(4), corrupting_rage, elemental_potion_of_ultimate_power
0:16.884 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, maelstrom_weapon(5), legacy_of_the_frost_witch, crumbling_power, spiraling_winds(4), corrupting_rage, elemental_potion_of_ultimate_power
0:17.837 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), forceful_winds(2), stormbringer, spiraling_winds(5), elemental_potion_of_ultimate_power
0:18.789 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds(3), stormbringer, maelstrom_weapon, spiraling_winds(5), elemental_potion_of_ultimate_power
0:19.742 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, forceful_winds(4), maelstrom_weapon(3), spiraling_winds(6), elemental_potion_of_ultimate_power
0:20.694 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(6), elemental_potion_of_ultimate_power
0:21.646 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(7), elemental_potion_of_ultimate_power
0:22.597 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_potion_of_ultimate_power
0:23.550 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_potion_of_ultimate_power
0:24.503 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_potion_of_ultimate_power
0:25.456 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_potion_of_ultimate_power
0:26.409 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(9), elemental_potion_of_ultimate_power
0:27.362 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_potion_of_ultimate_power
0:28.314 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_potion_of_ultimate_power
0:29.267 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_potion_of_ultimate_power
0:30.220 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
0:31.173 single R ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
0:32.125 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
0:33.078 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
0:34.031 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
0:34.983 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, maelstrom_weapon(2), corrupting_rage
0:35.935 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), maelstrom_weapon(3), corrupting_rage
0:36.887 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), corrupting_rage
0:37.840 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, corrupting_rage
0:38.792 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, corrupting_rage
0:39.745 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
0:40.698 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
0:42.102 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), ice_strike, corrupting_rage
0:43.340 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, corrupting_rage
0:44.577 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, corrupting_rage
0:45.815 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(7), ice_strike, corrupting_rage
0:47.053 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:48.291 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:49.528 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:50.766 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:52.004 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(3), ice_strike, corrupting_rage
0:53.242 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(2), stormbringer, maelstrom_weapon(6), corrupting_rage
0:54.479 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(3), maelstrom_weapon(9), corrupting_rage
0:55.717 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(3), legacy_of_the_frost_witch, corrupting_rage
0:56.955 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:58.193 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(4), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:59.431 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:00.668 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:01.906 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:03.144 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:04.382 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:05.619 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:06.856 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:08.094 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, corrupting_rage
1:09.332 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:10.570 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:11.808 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, corrupting_rage
1:13.046 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), corrupting_rage
1:14.284 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
1:15.522 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
1:16.760 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(4), maelstrom_weapon(4), legacy_of_the_frost_witch, corrupting_rage
1:17.998 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(7), legacy_of_the_frost_witch, corrupting_rage
1:19.430 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), corrupting_rage
1:20.668 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), corrupting_rage
1:21.906 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, corrupting_rage
1:23.144 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, corrupting_rage
1:24.380 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, corrupting_rage
1:25.617 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, corrupting_rage
1:26.854 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:28.092 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:29.330 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:30.567 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:31.805 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:33.043 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), doom_winds, legacy_of_the_frost_witch, corrupting_rage
1:34.280 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(3), stormbringer, maelstrom_weapon(2), doom_winds, legacy_of_the_frost_witch, corrupting_rage
1:35.518 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, corrupting_rage
1:36.755 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(10), doom_winds, corrupting_rage
1:37.993 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, corrupting_rage
1:39.231 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), doom_winds, legacy_of_the_frost_witch, corrupting_rage
1:40.468 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, corrupting_rage
1:41.706 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, corrupting_rage
1:42.944 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:44.181 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:45.419 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:46.657 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion, corrupting_rage
1:47.895 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:49.132 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:50.369 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(4), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:51.607 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:52.845 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:54.082 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:55.318 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:56.556 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:57.793 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:59.029 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:00.265 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:01.503 single M windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), ice_strike, corrupting_rage
2:02.329 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, corrupting_rage
2:03.567 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:04.805 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
2:06.042 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
2:07.279 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(2), corrupting_rage
2:08.516 Waiting     0.194s 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(3), spiraling_winds(2), sophic_devotion, corrupting_rage
2:08.710 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(3), spiraling_winds(2), sophic_devotion, corrupting_rage
2:10.134 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(3), sophic_devotion, corrupting_rage
2:11.372 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(3), maelstrom_weapon(6), ice_strike, spiraling_winds(4), sophic_devotion, corrupting_rage
2:12.610 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, corrupting_rage
2:13.847 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(4), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, corrupting_rage
2:15.085 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion
2:16.323 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion
2:17.560 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds, stormbringer, maelstrom_weapon(6), spiraling_winds(7), sophic_devotion
2:18.798 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), spiraling_winds(8), sophic_devotion
2:20.036 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), spiraling_winds(8), sophic_devotion
2:21.274 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, spiraling_winds(9), sophic_devotion
2:22.511 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(9), sophic_devotion
2:23.748 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(10), sophic_devotion
2:24.986 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
2:26.223 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
2:27.461 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
2:28.698 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
2:29.936 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:31.174 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:32.412 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(5), sophic_devotion, corrupting_rage
2:33.650 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:34.886 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:36.124 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(3), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:37.362 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:38.600 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
2:39.838 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
2:41.076 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
2:42.314 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, forgestorm_ignited, corrupting_rage
2:43.552 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
2:44.789 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
2:46.027 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
2:47.265 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
2:48.503 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, forgestorm_ignited, corrupting_rage
2:49.741 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, corrupting_rage
2:50.979 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(2), corrupting_rage
2:52.217 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), corrupting_rage
2:53.455 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), corrupting_rage
2:54.692 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
2:55.930 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, corrupting_rage
2:57.167 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, corrupting_rage
2:58.405 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), legacy_of_the_frost_witch, spiraling_winds(3), forgestorm_ignited, corrupting_rage
2:59.643 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon, ice_strike, spiraling_winds(4), forgestorm_ignited, corrupting_rage
3:00.881 default E use_item_irideus_fragment Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(3), maelstrom_weapon(3), spiraling_winds(4), forgestorm_ignited, corrupting_rage
3:00.881 default F berserking PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), forceful_winds(3), maelstrom_weapon(3), crumbling_power(20), spiraling_winds(4), forgestorm_ignited, corrupting_rage
3:00.881 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), forceful_winds(3), maelstrom_weapon(3), crumbling_power(19), spiraling_winds(4), forgestorm_ignited, corrupting_rage
3:02.006 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, forceful_winds(3), maelstrom_weapon(4), crumbling_power(19), spiraling_winds(5), forgestorm_ignited
3:03.131 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(6), doom_winds, crumbling_power(18), spiraling_winds(5), forgestorm_ignited
3:04.255 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, forceful_winds(5), stormbringer, maelstrom_weapon(7), doom_winds, crumbling_power(17), spiraling_winds(6), forgestorm_ignited
3:05.380 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds, crumbling_power(16), spiraling_winds(6), forgestorm_ignited
3:06.504 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(15), spiraling_winds(7), forgestorm_ignited
3:07.628 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), doom_winds, legacy_of_the_frost_witch, crumbling_power(14), spiraling_winds(8)
3:08.753 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), doom_winds, legacy_of_the_frost_witch, crumbling_power(13), spiraling_winds(8)
3:09.878 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch, crumbling_power(12), spiraling_winds(9)
3:11.003 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds(9)
3:12.127 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds(10)
3:13.252 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(10)
3:14.489 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(10)
3:15.727 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(10)
3:16.965 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(10), corrupting_rage
3:18.202 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, crumbling_power(5), spiraling_winds(10), corrupting_rage
3:19.440 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), corrupting_rage
3:20.678 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), corrupting_rage
3:21.916 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:23.154 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:24.392 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(7), ice_strike, corrupting_rage
3:25.630 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), forgestorm_ignited, corrupting_rage
3:26.868 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:28.106 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:29.344 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:30.582 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:31.819 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, forgestorm_ignited, corrupting_rage
3:33.056 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, forgestorm_ignited, corrupting_rage
3:34.293 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, forgestorm_ignited, corrupting_rage
3:35.531 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:36.769 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:38.007 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:39.243 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, corrupting_rage
3:40.480 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:41.718 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:42.955 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:44.193 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds, corrupting_rage
3:45.431 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(2), corrupting_rage
3:46.669 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), corrupting_rage
3:47.907 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), corrupting_rage
3:49.144 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), corrupting_rage
3:50.381 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), corrupting_rage
3:51.619 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, corrupting_rage
3:52.856 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, corrupting_rage
3:54.093 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage
3:55.330 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage
3:56.568 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, corrupting_rage
3:57.805 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(4), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion, corrupting_rage
3:59.042 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion, corrupting_rage
4:00.280 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
4:01.518 single M windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
4:02.343 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
4:03.581 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
4:04.819 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
4:06.057 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
4:07.295 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
4:08.532 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
4:09.770 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
4:11.007 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
4:12.245 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
4:13.483 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
4:14.721 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
4:15.959 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
4:17.197 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
4:18.435 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(10), sophic_devotion
4:19.673 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(10)
4:20.911 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10)
4:22.149 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:23.387 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:24.625 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:25.863 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:27.101 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(3), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:28.339 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:29.577 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:30.814 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:32.051 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(4), maelstrom_weapon(7), ice_strike, spiraling_winds(10), corrupting_rage
4:33.287 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(7), doom_winds, ice_strike, spiraling_winds(10), corrupting_rage
4:34.525 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(2), doom_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:35.763 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), maelstrom_weapon(9), doom_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:37.001 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:38.239 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), doom_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:39.476 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:40.712 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:41.949 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:43.185 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:44.423 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:45.661 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:46.898 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:48.136 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:49.374 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:50.611 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:51.849 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:53.086 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon(6), spiraling_winds(10), corrupting_rage
4:54.324 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:55.561 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:56.799 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:58.037 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:59.275 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, spiraling_winds(10), corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 250000 250000 0
Spell Power 2280 6148 0
Crit 21.84% 15.63% 1013
Haste 21.55% 21.55% 3663
Versatility 3.93% 0.93% 191
Mana Regen 2560 2560 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [16]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [29]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQJJSIAAAAAAAAAAAAgSESCJkioQSDAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
actions+=/primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
actions+=/call_action_list,name=funnel,if=active_enemies>1&rotation.funnel

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.funnel=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.funnel+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.funnel+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/windstrike,if=(talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1)|buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/stormstrike,if=buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&buff.crackling_thunder.up
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)|(talent.converging_storms.enabled&buff.converging_storms.stack<buff.converging_storms.max_stack)
actions.funnel+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.funnel+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.funnel+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.funnel+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.funnel+=/sundering
actions.funnel+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.funnel+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=3
actions.funnel+=/stormstrike,if=buff.crash_lightning.up&talent.deeply_rooted_elements.enabled
actions.funnel+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.funnel+=/windstrike
actions.funnel+=/stormstrike
actions.funnel+=/ice_strike
actions.funnel+=/lava_lash
actions.funnel+=/crash_lightning
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=2
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5
actions.funnel+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.funnel+=/flame_shock,if=!ticking
actions.funnel+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
actions.single+=/primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
actions.single+=/lava_lash,if=talent.lashing_flames.enabled
actions.single+=/ice_strike,if=!buff.ice_strike.up
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/ice_strike
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=action.sundering.cooldown
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Ele : 60892 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
60892.2 60892.2 56.0 / 0.092% 9675.4 / 15.9% 110.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
525.6 524.4 Mana 0.32% 53.7 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkESSSDlEAAAAAAAAAAAAAKRIJkQKiCJNAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Ele 60892
Elemental Blast 11362 18.7% 24.8 12.22s 137449 120118 Direct 24.8 113373 226907 137501 21.3% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.78 24.77 0.00 0.00 0.00 1.1443 0.0000 3406060.79 3406060.79 0.00% 120117.82 120117.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.75% 19.51 10 30 113373.26 46819 258766 113382.50 93224 138398 2211571 2211571 0.00%
crit 21.25% 5.26 0 14 226906.64 93638 534051 226154.43 0 368706 1194490 1194490 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:0.28
  • if_expr:buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
    single
    [O]:6.39
  • if_expr:buff.maelstrom_weapon.stack>=5&charges=max_charges
    single
    [Q]:18.11
  • if_expr:buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Resource Cost 2Enhancement Shaman13704112PCT-1.000
Spell Direct AmountEnhancement Shaman13704122PCT-0.090
Spell Direct AmountEnhancement Shaman13704123PCT0.100
Spell Direct AmountFire and Ice3828861PCT0.030
Flame Shock 6428 10.6% 90.4 3.31s 21303 167592 Direct 90.4 7676 15380 9347 21.7% 0.0%
Periodic 196.0 4536 9083 5517 21.6% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.44 90.44 195.99 195.99 89.44 0.1271 1.5215 1926637.91 1926637.91 0.00% 6221.38 167592.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.31% 70.82 44 105 7675.98 4306 19346 7677.00 6664 8995 543629 543629 0.00%
crit 21.69% 19.62 6 39 15380.27 8613 39131 15382.71 12200 20646 301730 301730 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 78.42% 153.69 111 202 4535.77 2489 11508 4536.15 4010 5253 697095 697095 0.00%
crit 21.58% 42.30 20 75 9083.31 4979 22811 9083.13 7769 10735 384183 384183 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.08

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:1.08
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Volcanic damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Volcanic damage and then an additional {$=}o2 Volcanic damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Volcanic damage and knocking them into the air.]

Action Priority List

    single
    [a]:9.73

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.090
Spell Periodic AmountEnhancement Shaman13704115PCT-0.090
Spell Direct AmountFire and Ice3828861PCT0.030
Spell Periodic AmountFire and Ice3828862PCT0.030
Flametongue Weapon 0 (967) 0.0% (1.6%) 1.0 0.00s 289937 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFire and Ice3828861PCT0.030
    Flametongue Attack 967 1.6% 610.0 0.74s 475 0 Direct 610.0 391 782 475 21.6% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 610.04 610.04 0.00 0.00 0.00 0.0000 0.0000 289937.12 289937.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.37% 478.09 339 639 390.60 297 1086 390.62 347 449 186741 186741 0.00%
crit 21.63% 131.95 79 195 782.08 594 2010 782.13 687 911 103196 103196 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Forgestorm Ignited (_damage) 1262 2.1% 28.8 7.61s 13157 0 Direct 28.8 10808 21617 13157 21.7% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.78 28.78 0.00 0.00 0.00 0.0000 0.0000 378660.91 378660.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.27% 22.53 2 65 10808.06 10705 11241 10800.59 10705 11241 243463 243463 0.00%
crit 21.73% 6.25 0 22 21616.70 21411 22481 21422.21 0 22481 135197 135197 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 7105 11.7% 42.8 6.95s 49727 43607 Direct 42.8 40863 81904 49727 21.6% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.83 42.83 0.00 0.00 0.00 1.1403 0.0000 2129774.88 2129774.88 0.00% 43607.18 43607.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.41% 33.58 19 51 40863.45 8620 125762 40924.03 33107 51848 1372218 1372218 0.00%
crit 21.59% 9.25 0 21 81904.46 17241 241711 82041.53 0 143575 757557 757557 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.08

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [V]:42.56
  • if_expr:buff.hailstorm.up
    single
    [Y]:0.27

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownEnhancement Shaman1370417ADD6000.000
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.090
Spell Periodic AmountEnhancement Shaman13704115PCT-0.090
Spell Direct AmountFire and Ice3828861PCT0.030
Ice Strike 2402 3.9% 24.1 12.55s 29821 26157 Direct 24.1 24513 48902 29821 21.8% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.14 24.14 0.00 0.00 0.00 1.1401 0.0000 719847.36 719847.36 0.00% 26157.24 26157.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.24% 18.89 9 28 24512.95 18489 54449 24516.10 20804 28992 462950 462950 0.00%
crit 21.76% 5.25 0 14 48901.75 36979 104639 48753.66 0 82028 256898 256898 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [T]:24.14
  • if_expr:talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Lava Lash 12623 20.7% 73.7 4.04s 51305 45067 Direct 73.7 (73.7) 42160 84351 51306 21.7% (21.7%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 73.73 73.73 0.00 0.00 0.00 1.1384 0.0000 3782830.70 3782830.70 0.00% 45066.96 45066.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.32% 57.75 31 91 42160.14 21808 135932 42159.31 36135 51627 2434720 2434720 0.00%
crit 21.68% 15.98 3 31 84351.19 43617 240993 84340.54 65002 113826 1348111 1348111 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [M]:48.66
  • if_expr:buff.hot_hand.up
    single
    [U]:25.07
  • if_expr:talent.lashing_flames.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownMolten Assault3340331ADD-6000.000
Spell Direct AmountFire and Ice3828861PCT0.030
Lightning Bolt 6045 9.9% 28.7 10.37s 63235 53730 Direct 28.7 52002 104163 63234 21.5% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.66 28.66 0.00 0.00 0.00 1.1769 0.0000 1812274.63 1812274.63 0.00% 53730.46 53730.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.46% 22.49 10 34 52002.11 29581 127117 52040.49 44038 63817 1169395 1169395 0.00%
crit 21.54% 6.17 0 17 104163.11 59163 263846 104180.19 0 170807 642879 642879 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.91

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [P]:6.93
  • if_expr:buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [R]:12.43
  • if_expr:((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
    single
    [X]:9.30
  • if_expr:talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
main_hand 1809 3.0% 193.9 1.80s 2796 1605 Direct 193.9 2657 5320 2796 21.6% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.90 193.90 0.00 0.00 0.00 1.7416 0.0000 542157.96 774531.11 30.00% 1605.46 1605.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.98% 120.17 70 170 2657.26 2257 4294 2657.21 2449 2951 319333 456202 30.00%
crit 21.60% 41.89 17 72 5319.58 4513 8506 5318.88 4784 6063 222824 318329 30.00%
miss 16.42% 31.84 12 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 927 1.5% 198.2 1.76s 1401 806 Direct 198.2 1331 2666 1401 21.6% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 198.25 198.25 0.00 0.00 0.00 1.7388 0.0000 277785.19 396846.10 30.00% 805.83 805.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.96% 122.84 79 173 1331.30 1128 2151 1331.27 1233 1492 163532 233622 30.00%
crit 21.62% 42.86 20 71 2665.65 2257 4302 2665.67 2418 3082 114254 163224 30.00%
miss 16.42% 32.55 12 57 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 0 (4187) 0.0% (6.9%) 7.0 46.17s 179549 150240

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 0.00 0.00 0.00 0.00 1.1951 0.0000 0.00 0.00 0.00% 150240.40 150240.40

Action Details: Primordial Wave

  • id:375982
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:elemental
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=175}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:1.00
  • if_expr:!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
    single
    [S]:5.98
  • if_expr:raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
    Primordial Wave (_damage) 1105 1.8% 7.0 46.17s 47411 0 Direct 7.0 38951 77976 47411 21.7% 0.0%

Stats Details: Primordial Wave Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 0.00 0.0000 0.0000 330992.31 330992.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.32% 5.47 0 8 38950.83 31062 59519 38956.82 0 50135 212974 212974 0.00%
crit 21.68% 1.51 0 7 77975.60 62125 119038 63221.96 0 119038 118018 118018 0.00%

Action Details: Primordial Wave Damage

  • id:375984
  • school:elemental
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:6.00

Spelldata

  • id:375984
  • name:Primordial Wave
  • school:elemental
  • tooltip:
  • description:{$@spelldesc375982=Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=175}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman13704121PCT5.000
    Lightning Bolt (_pw) 3081 5.1% 6.9 45.75s 133153 0 Direct 6.9 109342 219749 133155 21.6% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 0.00 0.0000 0.0000 922763.81 922763.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.43% 5.44 0 8 109341.87 69023 216955 109306.83 0 163171 594313 594313 0.00%
crit 21.57% 1.49 0 7 219749.21 138046 442937 177893.92 0 418101 328451 328451 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.91

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
Stormstrike 0 (1891) 0.0% (3.1%) 32.3 9.14s 17543 15345

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.32 0.00 0.00 0.00 0.00 1.1433 0.0000 0.00 0.00 0.00% 15345.04 15345.04

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [W]:32.32

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
    Stormstrike (_mh) 1261 2.1% 32.3 9.14s 11697 0 Direct 32.3 9619 19256 11697 21.6% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.32 32.32 0.00 0.00 0.00 0.0000 0.0000 378060.82 540100.66 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.44% 25.35 10 41 9618.66 8137 15311 9618.10 8537 11202 243847 348361 30.00%
crit 21.56% 6.97 0 19 19255.75 16274 30623 19230.88 0 28600 134214 191740 29.97%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
    Stormstrike Off-Hand 630 1.0% 32.3 9.14s 5847 0 Direct 32.3 4809 9629 5847 21.5% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.32 32.32 0.00 0.00 0.00 0.0000 0.0000 188968.99 269962.59 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.48% 25.37 10 42 4809.14 4069 7656 4808.94 4283 5462 121985 174268 30.00%
crit 21.52% 6.96 0 18 9629.29 8137 15311 9617.54 0 14854 66984 95694 29.97%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
Windfury Weapon 0 (901) 0.0% (1.5%) 1.0 0.00s 270245 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 901 1.5% 119.8 5.13s 2256 0 Direct 119.8 1853 3711 2256 21.7% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.77 119.77 0.00 0.00 0.00 0.0000 0.0000 270245.43 386074.74 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.30% 93.78 48 155 1853.35 1565 2999 1853.21 1667 2109 173814 248313 30.00%
crit 21.70% 25.99 9 53 3710.68 3130 5997 3710.15 3283 4355 96431 137762 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
pet - greater_earth_elemental 500 / 107
melee 500 0.2% 44.3 2.52s 720 507 Direct 44.3 592 1185 720 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.29 44.29 0.00 0.00 0.00 1.4189 0.0000 31886.80 45553.73 30.00% 507.44 507.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.41% 34.72 17 64 592.01 488 915 589.49 488 757 20557 29368 30.00%
crit 21.59% 9.56 1 27 1184.68 976 1814 1179.17 976 1604 11330 16186 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2470 / 957
melee 2470 1.6% 119.8 2.70s 2389 2141 Direct 119.8 1963 3929 2389 21.7% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.85 119.85 0.00 0.00 0.00 1.1158 0.0000 286315.99 409033.27 30.00% 2141.14 2141.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.31% 93.85 6 218 1962.60 1630 3160 1960.82 1630 2498 184192 263138 30.00%
crit 21.69% 25.99 3 65 3928.74 3260 6247 3925.39 3260 4966 102124 145895 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2459 / 959
melee 2459 1.6% 120.4 2.69s 2386 2138 Direct 120.4 1962 3927 2386 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.35 120.35 0.00 0.00 0.00 1.1163 0.0000 287209.03 410309.08 30.00% 2137.74 2137.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.40% 94.35 8 208 1961.78 1630 3160 1959.50 1630 2823 185092 264423 30.00%
crit 21.60% 26.00 2 63 3927.38 3260 6320 3922.44 3260 5672 102117 145886 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2469 / 963
melee 2469 1.6% 120.7 2.68s 2388 2140 Direct 120.7 1961 3929 2388 21.7% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.74 120.74 0.00 0.00 0.00 1.1161 0.0000 288378.40 411979.65 30.00% 2140.04 2140.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.30% 94.54 9 199 1961.45 1630 3124 1959.57 1630 2452 185438 264919 30.00%
crit 21.70% 26.20 1 63 3929.00 3260 6247 3925.36 3260 5094 102940 147061 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Ele
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.2 310.69s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.20 0.00 0.00 0.00 0.00 0.9269 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Z]:1.20
Feral Spirit 14.4 22.14s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.36 0.00 0.00 0.00 0.00 1.1336 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:14.36

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 303.46s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 3.0 116.83s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.05 0.00 0.00 0.00 0.00 0.5476 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Action Priority List

    single
    [N]:1.66
  • if_expr:!buff.windfury_totem.up
    single
    [b]:0.39
  • if_expr:buff.windfury_totem.remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 73.3 122.7 4.1s 1.5s 3.3s 80.02% 98.33% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 16.6s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.3s
  • uptime_min/max:71.42% / 87.75%

Stack Uptimes

  • ashen_catalyst_1:33.64%
  • ashen_catalyst_2:18.08%
  • ashen_catalyst_3:12.72%
  • ashen_catalyst_4:10.10%
  • ashen_catalyst_5:4.24%
  • ashen_catalyst_6:0.98%
  • ashen_catalyst_7:0.23%
  • ashen_catalyst_8:0.04%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.8s 58.4s 50.1s 80.22% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 340.0s
  • trigger_min/max:15.0s / 310.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.0s
  • uptime_min/max:47.05% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.22%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Crackling Surge 8.0 0.0 37.1s 36.7s 15.0s 39.01% 43.91% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.3s / 282.2s
  • trigger_min/max:11.3s / 282.2s
  • trigger_pct:84.38%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:4.53% / 70.73%

Stack Uptimes

  • crackling_surge_1:31.09%
  • crackling_surge_2:7.90%
  • crackling_surge_3:0.02%
  • crackling_surge_4:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases Nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4s 5.3s 17.8s 12.06% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 165.9s
  • trigger_pct:100.00%
  • duration_min/max:15.1s / 20.0s
  • uptime_min/max:9.84% / 15.04%

Stack Uptimes

  • crumbling_power_1:0.43%
  • crumbling_power_2:0.63%
  • crumbling_power_3:0.65%
  • crumbling_power_4:0.64%
  • crumbling_power_5:0.63%
  • crumbling_power_6:0.62%
  • crumbling_power_7:0.62%
  • crumbling_power_8:0.60%
  • crumbling_power_9:0.59%
  • crumbling_power_10:0.60%
  • crumbling_power_11:0.62%
  • crumbling_power_12:0.64%
  • crumbling_power_13:0.66%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.68%
  • crumbling_power_16:0.69%
  • crumbling_power_17:0.69%
  • crumbling_power_18:0.69%
  • crumbling_power_19:0.70%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Elemental Blast: Critical Strike 8.3 0.0 35.1s 35.1s 9.8s 27.15% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 241.9s
  • trigger_min/max:10.0s / 241.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:4.14% / 51.37%

Stack Uptimes

  • elemental_blast_critical_strike_1:27.15%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 8.2 0.0 35.4s 35.4s 9.8s 26.93% 0.00% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 206.9s
  • trigger_min/max:10.0s / 206.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:6.54% / 49.43%

Stack Uptimes

  • elemental_blast_haste_1:26.93%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 8.3 0.0 35.1s 35.1s 9.8s 27.20% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 260.2s
  • trigger_min/max:10.0s / 260.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:0.00% / 50.89%

Stack Uptimes

  • elemental_blast_mastery_1:27.20%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.0s 303.5s 27.5s 13.44% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 318.0s
  • trigger_min/max:300.0s / 318.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.98% / 18.17%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.44%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 13.8 0.6 22.6s 22.1s 15.2s 70.00% 0.00% 56.7 (56.7) 13.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 49.3s
  • trigger_min/max:13.0s / 34.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.8s
  • uptime_min/max:63.82% / 76.42%

Stack Uptimes

  • feral_spirit_1:70.00%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 44.5 281.9 6.8s 0.9s 5.6s 83.36% 89.81% 281.9 (618.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 58.8s
  • trigger_min/max:0.0s / 18.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.2s
  • uptime_min/max:70.04% / 92.18%

Stack Uptimes

  • flurry_1:21.79%
  • flurry_2:36.65%
  • flurry_3:24.92%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.5s 46.5s 12.9s 19.42% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 207.4s
  • trigger_min/max:0.2s / 207.4s
  • trigger_pct:98.85%
  • duration_min/max:0.0s / 51.0s
  • uptime_min/max:4.17% / 49.37%

Stack Uptimes

  • forgestorm_ignited_1:19.42%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 43.1 10.4 7.0s 5.6s 3.6s 51.95% 99.38% 10.3 (78.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 32.8s
  • trigger_min/max:1.0s / 17.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.7s
  • uptime_min/max:37.36% / 66.09%

Stack Uptimes

  • hailstorm_5:4.21%
  • hailstorm_6:3.87%
  • hailstorm_7:3.57%
  • hailstorm_8:10.54%
  • hailstorm_9:7.69%
  • hailstorm_10:22.07%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.7 5.7 27.4s 17.3s 9.9s 35.41% 86.49% 5.7 (5.7) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 198.5s
  • trigger_min/max:0.0s / 193.0s
  • trigger_pct:5.02%
  • duration_min/max:0.0s / 54.2s
  • uptime_min/max:8.53% / 68.28%

Stack Uptimes

  • hot_hand_1:35.41%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.1 0.0 12.6s 12.5s 3.4s 27.64% 55.47% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.8s / 32.2s
  • trigger_min/max:7.8s / 32.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.5s
  • uptime_min/max:16.06% / 40.65%

Stack Uptimes

  • ice_strike_1:27.64%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 8.0 0.0 37.1s 36.7s 15.0s 38.99% 100.00% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.8s / 255.2s
  • trigger_min/max:10.8s / 255.2s
  • trigger_pct:84.65%
  • duration_min/max:0.0s / 42.8s
  • uptime_min/max:4.65% / 68.85%

Stack Uptimes

  • icy_edge_1:31.17%
  • icy_edge_2:7.80%
  • icy_edge_3:0.02%
  • icy_edge_4:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases Frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 54.3 378.9 5.6s 0.7s 4.6s 83.99% 100.00% 28.3 (41.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 17.8s
  • trigger_min/max:0.0s / 7.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.6s
  • uptime_min/max:78.67% / 88.20%

Stack Uptimes

  • maelstrom_weapon_1:9.71%
  • maelstrom_weapon_2:9.97%
  • maelstrom_weapon_3:10.19%
  • maelstrom_weapon_4:10.15%
  • maelstrom_weapon_5:9.05%
  • maelstrom_weapon_6:8.18%
  • maelstrom_weapon_7:7.21%
  • maelstrom_weapon_8:6.32%
  • maelstrom_weapon_9:4.15%
  • maelstrom_weapon_10:9.05%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 7.9 0.0 37.4s 37.0s 15.0s 38.74% 100.00% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 262.2s
  • trigger_min/max:10.0s / 261.7s
  • trigger_pct:84.45%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:5.83% / 71.29%

Stack Uptimes

  • molten_weapon_1:30.87%
  • molten_weapon_2:7.85%
  • molten_weapon_3:0.02%
  • molten_weapon_4:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases Fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Wave 7.0 0.0 46.2s 46.2s 2.7s 6.32% 24.29% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 58.4s
  • trigger_min/max:45.0s / 58.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:3.13% / 15.59%

Stack Uptimes

  • primordial_wave_1:6.32%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=175}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.1 61.0s 45.8s 16.5s 23.67% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 222.8s
  • trigger_min/max:0.0s / 206.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 76.7s
  • uptime_min/max:4.97% / 60.52%

Stack Uptimes

  • sophic_devotion_1:23.67%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.5 1.9 76.5s 45.5s 32.3s 38.09% 0.00% 25.7 (25.7) 3.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 245.1s
  • trigger_min/max:0.0s / 198.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 175.6s
  • uptime_min/max:7.54% / 88.73%

Stack Uptimes

  • spiraling_winds_1:2.33%
  • spiraling_winds_2:2.30%
  • spiraling_winds_3:2.29%
  • spiraling_winds_4:2.27%
  • spiraling_winds_5:2.26%
  • spiraling_winds_6:2.24%
  • spiraling_winds_7:2.22%
  • spiraling_winds_8:2.21%
  • spiraling_winds_9:2.19%
  • spiraling_winds_10:17.78%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 6.9 0.0 45.8s 45.8s 11.8s 27.28% 31.07% 0.0 (0.0) 6.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:32.7s / 91.5s
  • trigger_min/max:32.7s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:23.39% / 29.86%

Stack Uptimes

  • splintered_elements_1:27.28%

Spelldata

  • id:382043
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc382042=Primordial Wave grants you {$s1=20}% Haste plus {$s2=4}% for each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave for {$382043d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 15.8 5.0 18.3s 13.8s 5.6s 29.41% 43.93% 5.0 (5.0) 1.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 205.8s
  • trigger_min/max:0.0s / 205.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.4s
  • uptime_min/max:5.39% / 57.81%

Stack Uptimes

  • stormbringer_1:29.41%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 26.8 8.0 51.0 10.9s 1.1s 127.2s
Windfury (Off Hand) 27.4 9.0 53.0 10.7s 1.1s 113.7s
Elemental Blast: Critical Strike 8.3 1.0 16.0 35.1s 10.0s 241.9s
Elemental Blast: Haste 8.2 2.0 17.0 35.4s 10.0s 206.9s
Elemental Blast: Mastery 8.3 0.0 17.0 35.1s 10.0s 260.2s
Maelstrom Weapon Swing Reset 6.9 5.0 8.0 45.8s 32.7s 91.5s
Flametongue: Windfury Attack 119.8 64.0 194.0 5.1s 0.0s 60.3s
Stormbringer: Windfury Attack 8.8 0.0 25.0 31.4s 0.0s 269.5s
Flametongue: main_hand 162.1 110.0 214.0 2.2s 1.1s 16.3s
Hot Hand: main_hand 8.1 0.0 21.0 32.8s 1.1s 320.3s
Windfury: main_hand 44.4 19.0 77.0 7.0s 1.1s 81.9s
Flametongue: offhand 165.7 114.0 224.0 2.2s 1.1s 18.0s
Hot Hand: offhand 8.3 0.0 22.0 32.4s 1.1s 316.2s
Flametongue: Lava Lash 73.7 42.0 112.0 4.0s 0.8s 16.5s
Stormbringer: Lava Lash 5.5 0.0 16.0 44.2s 0.8s 323.3s
Flametongue: Ice Strike 24.1 18.0 30.0 12.5s 7.8s 32.2s
Stormbringer: Ice Strike 1.8 0.0 9.0 81.8s 7.9s 329.9s
Windfury: Ice Strike 6.6 0.0 15.0 40.5s 7.8s 320.7s
Flametongue: Stormstrike 32.3 16.0 49.0 9.1s 0.8s 73.5s
Stormbringer: Stormstrike 2.4 0.0 10.0 68.7s 0.8s 331.8s
Windfury: Stormstrike 8.8 0.0 22.0 30.6s 0.8s 261.7s
Flametongue: Stormstrike Off-Hand 32.3 16.0 49.0 9.1s 0.8s 73.5s
Stormbringer: Stormstrike Off-Hand 2.4 0.0 10.0 68.8s 0.8s 323.6s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 42.50% 33.37% 49.71% 0.7s 0.0s 4.7s
Hot Hand 35.41% 8.53% 68.28% 9.9s 0.0s 54.2s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike
Stormstrike		3.8790.00050.619127.68762.440202.634
Primordial Wave1.1350.00013.3517.9600.89326.476
Feral Spirit0.7760.0001.51711.1674.22817.831
Lava Lash0.5720.0008.81042.30721.60966.513
Elemental Blast0.5060.00014.63512.6111.78640.646
Ice Strike1.2010.00019.73529.1738.33165.657
Frost Shock2.4260.00029.384104.93057.294160.677
Flame Shock23.8480.000224.832253.957163.873335.067
Earth Elemental19.1310.000198.27725.1426.147198.277

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack26.52.25.83%5.25%
main_hand35.53.47.82%8.17%
offhand36.53.38.04%7.87%
Primordial Wave50.319.611.06%46.89%
Feral Spirit76.66.416.85%15.36%
Lava Lash84.66.718.63%16.15%
Ice Strike54.00.111.88%0.17%
Frost Shock42.60.09.37%0.00%
Stormstrike32.30.17.10%0.14%
Stormstrike (_mh)7.80.01.71%0.00%
Stormstrike Off-Hand7.70.01.70%0.00%
Overflow Stacks0.041.70.00%8.42%
Actual Stacks454.30.091.58%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt234.352.06%
Elemental Blast215.747.94%
Total Spent450.0100.00%
Casts per Maelstrom Weapon Stack Consumed
Ability 0 1 2 3 4 5 6 7 8 9 10
Lightning Bolt          3.15 3.06 3.08 5.60 3.87 9.89
Elemental Blast          1.12 1.02 0.85 7.16 5.53 9.10
Total           4.27
(8.00%)		 4.08
(7.63%)		 3.93
(7.36%)		 12.77
(23.89%)		 9.40
(17.59%)		 18.99
(35.53%)

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Ele
Mana RegenMana631.52157332.26100.00%249.13609688.7779.49%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 270980.0 0.00 872.33 0.0 9280.5 -393152.2 270980.0
Mana 250000.0 524.44 525.64 609688.9 249639.7 248350.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement_Ele
BloodlustMana 1.001000.000.63%1000.001000.000.00
Flame ShockMana 9.737296.034.63%750.0080.67264.07
Frost ShockMana 42.8321414.9413.58%500.00500.0099.45
Ice StrikeMana 24.1439829.6525.26%1650.001650.0018.07
Lava LashMana 73.7329492.4918.70%400.00400.00128.26
Lightning BoltMana 28.6614329.769.09%500.00500.00126.47
Primordial WaveMana 6.9810474.206.64%1500.001500.00119.70
StormstrikeMana 32.3232321.6920.50%1000.001000.0117.54
Windfury TotemMana 3.051533.800.97%503.70503.700.00

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Ele Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Ele Damage Per Second
Count 7499
Mean 60892.23
Minimum 52024.37
Maximum 71690.31
Spread ( max - min ) 19665.94
Range [ ( max - min ) / 2 * 100% ] 16.15%
Standard Deviation 2473.4993
5th Percentile 57028.83
95th Percentile 65063.92
( 95th Percentile - 5th Percentile ) 8035.09
Mean Distribution
Standard Deviation 28.5634
95.00% Confidence Interval ( 60836.25 - 60948.21 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6339
0.1 Scale Factor Error with Delta=300 52229
0.05 Scale Factor Error with Delta=300 208914
0.01 Scale Factor Error with Delta=300 5222847
Priority Target DPS
PR_Shaman_Enhancement_Ele Priority Target Damage Per Second
Count 7499
Mean 60892.23
Minimum 52024.37
Maximum 71690.31
Spread ( max - min ) 19665.94
Range [ ( max - min ) / 2 * 100% ] 16.15%
Standard Deviation 2473.4993
5th Percentile 57028.83
95th Percentile 65063.92
( 95th Percentile - 5th Percentile ) 8035.09
Mean Distribution
Standard Deviation 28.5634
95.00% Confidence Interval ( 60836.25 - 60948.21 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6339
0.1 Scale Factor Error with Delta=300 52229
0.05 Scale Factor Error with Delta=300 208914
0.01 Scale Factor Error with Delta=300 5222847
DPS(e)
PR_Shaman_Enhancement_Ele Damage Per Second (Effective)
Count 7499
Mean 60892.23
Minimum 52024.37
Maximum 71690.31
Spread ( max - min ) 19665.94
Range [ ( max - min ) / 2 * 100% ] 16.15%
Damage
PR_Shaman_Enhancement_Ele Damage
Count 7499
Mean 17356998.80
Minimum 12805826.04
Maximum 23346994.47
Spread ( max - min ) 10541168.43
Range [ ( max - min ) / 2 * 100% ] 30.37%
DTPS
PR_Shaman_Enhancement_Ele Damage Taken Per Second
Count 7499
Mean 871.59
Minimum 0.00
Maximum 2344.45
Spread ( max - min ) 2344.45
Range [ ( max - min ) / 2 * 100% ] 134.49%
HPS
PR_Shaman_Enhancement_Ele Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Ele Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Ele Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Ele Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Ele Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_EleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Ele Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
0.00 primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
G 14.36 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
0.00 doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
I 0.00 call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
J 0.00 call_action_list,name=funnel,if=active_enemies>1&rotation.funnel
actions.single
# count action,conditions
K 1.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
L 0.28 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
0.00 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
M 48.66 lava_lash,if=buff.hot_hand.up
N 1.66 windfury_totem,if=!buff.windfury_totem.up
O 6.39 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
P 6.93 lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
Q 18.11 elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
R 12.43 lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
S 5.98 primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
0.00 flame_shock,if=!ticking
T 24.14 ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
U 25.07 lava_lash,if=talent.lashing_flames.enabled
0.00 ice_strike,if=!buff.ice_strike.up
V 42.56 frost_shock,if=buff.hailstorm.up
0.00 lava_lash
0.00 ice_strike
0.00 windstrike
W 32.32 stormstrike
0.00 sundering,if=raid_event.adds.in>=action.sundering.cooldown
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
X 9.30 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 0.27 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Z 1.20 earth_elemental
a 9.73 flame_shock
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
b 0.39 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGKOTUVWZaPUMVMTMQMVGMQVWTURMVMQMVMTMRVWGXUVWMQMTMRMSPVWaMGMTMQMVWWQUVTRWMVMWMGMQTVWMQMVMRMSPTGUVQWaVUXTVWQaUVWXaNTGUQVWXaVUTQMVMSMGPUTVQWaUVRWaTURVWWGQUMTMMQMVMWEFRUTVWRSGPUVWOTVUWQVaWUTMRMVGMQVUMQMTMRMVWaXSGPTUVWNQaVUWQTVXUWVaWTGQUVWQaVUTRVWMSMGMPMTMQMVWQUVaTW

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 2 augmentation PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 3 windfury_weapon PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 4 flametongue_weapon PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 6 windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana corrupting_rage
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
0:00.000 default B bloodlust Fluffy_Pillow 250000.0/250000: 100% mana corrupting_rage
0:00.000 default C potion Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, corrupting_rage
0:00.000 default D auto_attack Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(2), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default F berserking PR_Shaman_Enhancement_Ele 249000.0/250000: 100% mana bloodlust, flurry(2), crumbling_power(20), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, berserking, flurry(2), crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:00.894 single K primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, icy_edge, crackling_surge, maelstrom_weapon, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:01.788 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, primordial_wave, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(10), crumbling_power(18), corrupting_rage, elemental_potion_of_ultimate_power
0:02.682 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hailstorm(10), crumbling_power(17), corrupting_rage, elemental_potion_of_ultimate_power
0:03.576 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), hailstorm(10), ice_strike, crumbling_power(16), corrupting_rage, elemental_potion_of_ultimate_power
0:04.470 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(4), hailstorm(10), ice_strike, crumbling_power(15), corrupting_rage, elemental_potion_of_ultimate_power
0:05.364 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(5), crumbling_power(14), corrupting_rage, elemental_potion_of_ultimate_power
0:06.258 single Z earth_elemental Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(7), crumbling_power(13), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:07.152 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(7), crumbling_power(12), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:08.046 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(8), crumbling_power(11), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:08.940 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hailstorm(8), crumbling_power(10), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:09.693 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(8), crumbling_power(9), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:10.446 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(4), hailstorm(8), crumbling_power(8), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:11.199 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), crumbling_power(7), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:11.953 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, hot_hand, maelstrom_weapon(7), crumbling_power(6), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:12.707 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, crumbling_power(5), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:13.526 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, crumbling_power(4), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:14.345 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, hailstorm(10), ice_strike, crumbling_power(3), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:15.163 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, splintered_elements, hot_hand, maelstrom_weapon(3), hailstorm(10), ice_strike, crumbling_power(2), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:15.982 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(4), crumbling_power, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:16.819 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:17.638 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(9), spiraling_winds, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:18.456 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hailstorm(9), spiraling_winds, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:19.252 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), spiraling_winds(2), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:20.048 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), spiraling_winds(2), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:21.002 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(7), ice_strike, spiraling_winds(3), corrupting_rage, elemental_potion_of_ultimate_power
0:21.956 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(3), corrupting_rage, elemental_potion_of_ultimate_power
0:22.909 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(8), ice_strike, spiraling_winds(4), corrupting_rage, elemental_potion_of_ultimate_power
0:23.863 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(8), ice_strike, spiraling_winds(4), corrupting_rage, elemental_potion_of_ultimate_power
0:24.817 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), spiraling_winds(4), corrupting_rage, elemental_potion_of_ultimate_power
0:25.770 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(10), spiraling_winds(5), corrupting_rage, elemental_potion_of_ultimate_power
0:26.743 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, hailstorm(10), spiraling_winds(5), corrupting_rage, elemental_potion_of_ultimate_power
0:27.697 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), spiraling_winds(6), corrupting_rage, elemental_potion_of_ultimate_power
0:28.680 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3), spiraling_winds(6), corrupting_rage, elemental_potion_of_ultimate_power
0:29.662 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), spiraling_winds(7), corrupting_rage, elemental_potion_of_ultimate_power
0:30.645 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(7), corrupting_rage
0:31.628 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst, stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(8), corrupting_rage
0:32.611 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), stormbringer, hailstorm(10), ice_strike, spiraling_winds(8), corrupting_rage
0:33.594 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst(3), stormbringer, maelstrom_weapon(2), spiraling_winds(9), corrupting_rage
0:34.577 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(5), spiraling_winds(9), corrupting_rage
0:35.559 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(6), spiraling_winds(10), corrupting_rage
0:36.542 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), hailstorm(6), spiraling_winds(10)
0:37.525 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon, hailstorm(6), spiraling_winds(10)
0:38.508 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(10)
0:39.489 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(8), spiraling_winds(10)
0:40.472 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(9), spiraling_winds(10)
0:41.747 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(9), spiraling_winds(10)
0:42.986 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(9)
0:44.224 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(9), ice_strike
0:45.463 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(9), ice_strike
0:46.702 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike
0:47.939 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike
0:49.178 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(10), hailstorm(10), ice_strike
0:50.417 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst(3), stormbringer, maelstrom_weapon, hailstorm(10), ice_strike
0:51.450 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst(4), stormbringer, maelstrom_weapon(2), corrupting_rage
0:52.514 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(4), maelstrom_weapon(3), corrupting_rage
0:53.578 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(5), hot_hand, maelstrom_weapon(3), corrupting_rage
0:54.639 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(5), corrupting_rage
0:55.703 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(6), corrupting_rage
0:56.766 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), hot_hand, maelstrom_weapon(7), corrupting_rage
0:57.830 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, corrupting_rage
0:58.894 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, corrupting_rage
0:59.958 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, corrupting_rage
1:01.021 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), maelstrom_weapon(3), hailstorm(10), ice_strike, corrupting_rage
1:02.085 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(4), corrupting_rage
1:03.361 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(7), corrupting_rage
1:04.637 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(10), corrupting_rage
1:05.912 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), hailstorm(10), corrupting_rage
1:07.151 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(3), hailstorm(10), corrupting_rage
1:08.388 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(5), corrupting_rage
1:09.735 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(8), ice_strike, spiraling_winds, corrupting_rage
1:10.974 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(3), hailstorm(8), ice_strike, spiraling_winds(2), corrupting_rage
1:12.213 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(4), hot_hand, maelstrom_weapon, hailstorm(8), ice_strike, spiraling_winds(2), corrupting_rage
1:13.452 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(8), ice_strike, spiraling_winds(3), corrupting_rage
1:14.691 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3), spiraling_winds(4), corrupting_rage
1:15.967 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(4), corrupting_rage
1:17.242 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(6), spiraling_winds(5), corrupting_rage
1:18.518 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(9), spiraling_winds(6), corrupting_rage
1:19.792 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), spiraling_winds(6), corrupting_rage
1:21.067 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, maelstrom_weapon(10), spiraling_winds(7), corrupting_rage
1:22.343 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(2), hailstorm(10), spiraling_winds(7), corrupting_rage
1:23.618 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), hailstorm(10), ice_strike, spiraling_winds(8), corrupting_rage
1:24.893 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(6), spiraling_winds(9), corrupting_rage
1:26.169 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(10), spiraling_winds(9), corrupting_rage
1:27.445 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), spiraling_winds(10), corrupting_rage
1:28.721 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), spiraling_winds(10), corrupting_rage
1:29.959 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), spiraling_winds(10), corrupting_rage
1:31.198 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(10), corrupting_rage
1:32.437 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), spiraling_winds(10), corrupting_rage
1:33.676 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(8), corrupting_rage
1:34.915 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(8), corrupting_rage
1:36.154 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, primordial_wave, ashen_catalyst, stormbringer, maelstrom_weapon(10), hailstorm(8), corrupting_rage
1:37.391 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, ashen_catalyst(2), hailstorm(10), corrupting_rage
1:38.424 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(3), stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, corrupting_rage
1:39.487 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, corrupting_rage
1:40.778 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(6), hailstorm(10), ice_strike, corrupting_rage
1:41.841 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(10)
1:42.904 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, hailstorm(10)
1:43.968 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(10)
1:45.032 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(3), hailstorm(10)
1:46.096 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4)
1:47.233 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(5)
1:48.297 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon, hailstorm(5)
1:49.572 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5), hailstorm(5), ice_strike
1:50.848 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(7)
1:52.124 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(10)
1:53.400 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon, hailstorm(10)
1:54.638 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(5), maelstrom_weapon(2), hailstorm(10)
1:55.877 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst, maelstrom_weapon(3), hailstorm(10)
1:57.116 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, maelstrom_weapon(4), corrupting_rage
1:58.355 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(6), corrupting_rage
1:59.594 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon, hailstorm(6), spiraling_winds, sophic_devotion, corrupting_rage
2:00.833 single N windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(4), stormbringer, maelstrom_weapon(2), hailstorm(6), spiraling_winds(2), sophic_devotion, forgestorm_ignited, corrupting_rage
2:01.660 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(4), stormbringer, maelstrom_weapon(2), hailstorm(6), spiraling_winds(2), sophic_devotion, forgestorm_ignited, corrupting_rage
2:02.899 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst(5), stormbringer, maelstrom_weapon(6), hailstorm(6), ice_strike, spiraling_winds(3), sophic_devotion, forgestorm_ignited, corrupting_rage
2:04.174 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge(2), ashen_catalyst(6), stormbringer, maelstrom_weapon(7), hailstorm(6), ice_strike, spiraling_winds(3), sophic_devotion, forgestorm_ignited, corrupting_rage
2:05.450 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, icy_edge(2), stormbringer, maelstrom_weapon(10), hailstorm(6), ice_strike, spiraling_winds(4), sophic_devotion, forgestorm_ignited, corrupting_rage
2:06.726 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds(5), sophic_devotion, forgestorm_ignited, corrupting_rage
2:08.002 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(3), spiraling_winds(5), sophic_devotion, forgestorm_ignited, corrupting_rage
2:09.278 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(5), spiraling_winds(6), sophic_devotion, forgestorm_ignited, corrupting_rage
2:10.553 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), hailstorm(5), spiraling_winds(7), sophic_devotion, forgestorm_ignited, corrupting_rage
2:11.829 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(4), hailstorm(5), spiraling_winds(7), sophic_devotion, forgestorm_ignited, corrupting_rage
2:13.105 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(4), spiraling_winds(8), sophic_devotion, forgestorm_ignited, corrupting_rage
2:14.381 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(5), spiraling_winds(9), forgestorm_ignited, corrupting_rage
2:15.657 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(10), ice_strike, spiraling_winds(9), forgestorm_ignited, corrupting_rage
2:16.933 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, hailstorm(10), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
2:18.209 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
2:19.485 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, corrupting_rage
2:20.761 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, hot_hand, maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, corrupting_rage
2:22.036 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, primordial_wave, ashen_catalyst, hot_hand, maelstrom_weapon(10), spiraling_winds(10), forgestorm_ignited, corrupting_rage
2:23.312 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, primordial_wave, ashen_catalyst, hot_hand, maelstrom_weapon(10), spiraling_winds(10), forgestorm_ignited, corrupting_rage
2:24.588 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(10), forgestorm_ignited, corrupting_rage
2:25.864 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hailstorm(10), corrupting_rage
2:26.928 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(3), hailstorm(10), corrupting_rage
2:27.992 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), hailstorm(10), ice_strike, corrupting_rage
2:29.056 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(9), corrupting_rage
2:30.119 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon, hailstorm(9), corrupting_rage
2:31.152 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(3), hailstorm(9), corrupting_rage
2:32.183 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(3), hailstorm(9), corrupting_rage
2:33.216 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(6), hailstorm(9), corrupting_rage
2:34.249 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(8), corrupting_rage
2:35.281 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon, hailstorm(8), corrupting_rage
2:36.314 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), hailstorm(8), corrupting_rage
2:37.346 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), hailstorm(8), corrupting_rage
2:38.667 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(7), hailstorm(8), ice_strike, corrupting_rage
2:40.024 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), maelstrom_weapon(8), hailstorm(8), ice_strike, corrupting_rage
2:41.300 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst, maelstrom_weapon, hailstorm(10), ice_strike, sophic_devotion, corrupting_rage
2:42.576 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(2), sophic_devotion, corrupting_rage
2:43.851 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst(3), stormbringer, maelstrom_weapon(4), sophic_devotion, corrupting_rage
2:45.127 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst(3), stormbringer, maelstrom_weapon(8), sophic_devotion, corrupting_rage
2:46.588 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(9), sophic_devotion, corrupting_rage
2:47.863 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(5), stormbringer, maelstrom_weapon(2), hailstorm(9), sophic_devotion, corrupting_rage
2:49.139 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(9), sophic_devotion, corrupting_rage
2:50.415 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(9), sophic_devotion, corrupting_rage
2:51.691 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(9), ice_strike, sophic_devotion, corrupting_rage
2:52.967 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(9), ice_strike, sophic_devotion, corrupting_rage
2:54.243 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(9), ice_strike, sophic_devotion, corrupting_rage
2:55.519 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, corrupting_rage
2:56.795 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), ice_strike, corrupting_rage
2:58.071 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(4), corrupting_rage
2:59.347 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(6), corrupting_rage
3:00.623 default E use_item_irideus_fragment Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(8), corrupting_rage
3:00.623 default F berserking PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(8), crumbling_power(20), corrupting_rage
3:00.623 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(8), crumbling_power(19), corrupting_rage
3:01.784 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon, hailstorm(8), crumbling_power(19), corrupting_rage
3:02.945 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(2), hailstorm(8), crumbling_power(18), corrupting_rage
3:04.106 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana berserking, elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(4), hailstorm(8), ice_strike, crumbling_power(17), corrupting_rage
3:05.267 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), ashen_catalyst(2), maelstrom_weapon(5), crumbling_power(16), spiraling_winds, corrupting_rage
3:06.428 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), ashen_catalyst(3), stormbringer, maelstrom_weapon(9), crumbling_power(15), spiraling_winds(2), corrupting_rage
3:07.588 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), ashen_catalyst(4), stormbringer, hailstorm(9), crumbling_power(14), spiraling_winds(2), corrupting_rage
3:08.748 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), primordial_wave, ashen_catalyst(5), stormbringer, maelstrom_weapon(10), hailstorm(9), crumbling_power(13), spiraling_winds(3), corrupting_rage
3:09.909 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(10), hailstorm(9), crumbling_power(12), spiraling_winds(3), forgestorm_ignited, corrupting_rage
3:11.070 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), stormbringer, maelstrom_weapon, hailstorm(10), crumbling_power(11), spiraling_winds(4), forgestorm_ignited, corrupting_rage
3:12.038 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(4), hailstorm(10), crumbling_power(10), spiraling_winds(4), forgestorm_ignited, corrupting_rage
3:13.006 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), crumbling_power(9), spiraling_winds(5), forgestorm_ignited, corrupting_rage
3:14.070 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(6), crumbling_power(8), spiraling_winds(5), forgestorm_ignited, corrupting_rage
3:15.133 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon, hailstorm(6), crumbling_power(7), spiraling_winds(6), forgestorm_ignited, corrupting_rage
3:16.197 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(3), hailstorm(6), ice_strike, crumbling_power(6), spiraling_winds(7), forgestorm_ignited, corrupting_rage
3:17.285 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(4), crumbling_power(5), spiraling_winds(7), forgestorm_ignited, corrupting_rage
3:18.349 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(7), crumbling_power(4), spiraling_winds(8), forgestorm_ignited, corrupting_rage
3:19.411 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(10), crumbling_power(3), spiraling_winds(8), forgestorm_ignited, corrupting_rage
3:20.474 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hailstorm(10), crumbling_power(2), spiraling_winds(9), forgestorm_ignited, corrupting_rage
3:21.507 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), spiraling_winds(9), corrupting_rage
3:22.539 Waiting     1.088s 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds(10), corrupting_rage
3:23.627 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds(10), corrupting_rage
3:25.088 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(5), stormbringer, maelstrom_weapon(6), spiraling_winds(10), corrupting_rage
3:26.327 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, stormbringer, maelstrom_weapon(7), spiraling_winds(10), corrupting_rage
3:27.566 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10)
3:28.805 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10)
3:30.044 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, hailstorm(10), ice_strike
3:31.320 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike
3:32.596 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3)
3:33.870 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4)
3:35.145 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8)
3:36.421 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon, hailstorm(8), spiraling_winds
3:37.697 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(2), spiraling_winds
3:39.178 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), spiraling_winds(2)
3:40.453 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(8), spiraling_winds(3)
3:41.729 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(8), spiraling_winds(3)
3:43.005 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(8), spiraling_winds(4), corrupting_rage
3:44.281 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(8), ice_strike, spiraling_winds(4), corrupting_rage
3:45.556 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(8), ice_strike, spiraling_winds(5), corrupting_rage
3:46.831 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, hailstorm(10), ice_strike, spiraling_winds(6), corrupting_rage
3:48.107 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds(6), corrupting_rage
3:49.383 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), spiraling_winds(7), corrupting_rage
3:50.659 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(8), corrupting_rage
3:51.935 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(5), spiraling_winds(8), corrupting_rage
3:53.210 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(4), hailstorm(5), spiraling_winds(9), corrupting_rage
3:54.486 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), primordial_wave, ashen_catalyst(5), maelstrom_weapon(10), hailstorm(5), spiraling_winds(10), corrupting_rage
3:55.762 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(10), hailstorm(5), spiraling_winds(10), corrupting_rage
3:57.037 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), hailstorm(10), spiraling_winds(10), corrupting_rage
3:58.101 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), maelstrom_weapon(3), hailstorm(10), ice_strike, spiraling_winds(10), corrupting_rage
3:59.165 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(5), hailstorm(10), ice_strike, spiraling_winds(10), corrupting_rage
4:00.229 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(7), spiraling_winds(10), corrupting_rage
4:01.293 single N windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(9), spiraling_winds(10), corrupting_rage
4:02.046 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(9), spiraling_winds(10), corrupting_rage
4:03.110 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hailstorm(9), spiraling_winds(10), corrupting_rage
4:04.174 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(2), hailstorm(9), spiraling_winds(10), corrupting_rage
4:05.238 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
4:06.301 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(5), spiraling_winds(10), corrupting_rage
4:07.364 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(9), spiraling_winds(10), corrupting_rage
4:08.428 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hailstorm(9), spiraling_winds(10), corrupting_rage
4:09.667 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(3), hailstorm(9), ice_strike, spiraling_winds(10)
4:10.906 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, ashen_catalyst(4), maelstrom_weapon(5), spiraling_winds(10)
4:12.145 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(5), hailstorm(5), spiraling_winds(10)
4:13.384 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, maelstrom_weapon, hailstorm(5), spiraling_winds(10)
4:14.623 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, maelstrom_weapon(3), hailstorm(5), spiraling_winds(10)
4:15.862 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(10)
4:17.101 Waiting     2.364s 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(10)
4:19.465 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(4), spiraling_winds(10)
4:20.904 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon(5), spiraling_winds(10)
4:22.180 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(6), maelstrom_weapon(9), ice_strike, spiraling_winds(10)
4:23.456 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, icy_edge, molten_weapon, ashen_catalyst(6), maelstrom_weapon(10), ice_strike, spiraling_winds(10)
4:24.732 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(7), hailstorm(10), ice_strike, spiraling_winds(10), corrupting_rage
4:25.971 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(4), hailstorm(10), ice_strike, spiraling_winds(10), corrupting_rage
4:27.210 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(6), spiraling_winds(10), corrupting_rage
4:28.449 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(9), spiraling_winds(10), corrupting_rage
4:29.688 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon, hailstorm(9), spiraling_winds(10), corrupting_rage
4:30.927 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon, hailstorm(9), spiraling_winds(10), corrupting_rage
4:32.166 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_weapon(3), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:33.404 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:34.643 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(8), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:35.919 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hailstorm(8), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:37.217 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), stormbringer, maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:38.493 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(3), hot_hand, maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:39.769 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:41.045 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:42.321 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, ashen_catalyst, hot_hand, maelstrom_weapon(10), forgestorm_ignited, corrupting_rage
4:43.596 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), forgestorm_ignited, corrupting_rage
4:44.871 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), corrupting_rage
4:46.147 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10)
4:47.211 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10)
4:48.275 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(10), ice_strike, sophic_devotion
4:49.338 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), hailstorm(10), ice_strike, sophic_devotion
4:50.402 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, hailstorm(10), ice_strike, sophic_devotion
4:51.466 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, sophic_devotion
4:52.530 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), sophic_devotion
4:53.594 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(8), sophic_devotion
4:54.658 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon, hailstorm(8), sophic_devotion
4:55.821 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(2), hailstorm(8), sophic_devotion
4:56.853 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), sophic_devotion
4:57.886 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(4), sophic_devotion
4:59.125 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(6), ice_strike, sophic_devotion

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 250000 250000 0
Spell Power 2280 6148 0
Crit 22.03% 15.82% 1047
Haste 17.84% 17.84% 3032
Versatility 3.93% 0.93% 191
Mana Regen 2560 2560 0
Attack Power 5440 5012 0
Mastery 58.69% 58.69% 3842
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +519 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [16]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement_Ele"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkESSSDlEAAAAAAAAAAAAAKRIJkQKiCJNAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
actions+=/primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
actions+=/call_action_list,name=funnel,if=active_enemies>1&rotation.funnel

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.funnel=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.funnel+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.funnel+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/windstrike,if=(talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1)|buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/stormstrike,if=buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&buff.crackling_thunder.up
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)|(talent.converging_storms.enabled&buff.converging_storms.stack<buff.converging_storms.max_stack)
actions.funnel+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.funnel+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.funnel+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.funnel+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.funnel+=/sundering
actions.funnel+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.funnel+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=3
actions.funnel+=/stormstrike,if=buff.crash_lightning.up&talent.deeply_rooted_elements.enabled
actions.funnel+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.funnel+=/windstrike
actions.funnel+=/stormstrike
actions.funnel+=/ice_strike
actions.funnel+=/lava_lash
actions.funnel+=/crash_lightning
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=2
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5
actions.funnel+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.funnel+=/flame_shock,if=!ticking
actions.funnel+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
actions.single+=/primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
actions.single+=/lava_lash,if=talent.lashing_flames.enabled
actions.single+=/ice_strike,if=!buff.ice_strike.up
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/ice_strike
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=action.sundering.cooldown
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1047
# gear_haste_rating=3032
# gear_mastery_rating=3842
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:
Total Events Processed: 245116561
Max Event Queue: 286
Sim Seconds: 2250297
CPU Seconds: 242.4354
Physical Seconds: 121.6775
Speed Up: 9282

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.95sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 181861 606 7.61 3639 7284 38.0 38.0 31.3% 0.0% 0.0% 0.0% 6.76sec 181861 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost antimagic_shell 48707 52105 174 0.65 16014 0 6.9 3.3 0.0% 0.0% 0.0% 0.0% 41.91sec 52105 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 130.28sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 798781 2663 38.43 3608 7226 192.2 192.2 31.5% 16.3% 0.0% 0.0% 1.82sec 1141145 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 389066 1297 37.56 1804 3611 187.8 187.8 31.5% 16.7% 0.0% 0.0% 1.82sec 555823 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost blood_draw 374606 30218 101 0.40 11494 23042 2.0 2.0 31.3% 0.0% 0.0% 0.0% 179.94sec 30218 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.98sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_damage 155166 3042516 10142 25.28 18321 36559 126.4 126.4 31.5% 0.0% 0.0% 0.0% 2.09sec 3042516 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 220018 733 0.55 60242 120352 3.0 2.8 31.7% 0.0% 0.0% 0.0% 119.95sec 220018 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay ticks -43265 4551 15 0.00 422 846 0.8 0.0 31.3% 0.0% 0.0% 0.0% 74.09sec 4551 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 306489 1022 1.38 33776 67511 6.9 6.9 31.2% 0.0% 0.0% 0.0% 29.37sec 437852 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 82.90sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 382154 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 784677 2616 19.74 6057 12088 59.1 98.7 31.4% 0.0% 0.0% 0.0% 5.05sec 784677 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 222026 811404 2705 9.26 13362 26631 46.3 46.3 31.4% 0.0% 0.0% 0.0% 4.72sec 811404 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 406106 1354 9.26 6680 13316 46.3 46.3 31.5% 0.0% 0.0% 0.0% 4.72sec 406106 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 4.2 0.0 0.0% 0.0% 0.0% 0.0% 72.64sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 2049690 6832 11.83 26366 52708 59.1 59.1 31.5% 0.0% 0.0% 0.0% 5.05sec 2049690 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 405440 1351 11.83 5215 10422 59.1 59.1 31.5% 0.0% 0.0% 0.0% 5.05sec 405440 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 405875 1353 9.00 6841 13792 45.0 45.0 31.3% 0.0% 0.0% 0.0% 6.49sec 579836 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 203879 680 9.00 3420 6933 45.0 45.0 31.5% 0.0% 0.0% 0.0% 6.49sec 291262 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1914190 6381 11.47 0 33372 57.4 57.4 100.0% 0.0% 0.0% 0.0% 5.16sec 1914190 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 957005 3190 11.47 0 16685 57.4 57.4 100.0% 0.0% 0.0% 0.0% 5.16sec 957005 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost overwhelming_rage ticks -374037 261193 871 3.91 13350 0 4.0 19.6 0.0% 0.0% 0.0% 0.0% 59.62sec 323557 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 35.88sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 304.84sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.62sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul auto_attack 0 278055 1713 35.10 2225 4460 95.0 95.0 31.4% 0.0% 0.0% 0.0% 2.90sec 397232 162.35sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 135932 837 19.30 1978 3959 52.2 52.2 31.5% 0.0% 0.0% 0.0% 5.36sec 194193 162.35sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 255 2 1.07 66 133 2.9 2.9 32.1% 0.0% 0.0% 0.0% 121.63sec 364 162.35sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.3 0.0 0.0% 0.0% 0.0% 0.0% 20.33sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1836032 6120 48.55 5758 11503 242.7 242.7 31.4% 0.0% 0.0% 0.0% 1.24sec 1836032 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 61991 207 4.05 2323 4646 20.3 20.3 31.8% 0.0% 0.0% 0.0% 14.44sec 88560 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 62011 207 4.06 2323 4646 20.3 20.3 31.5% 0.0% 0.0% 0.0% 14.32sec 88590 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.2 0.0 0.0% 0.0% 0.0% 0.0% 14.41sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy algethar_puzzle_box_channel 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.56sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy antimagic_shell 48707 49324 164 0.62 15824 0 6.9 3.1 0.0% 0.0% 0.0% 0.0% 45.42sec 49324 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 71652 239 1.36 8768 17519 6.8 6.8 20.4% 0.0% 0.0% 0.0% 46.29sec 71652 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 1248154 9480 117.41 4027 8054 257.6 257.6 20.3% 0.0% 0.0% 0.0% 4.33sec 1783123 131.66sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 297537 2260 85.93 1311 2619 188.6 188.6 20.4% 0.0% 0.0% 0.0% 5.99sec 425063 131.66sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_magus frostbolt 317792 194603 1478 9.00 8188 16375 19.7 19.7 20.4% 0.0% 0.0% 0.0% 14.92sec 194603 131.66sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_magus shadow_bolt 317791 619500 4705 28.43 8250 16517 62.4 62.4 20.3% 0.0% 0.0% 0.0% 4.53sec 619500 131.66sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1148936 18728 329.04 2838 5666 336.4 336.4 20.4% 0.0% 0.0% 0.0% 0.85sec 1641379 61.35sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 219043 3571 201.02 885 1765 205.5 205.5 20.5% 0.0% 0.0% 0.0% 1.48sec 312927 61.35sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_magus frostbolt 317792 81866 1364 8.00 8520 16916 8.0 8.0 20.4% 0.0% 0.0% 0.0% 30.87sec 81866 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_magus shadow_bolt 317791 383796 6397 35.55 8968 17895 35.5 35.5 20.5% 0.0% 0.0% 0.0% 6.32sec 383796 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 811950 2707 29.40 4589 9179 147.0 147.0 20.4% 0.0% 0.0% 0.0% 2.46sec 1159959 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.01sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy blood_draw 374606 28468 95 0.40 11772 23458 2.0 2.0 21.1% 0.0% 0.0% 0.0% 0.00sec 28468 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy clawing_shadows 207311 2362109 7874 14.10 27850 55736 70.5 70.5 20.3% 0.0% 0.0% 0.0% 4.12sec 2362109 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 46.21sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation_damage 344955 62870 210 1.38 7531 15072 0.0 6.9 20.6% 0.0% 0.0% 0.0% 0.00sec 62870 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_and_decay ticks -43265 80918 270 0.00 733 1465 8.4 0.0 20.5% 0.0% 0.0% 0.0% 36.51sec 80918 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 2187949 7293 19.15 18985 37979 95.8 95.8 20.3% 0.0% 0.0% 0.0% 3.09sec 2187949 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 644756 2149 27.25 4732 0 0.0 136.3 0.0% 0.0% 0.0% 0.0% 0.00sec 644756 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 334126 1114 1.63 33987 67958 8.2 8.2 20.3% 0.0% 0.0% 0.0% 28.96sec 477335 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 168.70sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 464242 1547 4.49 17177 34336 22.5 22.5 20.4% 0.0% 0.0% 0.0% 13.32sec 663219 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 751021 2503 19.53 6389 12791 97.7 97.7 20.3% 0.0% 0.0% 0.0% 3.79sec 751021 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound_application 197147 0 0 0.00 0 0 101.4 0.0 0.0% 0.0% 0.0% 0.0% 5.28sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 382154 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 25901 86 2.32 1853 3689 11.6 11.6 20.4% 0.0% 0.0% 0.0% 27.02sec 25901 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak_aoe 196780 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 27.02sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy overwhelming_rage ticks -374037 261021 870 3.92 13309 0 4.0 19.6 0.0% 0.0% 0.0% 0.0% 59.42sec 321586 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.59sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul auto_attack 0 1640812 5469 37.20 7327 14664 186.0 186.0 20.4% 0.0% 0.0% 0.0% 1.61sec 2344076 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 594861 1983 12.52 7891 15798 62.6 62.6 20.4% 0.0% 0.0% 0.0% 4.67sec 594861 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 132021 440 8.00 2743 5482 40.0 40.0 20.4% 0.0% 0.0% 0.0% 7.61sec 188607 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 410 1 0.75 91 183 3.7 3.7 20.1% 0.0% 0.0% 0.0% 90.08sec 585 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 219925 733 3.08 11869 23740 15.4 15.4 20.5% 0.0% 0.0% 0.0% 6.97sec 219925 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 1017635 3392 3.08 54976 109885 15.4 15.4 20.4% 0.0% 0.0% 0.0% 6.97sec 1017635 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.36sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 904562 18091 32.56 27673 55329 27.1 27.1 20.5% 0.0% 0.0% 0.0% 7.85sec 904562 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 117459 392 0.73 26874 53787 3.6 3.6 20.4% 0.0% 0.0% 0.0% 91.83sec 117459 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 20.6 0.0 0.0% 0.0% 0.0% 0.0% 14.16sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 380576 1269 19.90 3176 6350 11.6 99.5 20.4% 0.0% 0.0% 0.0% 27.02sec 380576 300.00sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 595609 1985 4.20 25042 50189 21.0 21.0 13.2% 0.0% 0.0% 0.0% 14.24sec 1318561 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 722951 2410 13.02 9800 19599 21.0 65.1 13.3% 0.0% 0.0% 0.0% 14.24sec 1318561 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 86.1 0.0 0.0% 0.0% 0.0% 0.0% 3.40sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 807008 2690 7.19 19810 39645 36.0 36.0 13.3% 0.0% 0.0% 0.0% 8.41sec 807008 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 2030503 6768 35.85 9993 20026 179.3 179.3 13.3% 0.0% 0.0% 0.0% 1.66sec 2030503 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 17986 60 6.60 545 0 33.0 33.0 0.0% 0.0% 0.0% 0.0% 6.42sec 17986 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 180799 603 0.83 38240 77031 4.1 4.1 13.9% 0.0% 0.0% 0.0% 15.00sec 180799 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage 32409 86446 288 0.82 21195 0 4.1 4.1 0.0% 0.0% 0.0% 0.0% 15.00sec 89176 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowfiend 34433 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 312818 1043 15.98 3916 0 7.0 79.9 0.0% 0.0% 0.0% 0.0% 37.93sec 312818 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 602400 2008 25.56 4159 8335 13.5 127.8 13.3% 0.0% 0.0% 0.0% 21.06sec 602400 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 127.8 0.0 0.0% 0.0% 0.0% 0.0% 2.33sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_shadowfiend melee 0 146768 4193 56.57 3935 7863 33.0 33.0 13.1% 0.0% 0.0% 0.0% 6.42sec 146768 35.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement doom_winds 384352 30155 101 0.75 6658 13390 3.7 3.7 21.1% 0.0% 0.0% 0.0% 90.42sec 43080 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 307.90sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 15.5 0.0 0.0% 0.0% 0.0% 0.0% 20.41sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 107439 358 5.91 3012 6020 29.6 29.6 20.7% 0.0% 0.0% 0.0% 10.04sec 503499 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 396060 1320 36.85 1783 3564 29.6 184.2 20.6% 0.0% 0.0% 0.0% 10.04sec 503499 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 410086 1367 198.35 343 686 991.8 991.8 20.6% 0.0% 0.0% 0.0% 0.68sec 410086 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 371597 1239 5.69 10808 21617 28.5 28.5 20.8% 0.0% 0.0% 0.0% 7.74sec 371597 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 319066 1064 2.86 18557 37047 14.3 14.3 20.4% 0.0% 0.0% 0.0% 19.51sec 319066 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 563064 1877 4.31 21683 43447 21.5 21.5 20.5% 0.0% 0.0% 0.0% 13.80sec 563064 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 528489 1762 4.01 21869 43715 20.0 20.0 20.6% 0.0% 0.0% 0.0% 14.72sec 528489 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 4130696 13769 13.63 50239 100476 68.1 68.1 20.7% 0.0% 0.0% 0.0% 4.36sec 4130696 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 1 536361 1788 38.66 2660 5324 193.3 193.3 20.7% 16.4% 0.0% 0.0% 1.81sec 766249 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 2 268737 896 38.69 1332 2665 193.5 193.5 20.6% 16.3% 0.0% 0.0% 1.80sec 383919 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement overwhelming_rage ticks -374037 262941 876 3.96 13283 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 58.73sec 268214 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 301.83sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 90.8 0.0 0.0% 0.0% 0.0% 0.0% 3.29sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 1578052 5260 24.18 10817 21650 120.9 120.9 20.6% 0.0% 0.0% 0.0% 2.47sec 2254418 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_mh 390287 363530 1212 10.51 6917 0 52.6 52.6 0.0% 0.0% 0.0% 0.0% 5.62sec 363530 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 788618 2629 24.18 5409 10821 120.9 120.9 20.6% 0.0% 0.0% 0.0% 2.47sec 1126626 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_offhand 390287 181588 605 10.51 3455 0 52.6 52.6 0.0% 0.0% 0.0% 0.0% 5.62sec 181588 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 293112 977 1.21 40204 80290 6.0 6.0 21.0% 0.0% 0.0% 0.0% 50.57sec 293112 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement tempest_strikes 428078 1132157 3774 32.49 5778 11563 162.5 162.5 20.6% 0.0% 0.0% 0.0% 1.84sec 1132157 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_totem 8512 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 114.09sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 2064645 6882 75.03 4554 9135 375.2 375.2 20.7% 0.0% 0.0% 0.0% 2.49sec 2949568 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 26474 430 37.92 564 1129 38.9 38.9 20.7% 0.0% 0.0% 0.0% 2.28sec 37821 61.51sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_spirit_wolf melee 0 906954 9283 235.34 1961 3928 383.2 383.2 20.6% 0.0% 0.0% 0.0% 1.56sec 1295682 97.70sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 310.69sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele elemental_blast 117014 3406061 11354 4.95 113373 226907 24.8 24.8 21.3% 0.0% 0.0% 0.0% 12.22sec 3406061 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele feral_spirit 51533 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 22.14sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock 188389 845359 2818 18.09 7676 15380 90.4 90.4 21.7% 0.0% 0.0% 0.0% 3.31sec 1926638 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock ticks -188389 1081279 3604 39.20 4536 9083 90.4 196.0 21.6% 0.0% 0.0% 0.0% 3.31sec 1926638 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_attack 10444 289937 966 122.01 391 782 610.0 610.0 21.6% 0.0% 0.0% 0.0% 0.74sec 289937 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele forgestorm_ignited_damage 381700 378661 1262 5.76 10808 21617 28.8 28.8 21.7% 0.0% 0.0% 0.0% 7.61sec 378661 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele frost_shock 196840 2129775 7099 8.57 40863 81904 42.8 42.8 21.6% 0.0% 0.0% 0.0% 6.95sec 2129775 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele ice_strike 342240 719847 2399 4.83 24513 48902 24.1 24.1 21.8% 0.0% 0.0% 0.0% 12.55sec 719847 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lava_lash 60103 3782831 12609 14.75 42160 84351 73.7 73.7 21.7% 0.0% 0.0% 0.0% 4.04sec 3782831 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt 188196 1812275 6041 5.73 52002 104163 28.7 28.7 21.5% 0.0% 0.0% 0.0% 10.37sec 1812275 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele main_hand 1 542158 1807 38.78 2657 5320 193.9 193.9 21.6% 16.4% 0.0% 0.0% 1.80sec 774531 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele offhand 2 277785 926 39.65 1331 2666 198.2 198.2 21.6% 16.4% 0.0% 0.0% 1.76sec 396846 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele overwhelming_rage ticks -374037 261699 872 3.94 13283 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.36sec 266947 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 303.46sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave 375982 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 46.17sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave_damage 375984 330992 1103 1.40 38951 77976 7.0 7.0 21.7% 0.0% 0.0% 0.0% 46.17sec 330992 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt_pw 188196 922764 3076 1.39 109342 219749 6.9 6.9 21.6% 0.0% 0.0% 0.0% 45.75sec 922764 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike 17364 0 0 0.00 0 0 32.3 0.0 0.0% 0.0% 0.0% 0.0% 9.14sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_mh 32175 378061 1260 6.46 9619 19256 32.3 32.3 21.6% 0.0% 0.0% 0.0% 9.14sec 540101 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_offhand 32176 188969 630 6.46 4809 9629 32.3 32.3 21.5% 0.0% 0.0% 0.0% 9.14sec 269963 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_totem 8512 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 116.83sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_attack 25504 270245 901 23.95 1853 3711 119.8 119.8 21.7% 0.0% 0.0% 0.0% 5.13sec 386075 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_greater_earth_elemental melee 0 31887 501 41.71 592 1185 44.3 44.3 21.6% 0.0% 0.0% 0.0% 2.52sec 45554 63.70sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_fiery_wolf melee 0 286316 7537 189.29 1963 3929 119.8 119.8 21.7% 0.0% 0.0% 0.0% 2.70sec 409033 37.99sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_frost_wolf melee 0 287209 8407 211.37 1962 3927 120.4 120.4 21.6% 0.0% 0.0% 0.0% 2.69sec 410309 34.16sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_lightning_wolf melee 0 288378 8133 204.30 1961 3929 120.7 120.7 21.7% 0.0% 0.0% 0.0% 2.68sec 411980 35.46sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
235658.0 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.6 2.2 22.3s 18.8s 5.5s 23.02% 0.00% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.1s / 177.0s
  • trigger_min/max:0.2s / 177.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s
  • uptime_min/max:5.53% / 45.29%

Stack Uptimes

  • brittle_1:23.02%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.4s 18.9s 5.5s 23.08% 0.00% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 192.0s
  • trigger_min/max:3.0s / 192.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s
  • uptime_min/max:6.18% / 42.17%

Stack Uptimes

  • brittle_1:23.08%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 114.3 152.3s 2.6s 292.2s 98.18% 0.00% 105.2 (105.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.4s / 287.4s
  • trigger_min/max:0.0s / 14.9s
  • trigger_pct:100.00%
  • duration_min/max:24.8s / 354.6s
  • uptime_min/max:96.81% / 98.52%

Stack Uptimes

  • death_rot_1:0.24%
  • death_rot_2:0.33%
  • death_rot_3:0.68%
  • death_rot_4:0.51%
  • death_rot_5:1.06%
  • death_rot_6:0.68%
  • death_rot_7:0.47%
  • death_rot_8:0.55%
  • death_rot_9:0.60%
  • death_rot_10:93.06%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% from you for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 5.0 237.7 64.4s 1.2s 59.2s 99.03% 0.00% 193.4 (193.4) 4.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 345.3s
  • trigger_min/max:0.0s / 15.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 345.2s
  • uptime_min/max:95.60% / 100.00%

Stack Uptimes

  • everfrost_1:1.67%
  • everfrost_2:1.67%
  • everfrost_3:1.66%
  • everfrost_4:1.65%
  • everfrost_5:1.65%
  • everfrost_6:1.64%
  • everfrost_7:1.64%
  • everfrost_8:1.63%
  • everfrost_9:1.62%
  • everfrost_10:84.20%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 23.1 33.8 13.0s 5.3s 10.6s 81.24% 0.00% 1.9 (2.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 105.3s
  • trigger_min/max:0.0s / 37.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 104.0s
  • uptime_min/max:63.12% / 92.08%

Stack Uptimes

  • festering_wound_1:23.39%
  • festering_wound_2:25.91%
  • festering_wound_3:17.90%
  • festering_wound_4:7.72%
  • festering_wound_5:3.56%
  • festering_wound_6:2.76%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 72.7 3.6s 4.0s 296.7s 98.89% 99.05% 72.7 (72.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.6s / 3.6s
  • trigger_min/max:0.8s / 16.5s
  • trigger_pct:100.00%
  • duration_min/max:236.5s / 358.0s
  • uptime_min/max:98.18% / 99.50%

Stack Uptimes

  • lashing_flames_1:98.89%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.1 58.1 190.3s 5.0s 273.6s 99.08% 0.00% 53.7 (53.7) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 351.3s
  • trigger_min/max:0.9s / 54.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 357.9s
  • uptime_min/max:87.78% / 99.43%

Stack Uptimes

  • razorice_1:1.14%
  • razorice_2:0.91%
  • razorice_3:0.82%
  • razorice_4:0.95%
  • razorice_5:95.26%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Rotten Touch 11.8 7.7 25.3s 15.0s 13.6s 53.48% 0.00% 7.7 (7.7) 11.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rotten_touch
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 102.9s
  • trigger_min/max:0.8s / 60.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 101.1s
  • uptime_min/max:29.98% / 79.39%

Stack Uptimes

  • rotten_touch_1:53.48%

Spelldata

  • id:390276
  • name:Rotten Touch
  • tooltip:Scourge Strike damage taken from {$@=}auracaster is increased by {$s1=50}%.
  • description:{$@spelldesc390275=Sudden Doom causes your next Death Coil to also increase your {$?s207311=true}[Clawing Shadows][Scourge Strike] damage against the target by {$390276s1=50}% for {$390276d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 236966.77
Minimum 219574.29
Maximum 255856.78
Spread ( max - min ) 36282.49
Range [ ( max - min ) / 2 * 100% ] 7.66%
Standard Deviation 5324.8489
5th Percentile 228498.81
95th Percentile 246051.42
( 95th Percentile - 5th Percentile ) 17552.60
Mean Distribution
Standard Deviation 61.4902
95.00% Confidence Interval ( 236846.25 - 237087.29 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1940
0.1 Scale Factor Error with Delta=300 242047
0.05 Scale Factor Error with Delta=300 968185
0.01 Scale Factor Error with Delta=300 24204619
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3733
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 86800862 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.