SimulationCraft 1027-01

for World of Warcraft 10.2.7.54988 Live (hotfix 2024-06-04/54988, git build ca93e4dc8d)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 51051 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
51050.7 51050.7 57.9 / 0.114% 10048.6 / 19.7% 4066.1
APS APS Error APS Range APR
173.0 3.9 / 2.227% 444.0 / 256.6% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.2 12.5 Runic Power 3.53% 53.4 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 51051
Abomination Limb 0 (612) 0.0% (1.2%) 3.0 120.96s 61136 49525

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 1.2345 0.0000 0.00 0.00 0.00% 49525.13 49525.13

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [f]:0.13
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
    cooldowns
    [g]:2.85
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
    Abomination Limb (_damage) 612 1.2% 38.0 6.76s 4785 0 Direct 38.0 3636 7290 4785 31.4% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.04 38.04 0.00 0.00 0.00 0.0000 0.0000 182004.86 182004.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.55% 26.08 11 36 3636.25 2343 7165 3638.31 2936 4516 94816 94816 0.00%
crit 31.45% 11.96 2 23 7289.71 4685 14161 7294.48 5176 10207 87189 87189 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
auto_attack_mh 2666 5.2% 192.2 1.82s 4158 2298 Direct 192.2 3609 7226 4158 31.5% 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 192.19 192.19 0.00 0.00 0.00 1.8095 0.0000 799066.88 1141553.22 30.00% 2297.73 2297.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.21% 100.34 65 149 3609.41 2407 7436 3609.79 3279 3940 362159 517383 30.00%
crit 31.46% 60.46 33 95 7226.38 4813 14707 7225.42 6513 8173 436908 624170 30.00%
miss 16.33% 31.39 14 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1298 2.5% 187.8 1.82s 2071 1145 Direct 187.8 1804 3613 2071 31.4% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 187.84 187.84 0.00 0.00 0.00 1.8093 0.0000 388982.12 555702.91 30.00% 1144.55 1144.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.86% 97.42 56 140 1803.70 1203 3677 1803.96 1649 1967 175707 251017 30.00%
crit 31.42% 59.02 30 91 3613.32 2407 7354 3612.61 3206 4055 213275 304686 30.00%
miss 16.72% 31.40 11 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 102 0.2% 2.0 0.00s 15081 0 Direct 2.0 11494 23028 15080 31.1% 0.0%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 30161.60 30161.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.90% 1.38 0 2 11493.56 10393 18399 10363.02 0 18399 15839 15839 0.00%
crit 31.10% 0.62 0 2 23028.35 20786 38999 12088.77 0 38909 14323 14323 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Breath of Sindragosa 0 (10194) 0.0% (19.9%) 2.9 121.00s 1036410 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [j]:2.94
  • if_expr:!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
    Breath of Sindragosa (_damage) 10194 19.9% 126.4 2.09s 24086 0 Direct 126.4 18329 36576 24085 31.5% 0.0%

Stats Details: Breath Of Sindragosa Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 126.36 126.36 0.00 0.00 0.00 0.0000 0.0000 3043445.09 3043445.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.45% 86.50 37 139 18329.24 9602 41486 18363.86 16292 21272 1585399 1585399 0.00%
crit 31.55% 39.86 14 73 36575.75 19204 82972 36637.78 31576 43911 1458046 1458046 0.00%

Action Details: Breath Of Sindragosa Damage

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Burnout Wave 735 1.4% 3.0 119.97s 74659 0 Direct 2.8 60267 120576 79442 31.8% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 2.78 0.00 0.00 0.00 0.0000 0.0000 220464.02 220464.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.21% 1.89 0 3 60266.58 22015 69346 57513.92 0 69346 114088 114088 0.00%
crit 31.79% 0.88 0 3 120576.34 44029 138692 78564.37 0 138692 106376 106376 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 15 0.0% 0.7 77.19s 5998 4644 Periodic 8.1 422 842 554 31.4% 0.0% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.75 0.00 0.00 8.07 0.00 1.2919 0.0000 4471.80 4471.80 0.00% 4643.62 4643.62
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.60% 5.54 0 45 421.88 312 727 221.37 0 619 2337 2337 0.00%
crit 31.40% 2.54 0 21 842.00 624 1418 437.73 0 1203 2135 2135 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    breath
    [X]:0.75
  • if_expr:(set_bonus.tier31_4pc&variable.st_planning&talent.unholy_ground&!death_and_decay.ticking&runic_power.deficit>=10)|runic_power<36&rune.time_to_2>runic_power%18

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Dragon Games Equipment 1021 2.0% 6.9 47.24s 44341 0 Direct 6.9 33773 67524 44369 31.4% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.91 6.90 0.00 0.00 0.00 0.0000 0.0000 306266.55 437534.80 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.60% 4.74 0 9 33773.40 33171 34829 33733.27 0 34829 159918 228460 29.95%
crit 31.40% 2.17 0 8 67523.96 66341 69658 61202.87 0 69658 146348 209074 27.18%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 2615 5.1% 59.1 5.04s 13270 0 Periodic 98.7 6060 12092 7951 31.3% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.13 0.00 98.69 98.69 58.11 0.0000 2.9997 784630.60 784630.60 0.00% 2650.53 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.65% 67.75 42 96 6059.74 7 15137 6059.63 5495 6600 410570 410570 0.00%
crit 31.35% 30.93 13 53 12092.33 42 30275 12090.10 10433 14403 374060 374060 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.33
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountFrost Death Knight1370065PCT0.280
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Frost Strike 2694 (4040) 5.3% (8.0%) 46.3 4.73s 26306 19712 Direct 46.3 (92.6) 13367 26657 17538 31.4% (31.4%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.31 46.31 0.00 0.00 0.00 1.3345 0.0000 812208.74 812208.74 0.00% 19711.78 19711.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.62% 31.78 12 60 13367.35 8140 26065 13346.04 11807 14888 424805 424805 0.00%
crit 31.38% 14.53 0 32 26657.06 16280 50697 26601.31 0 32340 387404 387404 0.00%

Action Details: Frost Strike

  • id:222026
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}

Action Priority List

    high_prio_actions
    [m]:4.90
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [o]:21.83
  • if_expr:buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
    single_target
    [r]:3.26
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [v]:16.32
  • if_expr:!variable.pooling_runic_power

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountImproved Frost Strike3168031PCT0.200
    Frost Strike Off-Hand 1346 2.7% 46.3 4.73s 8768 0 Direct 46.3 6685 13318 8768 31.4% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.31 46.31 0.00 0.00 0.00 0.0000 0.0000 406058.34 406058.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.59% 31.76 11 61 6684.71 4070 12920 6674.38 5896 7492 212335 212335 0.00%
crit 31.41% 14.55 2 34 13318.22 8140 25433 13289.38 10984 15735 193723 193723 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Frost Strike3168031PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Howling Blast 6848 (8203) 13.4% (16.0%) 59.1 5.04s 41500 34516 Direct 59.1 (118.2) 26382 52704 34647 31.4% (31.4%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.13 59.13 0.00 0.00 0.00 1.2024 0.0000 2048558.74 2048558.74 0.00% 34515.71 34515.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.60% 40.56 20 63 26381.80 3084 62654 26385.76 23067 29823 1070069 1070069 0.00%
crit 31.40% 18.57 5 36 52703.83 5349 125307 52711.96 42243 65741 978490 978490 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [T]:36.37
  • if_expr:variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
    breath
    [Y]:0.28
  • if_expr:runic_power<36&rune.time_to_2>runic_power%18
    breath
    [a]:0.30
  • if_expr:buff.rime.react
    single_target
    [q]:22.17
  • if_expr:buff.rime.react&talent.icebreaker.rank=2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Rime5905223.000Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Percent Cost Rime590521-1.000Spell Data
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
    Avalanche 1355 2.7% 59.1 5.04s 6854 0 Direct 59.1 5218 10422 6854 31.4% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.12 59.12 0.00 0.00 0.00 0.0000 0.0000 405197.82 405197.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.57% 40.54 21 61 5218.36 2752 12417 5219.80 4587 6034 211560 211560 0.00%
crit 31.43% 18.58 4 35 10421.73 5684 24835 10421.58 8333 13367 193638 193638 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Obliterate 1355 (11628) 2.7% (22.8%) 45.0 6.50s 77472 27970 Direct 45.0 (204.8) 6845 13776 9017 31.3% (69.9%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.98 44.98 0.00 0.00 0.00 2.7699 0.0000 405595.75 579437.27 30.00% 27969.80 27969.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.66% 30.88 9 53 6845.38 4263 13967 6854.15 5663 8135 211414 302028 30.00%
crit 31.34% 14.10 2 29 13775.60 8953 42999 13779.38 10817 18146 194182 277410 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]

Action Priority List

    breath
    [V]:22.62
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [W]:30.01
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Z]:5.93
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [p]:29.51
  • if_expr:buff.killing_machine.react
    single_target
    [s]:14.35
  • if_expr:!variable.pooling_runes&buff.remorseless_winter.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
    Obliterate Off-Hand 680 1.3% 45.0 6.50s 4523 0 Direct 45.0 3422 6928 4523 31.4% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.98 44.98 0.00 0.00 0.00 0.0000 0.0000 203423.98 290613.09 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.59% 30.85 12 51 3421.56 2132 6983 3425.98 2977 4064 105563 150808 30.00%
crit 31.41% 14.13 1 29 6927.73 4476 21701 6929.44 5307 9468 97861 139805 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
    Obliterate (_km) 6396 12.5% 57.4 5.15s 33383 0 Direct 57.4 8851 33383 33383 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.43 57.43 0.00 0.00 0.00 0.0000 0.0000 1917181.29 1917181.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 0.00% 0.00 0 1 8850.71 8851 8851 1.18 0 8851 1 1 0.00%
crit 100.00% 57.43 34 88 33383.11 18677 81607 33358.35 29508 37767 1917180 1917180 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
    Obliterate Off-Hand (_km) 3198 6.3% 57.4 5.15s 16690 0 Direct 57.4 4425 16690 16690 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.43 57.43 0.00 0.00 0.00 0.0000 0.0000 958500.63 958500.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 0.00% 0.00 0 1 4425.36 4425 4425 0.59 0 4425 1 1 0.00%
crit 100.00% 57.43 34 88 16690.41 9339 40804 16678.04 14754 18884 958500 958500 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Raise Dead 0 (1382) 0.0% (2.7%) 3.0 121.62s 140091 0

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [k]:2.96
    auto_attack 1716  / 927 1.8% 95.0 2.90s 2928 1902 Direct 95.0 2227 4459 2928 31.4% 0.0%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.97 94.97 0.00 0.00 0.00 1.5395 0.0000 278079.77 397266.94 30.00% 1902.05 1902.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.58% 65.13 36 88 2226.59 1426 4449 2229.48 1988 2543 145011 207164 30.00%
crit 31.42% 29.84 10 52 4459.18 2852 8899 4464.29 3785 5381 133069 190103 30.00%

Action Details: Auto Attack

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:2.92
    Claw 839  / 453 0.9% 52.2 5.37s 2602 2602 Direct 52.2 1977 3964 2602 31.4% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.22 52.22 0.00 0.00 0.00 1.0000 0.0000 135868.39 194102.65 30.00% 2601.80 2601.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.55% 35.80 17 50 1977.04 1243 4004 1979.07 1749 2274 70774 101108 30.00%
crit 31.45% 16.42 4 31 3963.57 2486 8009 3968.38 3122 4890 65094 92994 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.22
  • if_expr:energy>70
    Gnaw 2  / 1 0.0% 2.9 121.63s 87 88 Direct 2.9 66 133 87 31.7% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.90 2.90 0.00 0.00 0.00 1.0000 0.0000 253.94 362.78 30.00% 87.50 87.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.35% 1.98 0 3 66.35 45 109 63.86 0 107 132 188 28.81%
crit 31.65% 0.92 0 3 133.16 91 218 89.59 0 218 122 175 20.16%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.90
Remorseless Winter 0 (6128) 0.0% (12.0%) 15.3 20.33s 120220 95624

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.27 0.00 0.00 0.00 0.00 1.2573 0.0000 0.00 0.00 0.00% 95624.30 95624.30

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    high_prio_actions
    [n]:15.27
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 6128 12.0% 242.7 1.24s 7563 0 Direct 242.7 5761 11498 7563 31.4% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 242.75 242.75 0.00 0.00 0.00 0.0000 0.0000 1835795.37 1835795.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.60% 166.53 113 222 5761.16 1254 17532 5763.00 5001 6570 959382 959382 0.00%
crit 31.40% 76.22 42 121 11498.11 2508 35065 11501.71 9328 13736 876413 876413 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Periodic AmountBiting Cold3770562PCT0.350
Spell Direct AmountBiting Cold3770563PCT0.350

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Gathering Storm21180510.100Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Everfrost37697410.060
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Strike Twice 206 0.4% 20.3 14.35s 3050 0 Direct 20.3 2323 4645 3050 31.3% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.28 20.28 0.00 0.00 0.00 0.0000 0.0000 61840.50 88345.82 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.70% 13.93 3 29 2323.01 2296 2411 2322.96 2296 2373 32361 46232 30.00%
crit 31.30% 6.35 0 16 4645.47 4593 4822 4636.69 0 4822 29479 42114 29.95%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 207 0.4% 20.3 14.36s 3050 0 Direct 20.3 2323 4646 3050 31.3% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.29 20.29 0.00 0.00 0.00 0.0000 0.0000 61906.62 88440.29 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.68% 13.94 4 28 2322.88 2296 2411 2322.84 2296 2365 32375 46252 30.00%
crit 31.32% 6.36 0 17 4645.90 4593 4822 4641.55 0 4822 29531 42189 29.97%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Frost 173
Anti-Magic Shell 174 100.3% 6.9 41.94s 7537 0 Direct 3.3 16014 0 16014 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.91 3.25 0.00 0.00 0.00 0.0000 0.0000 52076.82 52076.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.25 0 17 16013.62 16014 16014 13867.51 0 16014 52077 52077 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [l]:6.91
  • if_expr:runic_power.deficit>40&death_knight.first_ams_cast<time

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownAnti-Magic Barrier2057271ADD-20000.000
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Arcane Torrent 2.3 130.31s

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.31 0.00 0.00 0.00 0.00 1.2841 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [b]:0.80
  • if_expr:runic_power<60
    single_target
    [u]:1.52
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 4.0 82.87s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [d]:0.29
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
    cooldowns
    [e]:3.66
  • if_expr:buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929621SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929631SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382154
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 4.2 72.98s

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.17 0.00 0.00 0.00 0.00 1.1895 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [U]:2.95
  • if_expr:rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
    single_target
    [t]:1.23
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Pillar of Frost 8.7 35.87s

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.70 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [h]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [i]:8.39
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Elemental Potion of Ultimate Power 1.5 305.12s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [c]:1.45
  • if_expr:(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
Unholy Strength 20.2 14.35s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.23 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 121.0s 121.0s 11.8s 11.80% 0.00% 32.2 (32.2) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 123.8s
  • trigger_min/max:120.0s / 123.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:9.76% / 14.22%

Stack Uptimes

  • abomination_limb_1:11.80%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Anti-Magic Shell 6.9 0.0 41.9s 41.9s 6.9s 15.92% 19.00% 0.0 (0.0) 6.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.40
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 90.6s
  • trigger_min/max:40.0s / 90.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:10.94% / 18.09%

Stack Uptimes

  • antimagic_shell_1:15.92%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 10.5 37.3 29.3s 6.2s 18.9s 66.25% 0.00% 0.0 (0.0) 3.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 72.4s
  • trigger_min/max:0.9s / 48.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.4s
  • uptime_min/max:50.73% / 84.39%

Stack Uptimes

  • bonegrinder_crit_1:17.25%
  • bonegrinder_crit_2:14.89%
  • bonegrinder_crit_3:12.85%
  • bonegrinder_crit_4:11.26%
  • bonegrinder_crit_5:10.01%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 6.0 0.0 48.1s 48.1s 9.8s 19.80% 16.57% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:17.5s / 262.6s
  • trigger_min/max:17.5s / 262.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:4.06% / 31.48%

Stack Uptimes

  • bonegrinder_frost_1:19.80%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 3.0 14.6 120.8s 15.1s 19.4s 19.22% 0.00% 2.0 (2.0) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 128.6s
  • trigger_min/max:0.0s / 117.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:16.06% / 22.67%

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.88%
  • bound_by_fire_and_blaze_2:4.34%
  • bound_by_fire_and_blaze_3:4.20%
  • bound_by_fire_and_blaze_4:3.66%
  • bound_by_fire_and_blaze_5:2.76%
  • bound_by_fire_and_blaze_6:3.38%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 121.0s 121.0s 43.0s 42.26% 0.00% 126.1 (126.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 127.5s
  • trigger_min/max:120.0s / 127.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 110.0s
  • uptime_min/max:20.95% / 62.47%

Stack Uptimes

  • breath_of_sindragosa_1:42.26%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.1s 58.8s 50.2s 80.21% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 341.0s
  • trigger_min/max:15.0s / 308.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.0s
  • uptime_min/max:48.73% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.21%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dragon Games Equipment 2.8 0.0 120.9s 120.9s 0.8s 0.70% 0.00% 6.9 (6.9) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.65
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 128.5s
  • trigger_min/max:120.0s / 128.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.9s
  • uptime_min/max:0.48% / 0.99%

Stack Uptimes

  • dragon_games_equipment_1:0.70%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 305.0s 305.0s 27.0s 12.87% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.4s
  • trigger_min/max:300.0s / 328.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.75% / 17.93%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.87%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 83.2s 82.8s 19.6s 25.86% 0.00% 11.6 (11.6) 3.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 288.1s
  • trigger_min/max:0.0s / 288.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.3s
  • uptime_min/max:17.13% / 30.15%

Stack Uptimes

  • empower_rune_weapon_1:25.86%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 8.4 0.0 35.9s 35.9s 12.6s 35.23% 0.00% 0.0 (0.0) 8.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.0s / 53.1s
  • trigger_min/max:26.0s / 53.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s
  • uptime_min/max:25.75% / 44.40%

Stack Uptimes

  • enduring_strength_1:35.23%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 8.6 20.7 36.2s 9.9s 9.9s 28.38% 98.76% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.4s / 108.9s
  • trigger_min/max:0.9s / 98.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:17.97% / 36.41%

Stack Uptimes

  • enduring_strength_builder_1:10.42%
  • enduring_strength_builder_2:8.69%
  • enduring_strength_builder_3:5.29%
  • enduring_strength_builder_4:2.51%
  • enduring_strength_builder_5:1.03%
  • enduring_strength_builder_6:0.35%
  • enduring_strength_builder_7:0.09%
  • enduring_strength_builder_8:0.01%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storm 12.9 124.7 24.1s 2.2s 15.8s 68.06% 86.89% 68.8 (109.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.3s / 103.9s
  • trigger_min/max:0.9s / 29.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 94.1s
  • uptime_min/max:56.21% / 79.01%

Stack Uptimes

  • gathering_storm_1:1.82%
  • gathering_storm_2:5.57%
  • gathering_storm_3:4.53%
  • gathering_storm_4:3.89%
  • gathering_storm_5:5.54%
  • gathering_storm_6:3.77%
  • gathering_storm_7:4.28%
  • gathering_storm_8:3.59%
  • gathering_storm_9:2.75%
  • gathering_storm_10:32.33%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 1.0 171.3 181.1s 1.7s 284.2s 97.94% 0.00% 169.3 (169.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.5s / 303.8s
  • trigger_min/max:1.0s / 15.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 354.8s
  • uptime_min/max:95.54% / 98.58%

Stack Uptimes

  • icy_talons_1:0.36%
  • icy_talons_2:0.35%
  • icy_talons_3:97.23%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 46.2 13.2 6.4s 5.0s 2.2s 33.84% 56.18% 1.6 (1.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 50.6s
  • trigger_min/max:0.0s / 41.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.9s
  • uptime_min/max:19.11% / 53.90%

Stack Uptimes

  • killing_machine_1:28.94%
  • killing_machine_2:4.90%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 8.7 0.0 35.9s 35.9s 11.8s 34.19% 36.34% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.0s / 53.1s
  • trigger_min/max:26.0s / 53.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:30.17% / 39.12%

Stack Uptimes

  • pillar_of_frost_1:34.19%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 8.7 55.7 36.0s 4.5s 11.3s 32.72% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.0s / 53.1s
  • trigger_min/max:0.9s / 45.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:25.36% / 37.74%

Stack Uptimes

  • pillar_of_frost_bonus_1:2.19%
  • pillar_of_frost_bonus_2:3.26%
  • pillar_of_frost_bonus_3:3.78%
  • pillar_of_frost_bonus_4:2.85%
  • pillar_of_frost_bonus_5:3.44%
  • pillar_of_frost_bonus_6:3.19%
  • pillar_of_frost_bonus_7:2.63%
  • pillar_of_frost_bonus_8:2.45%
  • pillar_of_frost_bonus_9:1.79%
  • pillar_of_frost_bonus_10:1.33%
  • pillar_of_frost_bonus_11:1.14%
  • pillar_of_frost_bonus_12:0.97%
  • pillar_of_frost_bonus_13:0.89%
  • pillar_of_frost_bonus_14:0.80%
  • pillar_of_frost_bonus_15:0.62%
  • pillar_of_frost_bonus_16:0.44%
  • pillar_of_frost_bonus_17:0.30%
  • pillar_of_frost_bonus_18:0.21%
  • pillar_of_frost_bonus_19:0.19%
  • pillar_of_frost_bonus_20:0.13%
  • pillar_of_frost_bonus_21:0.07%
  • pillar_of_frost_bonus_22:0.02%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 13.0 2.3 24.1s 20.3s 17.5s 75.94% 0.00% 222.9 (222.9) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 103.3s
  • trigger_min/max:20.0s / 26.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 96.2s
  • uptime_min/max:67.46% / 85.00%

Stack Uptimes

  • remorseless_winter_1:75.94%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 59.5 10.7 5.0s 4.3s 1.9s 37.21% 99.99% 10.7 (10.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.4s
  • trigger_min/max:0.0s / 58.4s
  • trigger_pct:63.24%
  • duration_min/max:0.0s / 30.8s
  • uptime_min/max:21.96% / 52.17%

Stack Uptimes

  • rime_1:37.21%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.3 13.4 22.6s 11.0s 11.6s 51.29% 0.00% 13.4 (13.4) 12.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 146.9s
  • trigger_min/max:0.9s / 140.2s
  • trigger_pct:15.03%
  • duration_min/max:0.0s / 74.0s
  • uptime_min/max:23.02% / 78.60%

Stack Uptimes

  • rune_mastery_1:51.29%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.5 23.2s 14.3s 10.1s 43.25% 42.01% 7.5 (7.5) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 83.8s
  • trigger_min/max:0.0s / 66.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.9s
  • uptime_min/max:23.01% / 71.09%

Stack Uptimes

  • rune_of_hysteria_1:43.25%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Ground 0.7 0.1 126.6s 77.0s 10.1s 2.22% 0.00% 0.1 (0.1) 0.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 246.9s
  • trigger_min/max:1.2s / 245.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 227.8s
  • uptime_min/max:0.00% / 75.92%

Stack Uptimes

  • unholy_ground_1:2.22%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 11.8 35.9s 14.4s 23.5s 66.20% 0.00% 11.8 (11.8) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 156.4s
  • trigger_min/max:0.0s / 60.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 176.5s
  • uptime_min/max:41.82% / 91.13%

Stack Uptimes

  • unholy_strength_1:66.20%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 1.0 171.3 181.1s 1.7s 284.2s 97.94% 0.00% 169.3 (169.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.5s / 303.8s
  • trigger_min/max:1.0s / 15.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 354.8s
  • uptime_min/max:95.54% / 98.58%

Stack Uptimes

  • unleashed_frenzy_1:0.36%
  • unleashed_frenzy_2:0.35%
  • unleashed_frenzy_3:97.23%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=10 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (sizzling_seafood_medley)

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_sizzling_seafood_medley
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382154
  • name:Well Fed
  • tooltip:Haste and mastery increased by {$=}w1.
  • description:Increases Haste and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 26.8 8.0 51.0 10.9s 1.3s 136.4s
Windfury (Off Hand) 22.5 7.0 40.0 12.9s 1.3s 145.9s
Killing Machine spent on Obliterate 57.4 34.0 88.0 5.2s 0.9s 42.6s
Killing Machine: Critical auto attacks 57.8 34.0 88.0 5.5s 1.2s 41.1s
Killing Machine wasted: Critical auto attacks 1.6 0.0 10.0 66.7s 1.3s 336.6s
Rune ready 217.4 156.0 275.0 1.5s 0.0s 18.5s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 1.75% 0.00% 8.15% 0.6s 0.0s 7.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Horn of Winter25.9600.000226.218123.88560.040267.664
Remorseless Winter0.3030.0006.7494.6340.45513.556
Death and Decay111.8680.000331.642278.896131.408359.952
Empower Rune Weapon1.3620.00083.1295.3814.11887.251
Abomination Limb0.9820.0003.7912.9271.0297.727
Pillar of Frost1.3670.00010.53111.9145.48927.383
Breath of Sindragosa2.3890.0007.5037.0354.12213.709
Raise Dead1.7700.0004.1245.2412.3689.067
Anti-Magic Shell6.0930.00054.20342.44520.599100.247

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=502032)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0851.858 / 1.3395.82626.740
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
29.50771.581124.337 / 121.786185.096267.316

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Anti-Magic ShellRunic Power3.2515.970.43%4.910.301.82%
Breath of SindragosaRune11.1610.754.94%0.960.413.66%
Empower Rune WeaponRunic Power19.1889.962.41%4.695.936.19%
Empower Rune WeaponRune19.1818.958.72%0.990.221.17%
Frost FeverRunic Power32.70157.954.23%4.835.573.41%
Horn of WinterRunic Power4.17104.372.79%25.000.000.00%
Horn of WinterRune8.358.353.84%1.000.000.00%
Murderous EfficiencyRune28.7028.7013.20%1.000.000.00%
Rage of the Frozen ChampionRunic Power59.12468.0012.52%7.924.981.05%
Rune RegenerationRune78.8678.8636.27%1.000.000.00%
Rune of HysteriaRunic Power154.92321.128.59%2.0721.166.18%
Runic AttenuationRunic Power71.42349.309.35%4.897.802.18%
Runic EmpowermentRune73.0871.8033.03%0.981.281.75%
Arcane TorrentRunic Power2.3146.281.24%20.000.000.00%
Death and DecayRunic Power0.757.450.20%10.000.000.00%
Howling BlastRunic Power59.130.050.00%0.000.000.00%
ObliterateRunic Power102.412027.1854.25%19.7921.101.03%
Remorseless WinterRunic Power15.27149.434.00%9.793.282.15%
pet - ghoul
Energy RegenEnergy1095.811920.63100.00%1.75166.697.99%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_damage)Runic Power 126.062269.1462.02%18.0017.961341.23
Death and DecayRune 0.750.750.34%1.001.005999.46
Frost StrikeRunic Power 46.311389.3737.98%30.0030.00876.85
Howling BlastRune 59.130.000.00%0.000.00497449405.77
ObliterateRune 102.41204.8392.75%2.004.5517012.81
Remorseless WinterRune 15.2715.276.91%1.001.00120220.54
pet - ghoul
ClawEnergy 52.222088.89100.00%40.0040.0065.04
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 330760.0 758.28 877.81 254399.4 294900.4 -604.7 330760.0
Runic Power 0.0 12.46 12.20 70.1 78.6 0.0 124.0
Rune 6.0 0.72 0.74 0.0 2.6 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 51050.70
Minimum 42319.90
Maximum 60977.47
Spread ( max - min ) 18657.57
Range [ ( max - min ) / 2 * 100% ] 18.27%
Standard Deviation 2560.3491
5th Percentile 46983.73
95th Percentile 55363.56
( 95th Percentile - 5th Percentile ) 8379.83
Mean Distribution
Standard Deviation 29.5663
95.00% Confidence Interval ( 50992.76 - 51108.65 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 97
0.1% Error 9663
0.1 Scale Factor Error with Delta=300 55961
0.05 Scale Factor Error with Delta=300 223843
0.01 Scale Factor Error with Delta=300 5596056
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 51050.70
Minimum 42319.90
Maximum 60977.47
Spread ( max - min ) 18657.57
Range [ ( max - min ) / 2 * 100% ] 18.27%
Standard Deviation 2560.3491
5th Percentile 46983.73
95th Percentile 55363.56
( 95th Percentile - 5th Percentile ) 8379.83
Mean Distribution
Standard Deviation 29.5663
95.00% Confidence Interval ( 50992.76 - 51108.65 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 97
0.1% Error 9663
0.1 Scale Factor Error with Delta=300 55961
0.05 Scale Factor Error with Delta=300 223843
0.01 Scale Factor Error with Delta=300 5596056
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 51050.70
Minimum 42319.90
Maximum 60977.47
Spread ( max - min ) 18657.57
Range [ ( max - min ) / 2 * 100% ] 18.27%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 14875761.30
Minimum 10282150.21
Maximum 18793557.72
Spread ( max - min ) 8511407.52
Range [ ( max - min ) / 2 * 100% ] 28.61%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 877.44
Minimum 0.00
Maximum 2345.77
Spread ( max - min ) 2345.77
Range [ ( max - min ) / 2 * 100% ] 133.67%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 756.41
Minimum 0.00
Maximum 1946.19
Spread ( max - min ) 1946.19
Range [ ( max - min ) / 2 * 100% ] 128.65%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
B 0.00 variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
E 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
F 0.00 variable,name=2h_check,value=main_hand.2h
G 0.00 variable,name=erw_pooling_time,op=setif,value=30,value_else=45,condition=death_knight.ams_absorb_percent>0.59
Protects Breath from starving itself on ERW charges depending on anticipated resource gains. More resources enable more aggressive use.
Default action list Executed every time the actor is available.
# count action,conditions
H 1.00 auto_attack
I 0.00 call_action_list,name=variables
Choose Action list to run
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=high_prio_actions
L 0.00 call_action_list,name=cooldowns
M 0.00 call_action_list,name=racials
N 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
O 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
P 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
Q 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
R 0.00 call_action_list,name=aoe,if=active_enemies>=2
S 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
T 36.37 howling_blast,if=variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
Breath Active Rotation
U 2.95 horn_of_winter,if=rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
V 22.62 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&(buff.killing_machine.react|runic_power>45)
W 30.01 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up
0.00 remorseless_winter,if=runic_power<36&rune.time_to_2>runic_power%18
X 0.75 death_and_decay,if=(set_bonus.tier31_4pc&variable.st_planning&talent.unholy_ground&!death_and_decay.ticking&runic_power.deficit>=10)|runic_power<36&rune.time_to_2>runic_power%18
Y 0.28 howling_blast,if=runic_power<36&rune.time_to_2>runic_power%18
Z 5.93 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
a 0.30 howling_blast,if=buff.rime.react
b 0.80 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
c 1.45 potion,if=(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
Cooldowns
d 0.29 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
e 3.66 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
f 0.13 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
g 2.85 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=set_bonus.tier31_2pc&buff.chilling_rage.remains<3
0.00 chill_streak,if=!set_bonus.tier31_2pc&active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
h 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
i 8.39 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
j 2.94 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
k 2.96 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react&rune>2|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>50|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.high_prio_actions
# count action,conditions
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
l 6.91 antimagic_shell,if=runic_power.deficit>40&death_knight.first_ams_cast<time
0.00 antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.ready|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up))
0.00 antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&((!talent.obliteration|talent.obliteration&(!cooldown.pillar_of_frost.ready|buff.pillar_of_frost.up&!buff.killing_machine.react))|(equipped.fyralath_the_dreamrender&!dot.mark_of_fyralath.ticking))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
m 4.90 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
n 15.27 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target
# count action,conditions
o 21.83 frost_strike,if=buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
Single Target Rotation
0.00 howling_blast,if=buff.rime.react&set_bonus.tier30_2pc&buff.killing_machine.stack<2
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
p 29.51 obliterate,if=buff.killing_machine.react
q 22.17 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)&talent.obliteration&talent.breath_of_sindragosa
r 3.26 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
s 14.35 obliterate,if=!variable.pooling_runes&buff.remorseless_winter.up
t 1.23 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
u 1.52 arcane_torrent,if=runic_power.deficit>20
v 16.32 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.pillar_of_frost.up&!buff.empower_rune_weapon.up&!death_and_decay.ticking&(active_enemies<2|dot.frost_fever.ticking)
Trinkets
0.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
w 2.95 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&((variable.damage_trinket_priority=1|trinket.2.cooldown.remains)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
x 2.78 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&((variable.damage_trinket_priority=2|trinket.1.cooldown.remains)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGHngkqsqjweicWWWTUVTVTWTWTWTVTnZZTVTxlWZTVVTZTVZTZiTenVbVTVTVTWTWWVWWTnWlTVTsstsoopqiovnsospoqovvvppqpmlnqvsqvpsoivvgkpqwjVneTWTVWVTVTWTWWTVxWnTlWWTViTUWWaWsvunsvvpqsqmpqvpqvnsqosoisoqrlpopopnooqpopopqovpvivnsqsmqvsqolvgkpqjwnTVVWZTeVTWTViTVVWxnTVTVTWWTVWlTWTVTnpqssmhqpqo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 4 trinket_1_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 5 trinket_2_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 6 trinket_1_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 7 trinket_2_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat A trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat B damage_trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat E rw_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat F 2h_check PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat G erw_pooling_time PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
0:00.000 default H auto_attack Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
0:00.000 high_prio_actions n remorseless_winter Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, corrupting_rage
0:01.030 cooldowns g abomination_limb Fluffy_Pillow 10.0/124: 8% runic_power
5.0/6: 83% rune
bloodlust, remorseless_winter, corrupting_rage
0:02.061 cooldowns k raise_dead PR_Death_Knight_Frost 10.0/124: 8% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, remorseless_winter, rime, corrupting_rage
0:02.061 single_target q howling_blast Fluffy_Pillow 10.0/124: 8% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, remorseless_winter, rime, corrupting_rage
0:03.092 single_target s obliterate Fluffy_Pillow 18.0/124: 15% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, gathering_storm, remorseless_winter, corrupting_rage
0:04.123 single_target q howling_blast Fluffy_Pillow 43.0/124: 35% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, gathering_storm(3), remorseless_winter, rime, corrupting_rage
0:05.154 cooldowns j breath_of_sindragosa Fluffy_Pillow 56.0/124: 45% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, gathering_storm(4), remorseless_winter, corrupting_rage
0:05.154 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 56.0/124: 45% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(4), remorseless_winter, corrupting_rage
0:05.154 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 56.0/124: 45% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(4), remorseless_winter, bound_by_fire_and_blaze, corrupting_rage
0:05.154 cooldowns i pillar_of_frost PR_Death_Knight_Frost 61.0/124: 49% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(4), remorseless_winter, bound_by_fire_and_blaze, corrupting_rage
0:05.154 cooldowns c potion Fluffy_Pillow 61.0/124: 49% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(4), pillar_of_frost, remorseless_winter, bound_by_fire_and_blaze, corrupting_rage
0:05.154 breath W obliterate Fluffy_Pillow 61.0/124: 49% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(4), pillar_of_frost, remorseless_winter, bound_by_fire_and_blaze, corrupting_rage, elemental_potion_of_ultimate_power
0:06.051 breath W obliterate Fluffy_Pillow 81.0/124: 65% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:06.947 breath W obliterate Fluffy_Pillow 83.0/124: 67% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons, breath_of_sindragosa, gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, unleashed_frenzy, bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:07.843 breath T howling_blast Fluffy_Pillow 85.0/124: 69% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(2), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy(2), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:08.740 breath U horn_of_winter PR_Death_Knight_Frost 85.0/124: 69% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:09.637 breath V obliterate Fluffy_Pillow 92.0/124: 74% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:10.534 breath T howling_blast Fluffy_Pillow 99.0/124: 80% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:11.431 breath V obliterate Fluffy_Pillow 94.0/124: 76% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:12.327 breath T howling_blast Fluffy_Pillow 96.0/124: 77% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:13.224 breath W obliterate Fluffy_Pillow 86.0/124: 69% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:14.121 breath T howling_blast Fluffy_Pillow 111.0/124: 90% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:15.018 breath W obliterate Fluffy_Pillow 106.0/124: 85% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:15.915 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:16.811 breath W obliterate Fluffy_Pillow 96.0/124: 77% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(19), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:17.707 breath T howling_blast Fluffy_Pillow 103.0/124: 83% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:18.603 breath V obliterate Fluffy_Pillow 93.0/124: 75% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:19.499 breath T howling_blast Fluffy_Pillow 95.0/124: 77% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:20.395 high_prio_actions n remorseless_winter Fluffy_Pillow 95.0/124: 77% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage, elemental_potion_of_ultimate_power
0:21.292 breath Z obliterate Fluffy_Pillow 87.0/124: 70% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:22.189 breath Z obliterate Fluffy_Pillow 94.0/124: 76% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:23.086 breath T howling_blast Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:23.983 breath V obliterate Fluffy_Pillow 111.0/124: 90% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:24.880 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:25.156 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 101.0/124: 81% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.777 Waiting     0.464s 101.0/124: 81% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), dragon_games_equipment, corrupting_rage, elemental_potion_of_ultimate_power
0:26.241 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 83.0/124: 67% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:26.241 breath W obliterate Fluffy_Pillow 83.0/124: 67% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:27.271 breath Z obliterate Fluffy_Pillow 85.0/124: 69% runic_power
2.0/6: 33% rune
bloodlust, antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:28.302 breath T howling_blast Fluffy_Pillow 91.8/124: 74% runic_power
1.0/6: 17% rune
bloodlust, antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:29.333 Waiting     0.288s 89.9/124: 73% runic_power
1.0/6: 17% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:29.621 breath V obliterate Fluffy_Pillow 89.9/124: 73% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:30.651 breath V obliterate Fluffy_Pillow 102.9/124: 83% runic_power
2.0/6: 33% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:31.682 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
0.0/6: 0% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:32.713 Waiting     0.444s 104.1/124: 84% runic_power
0.0/6: 0% rune
bloodlust, antimagic_shell, rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:33.157 breath Z obliterate Fluffy_Pillow 92.3/124: 74% runic_power
2.0/6: 33% rune
bloodlust, antimagic_shell, rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:34.188 breath T howling_blast Fluffy_Pillow 99.1/124: 80% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:35.219 Waiting     1.222s 97.2/124: 78% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
0:36.441 breath V obliterate Fluffy_Pillow 85.4/124: 69% runic_power
3.0/6: 50% rune
bloodlust, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
0:37.472 breath Z obliterate Fluffy_Pillow 98.4/124: 79% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
0:38.503 breath T howling_blast Fluffy_Pillow 105.2/124: 85% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
0:39.534 Waiting     0.474s 95.2/124: 77% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
0:40.008 breath Z obliterate Fluffy_Pillow 95.2/124: 77% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
0:41.348 cooldowns i pillar_of_frost PR_Death_Knight_Frost 79.2/124: 64% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
0:41.348 breath T howling_blast Fluffy_Pillow 79.2/124: 64% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
0:42.189 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 69.2/124: 56% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, unleashed_frenzy(3), corrupting_rage
0:42.688 high_prio_actions n remorseless_winter Fluffy_Pillow 74.2/124: 60% runic_power
1.0/6: 17% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, unleashed_frenzy(3), corrupting_rage
0:43.852 Waiting     0.192s 66.2/124: 53% runic_power
0.0/6: 0% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
0:44.044 breath V obliterate Fluffy_Pillow 66.2/124: 53% runic_power
2.0/6: 33% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
0:45.208 breath b arcane_torrent PR_Death_Knight_Frost 55.2/124: 45% runic_power
1.0/6: 17% rune
empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
0:46.373 Waiting     0.829s 62.2/124: 50% runic_power
1.0/6: 17% rune
empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
0:47.202 breath V obliterate Fluffy_Pillow 54.2/124: 44% runic_power
3.0/6: 50% rune
empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
0:48.367 breath T howling_blast Fluffy_Pillow 56.2/124: 45% runic_power
2.0/6: 33% rune
empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:49.531 breath V obliterate Fluffy_Pillow 46.2/124: 37% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:50.696 breath T howling_blast Fluffy_Pillow 53.0/124: 43% runic_power
1.0/6: 17% rune
unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:51.861 breath V obliterate Fluffy_Pillow 45.0/124: 36% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:53.026 breath T howling_blast Fluffy_Pillow 58.0/124: 47% runic_power
2.0/6: 33% rune
unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
0:54.190 breath W obliterate Fluffy_Pillow 31.9/124: 26% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:55.355 breath T howling_blast Fluffy_Pillow 44.9/124: 36% runic_power
1.0/6: 17% rune
unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:56.520 breath W obliterate Fluffy_Pillow 36.8/124: 30% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:57.685 breath W obliterate Fluffy_Pillow 43.8/124: 35% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:58.849 breath V obliterate Fluffy_Pillow 50.8/124: 41% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:00.013 breath W obliterate Fluffy_Pillow 52.8/124: 43% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:01.178 breath W obliterate Fluffy_Pillow 36.8/124: 30% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:02.343 breath T howling_blast Fluffy_Pillow 48.8/124: 39% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:03.682 high_prio_actions n remorseless_winter Fluffy_Pillow 38.8/124: 31% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:05.022 breath W obliterate Fluffy_Pillow 37.0/124: 30% runic_power
2.0/6: 33% rune
unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
1:06.362 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 32.0/124: 26% runic_power
1.0/6: 17% rune
unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
1:06.362 breath T howling_blast Fluffy_Pillow 32.0/124: 26% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
1:07.702 breath V obliterate Fluffy_Pillow 23.9/124: 19% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3)
1:09.042 breath T howling_blast Fluffy_Pillow 43.1/124: 35% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, unleashed_frenzy(3)
1:10.381 single_target s obliterate Fluffy_Pillow 17.0/124: 14% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(6), remorseless_winter, unleashed_frenzy(3)
1:11.721 single_target s obliterate Fluffy_Pillow 48.0/124: 39% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(8), remorseless_winter, unleashed_frenzy(3)
1:13.061 single_target t horn_of_winter PR_Death_Knight_Frost 68.0/124: 55% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(10), remorseless_winter, unleashed_frenzy(3)
1:14.400 single_target s obliterate Fluffy_Pillow 93.0/124: 75% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), gathering_storm(10), remorseless_winter, unleashed_frenzy(3)
1:15.740 single_target o frost_strike Fluffy_Pillow 118.0/124: 95% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, unleashed_frenzy(3)
1:17.080 single_target o frost_strike Fluffy_Pillow 100.4/124: 81% runic_power
2.0/6: 33% rune
unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, unleashed_frenzy(3)
1:18.420 single_target p obliterate Fluffy_Pillow 70.4/124: 57% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, unleashed_frenzy(3)
1:19.760 single_target q howling_blast Fluffy_Pillow 95.2/124: 77% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3)
1:21.100 cooldowns i pillar_of_frost PR_Death_Knight_Frost 117.6/124: 95% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:21.348 single_target o frost_strike Fluffy_Pillow 117.6/124: 95% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:22.688 single_target v frost_strike Fluffy_Pillow 93.8/124: 76% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:24.028 high_prio_actions n remorseless_winter Fluffy_Pillow 70.0/124: 56% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:25.368 single_target s obliterate Fluffy_Pillow 80.0/124: 64% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:26.706 single_target o frost_strike Fluffy_Pillow 105.0/124: 85% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:28.046 single_target s obliterate Fluffy_Pillow 75.0/124: 60% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:29.386 single_target p obliterate Fluffy_Pillow 100.0/124: 81% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
1:30.726 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:32.066 single_target q howling_blast Fluffy_Pillow 99.0/124: 80% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:33.406 single_target o frost_strike Fluffy_Pillow 107.0/124: 86% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:34.746 single_target v frost_strike Fluffy_Pillow 77.0/124: 62% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:36.086 single_target v frost_strike Fluffy_Pillow 53.2/124: 43% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:37.426 Waiting     0.729s 29.4/124: 24% runic_power
4.0/6: 67% rune
unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:38.155 single_target v frost_strike Fluffy_Pillow 35.6/124: 29% runic_power
4.0/6: 67% rune
unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:39.495 single_target p obliterate Fluffy_Pillow 5.6/124: 5% runic_power
4.0/6: 67% rune
unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:40.835 single_target p obliterate Fluffy_Pillow 35.4/124: 29% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:42.174 single_target q howling_blast Fluffy_Pillow 55.4/124: 45% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:43.514 single_target p obliterate Fluffy_Pillow 63.4/124: 51% runic_power
2.0/6: 33% rune
icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:44.853 high_prio_actions m frost_strike Fluffy_Pillow 88.4/124: 71% runic_power
1.0/6: 17% rune
icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:46.193 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 58.4/124: 47% runic_power
1.0/6: 17% rune
icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:46.362 high_prio_actions n remorseless_winter Fluffy_Pillow 58.4/124: 47% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:47.702 single_target q howling_blast Fluffy_Pillow 68.4/124: 55% runic_power
0.0/6: 0% rune
antimagic_shell, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:49.041 single_target v frost_strike Fluffy_Pillow 76.4/124: 62% runic_power
1.0/6: 17% rune
antimagic_shell, rune_of_hysteria, icy_talons(3), gathering_storm, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:50.381 single_target s obliterate Fluffy_Pillow 58.8/124: 47% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:51.720 single_target q howling_blast Fluffy_Pillow 83.6/124: 67% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:53.059 single_target v frost_strike Fluffy_Pillow 93.5/124: 75% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(4), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:54.399 single_target p obliterate Fluffy_Pillow 69.7/124: 56% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(4), killing_machine, remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:55.739 single_target s obliterate Fluffy_Pillow 94.5/124: 76% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm(6), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:57.079 single_target o frost_strike Fluffy_Pillow 114.5/124: 92% runic_power
0.0/6: 0% rune
unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(8), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:58.419 cooldowns i pillar_of_frost PR_Death_Knight_Frost 84.5/124: 68% runic_power
1.0/6: 17% rune
unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:58.419 single_target v frost_strike Fluffy_Pillow 84.5/124: 68% runic_power
1.0/6: 17% rune
unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:59.759 single_target v frost_strike Fluffy_Pillow 54.5/124: 44% runic_power
2.0/6: 33% rune
unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:01.097 cooldowns g abomination_limb Fluffy_Pillow 30.7/124: 25% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:02.436 cooldowns k raise_dead PR_Death_Knight_Frost 30.7/124: 25% runic_power
4.0/6: 67% rune
unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), killing_machine, pillar_of_frost, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:02.436 single_target p obliterate Fluffy_Pillow 30.7/124: 25% runic_power
4.0/6: 67% rune
unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), killing_machine, pillar_of_frost, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:03.776 single_target q howling_blast Fluffy_Pillow 55.5/124: 45% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
2:05.116 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 63.5/124: 51% runic_power
3.0/6: 50% rune
abomination_limb, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
2:05.154 cooldowns j breath_of_sindragosa Fluffy_Pillow 63.5/124: 51% runic_power
3.0/6: 50% rune
abomination_limb, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
2:05.154 breath V obliterate Fluffy_Pillow 63.5/124: 51% runic_power
5.0/6: 83% rune
abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:06.494 high_prio_actions n remorseless_winter Fluffy_Pillow 70.5/124: 57% runic_power
3.0/6: 50% rune
abomination_limb, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(5), rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:07.165 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 62.5/124: 50% runic_power
2.0/6: 33% rune
abomination_limb, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:07.834 breath T howling_blast Fluffy_Pillow 72.5/124: 58% runic_power
3.0/6: 50% rune
abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:08.999 breath W obliterate Fluffy_Pillow 67.5/124: 54% runic_power
4.0/6: 67% rune
abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:10.163 breath T howling_blast Fluffy_Pillow 56.5/124: 46% runic_power
3.0/6: 50% rune
abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:11.327 breath V obliterate Fluffy_Pillow 56.5/124: 46% runic_power
4.0/6: 67% rune
abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:12.492 breath W obliterate Fluffy_Pillow 63.5/124: 51% runic_power
4.0/6: 67% rune
abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:13.656 breath V obliterate Fluffy_Pillow 70.5/124: 57% runic_power
4.0/6: 67% rune
empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
2:14.821 breath T howling_blast Fluffy_Pillow 82.5/124: 67% runic_power
4.0/6: 67% rune
empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
2:15.985 breath V obliterate Fluffy_Pillow 72.5/124: 58% runic_power
4.0/6: 67% rune
empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
2:17.150 breath T howling_blast Fluffy_Pillow 79.5/124: 64% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:18.315 breath W obliterate Fluffy_Pillow 61.5/124: 50% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:19.480 breath T howling_blast Fluffy_Pillow 68.3/124: 55% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:20.644 breath W obliterate Fluffy_Pillow 66.4/124: 54% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:21.809 breath W obliterate Fluffy_Pillow 73.2/124: 59% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:22.974 breath T howling_blast Fluffy_Pillow 86.2/124: 70% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:24.139 breath V obliterate Fluffy_Pillow 90.6/124: 73% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:25.164 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 79.4/124: 64% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
2:25.304 breath W obliterate Fluffy_Pillow 79.4/124: 64% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), dragon_games_equipment, corrupting_rage
2:26.468 high_prio_actions n remorseless_winter Fluffy_Pillow 91.2/124: 74% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
2:27.659 breath T howling_blast Fluffy_Pillow 88.2/124: 71% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
2:28.998 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 78.2/124: 63% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, unleashed_frenzy(3), corrupting_rage
2:28.998 breath W obliterate Fluffy_Pillow 78.2/124: 63% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, unleashed_frenzy(3), corrupting_rage
2:30.336 breath W obliterate Fluffy_Pillow 67.2/124: 54% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, unleashed_frenzy(3), corrupting_rage
2:31.675 breath T howling_blast Fluffy_Pillow 69.2/124: 56% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
2:33.015 breath V obliterate Fluffy_Pillow 59.2/124: 48% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, unleashed_frenzy(3), corrupting_rage
2:34.355 cooldowns i pillar_of_frost PR_Death_Knight_Frost 43.2/124: 35% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:34.419 breath T howling_blast Fluffy_Pillow 43.2/124: 35% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:35.759 breath U horn_of_winter PR_Death_Knight_Frost 33.2/124: 27% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:37.099 breath W obliterate Fluffy_Pillow 45.2/124: 36% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:38.438 breath W obliterate Fluffy_Pillow 34.2/124: 28% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:39.777 breath a howling_blast Fluffy_Pillow 36.2/124: 29% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:41.117 breath W obliterate Fluffy_Pillow 26.2/124: 21% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:42.457 single_target s obliterate Fluffy_Pillow 10.2/124: 8% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:43.797 single_target v frost_strike Fluffy_Pillow 30.2/124: 24% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
2:45.137 single_target u arcane_torrent PR_Death_Knight_Frost 5.2/124: 4% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
2:46.547 high_prio_actions n remorseless_winter Fluffy_Pillow 30.2/124: 24% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:47.886 single_target s obliterate Fluffy_Pillow 40.2/124: 32% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:49.226 single_target v frost_strike Fluffy_Pillow 60.2/124: 49% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:50.566 single_target v frost_strike Fluffy_Pillow 30.2/124: 24% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:51.906 single_target p obliterate Fluffy_Pillow 0.2/124: 0% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3)
2:53.245 single_target q howling_blast Fluffy_Pillow 25.2/124: 20% runic_power
3.0/6: 50% rune
icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
2:54.584 single_target s obliterate Fluffy_Pillow 38.2/124: 31% runic_power
3.0/6: 50% rune
icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3)
2:55.924 single_target q howling_blast Fluffy_Pillow 58.2/124: 47% runic_power
1.0/6: 17% rune
rune_of_hysteria, icy_talons(3), gathering_storm(7), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3)
2:57.264 high_prio_actions m frost_strike Fluffy_Pillow 74.3/124: 60% runic_power
2.0/6: 33% rune
rune_mastery, rune_of_hysteria, icy_talons(3), gathering_storm(8), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3)
2:58.603 single_target p obliterate Fluffy_Pillow 44.3/124: 36% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), bonegrinder_crit, unleashed_frenzy(3)
2:59.943 single_target q howling_blast Fluffy_Pillow 75.3/124: 61% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(3)
3:01.281 single_target v frost_strike Fluffy_Pillow 85.2/124: 69% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3)
3:02.621 single_target p obliterate Fluffy_Pillow 55.2/124: 45% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3)
3:03.961 single_target q howling_blast Fluffy_Pillow 75.2/124: 61% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3)
3:05.300 single_target v frost_strike Fluffy_Pillow 85.1/124: 69% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3)
3:06.640 high_prio_actions n remorseless_winter Fluffy_Pillow 61.3/124: 49% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:07.980 single_target s obliterate Fluffy_Pillow 73.7/124: 59% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:09.319 single_target q howling_blast Fluffy_Pillow 98.5/124: 79% runic_power
2.0/6: 33% rune
unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:10.659 single_target o frost_strike Fluffy_Pillow 108.4/124: 87% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:11.999 single_target s obliterate Fluffy_Pillow 90.8/124: 73% runic_power
4.0/6: 67% rune
unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:13.339 single_target o frost_strike Fluffy_Pillow 115.6/124: 93% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:14.677 cooldowns i pillar_of_frost PR_Death_Knight_Frost 91.8/124: 74% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:14.677 single_target s obliterate Fluffy_Pillow 91.8/124: 74% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), pillar_of_frost, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:16.017 single_target o frost_strike Fluffy_Pillow 122.8/124: 99% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(7), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:17.357 single_target q howling_blast Fluffy_Pillow 99.0/124: 80% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(7), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:18.697 single_target r frost_strike Fluffy_Pillow 109.0/124: 88% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:20.036 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 79.0/124: 64% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:20.036 single_target p obliterate Fluffy_Pillow 79.0/124: 64% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:21.376 single_target o frost_strike Fluffy_Pillow 110.0/124: 89% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(5), rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:22.716 single_target p obliterate Fluffy_Pillow 80.0/124: 64% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(5), rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:24.056 single_target o frost_strike Fluffy_Pillow 104.8/124: 84% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
3:25.396 single_target p obliterate Fluffy_Pillow 74.8/124: 60% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
3:26.735 high_prio_actions n remorseless_winter Fluffy_Pillow 99.6/124: 80% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:28.075 single_target o frost_strike Fluffy_Pillow 118.2/124: 95% runic_power
0.0/6: 0% rune
rune_of_hysteria, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:29.415 single_target o frost_strike Fluffy_Pillow 100.6/124: 81% runic_power
2.0/6: 33% rune
rune_of_hysteria, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:30.754 single_target q howling_blast Fluffy_Pillow 70.6/124: 57% runic_power
4.0/6: 67% rune
rune_of_hysteria, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:32.093 single_target p obliterate Fluffy_Pillow 86.7/124: 70% runic_power
5.0/6: 83% rune
icy_talons(3), gathering_storm, killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:33.433 single_target o frost_strike Fluffy_Pillow 111.7/124: 90% runic_power
4.0/6: 67% rune
icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:34.773 single_target p obliterate Fluffy_Pillow 81.7/124: 66% runic_power
5.0/6: 83% rune
icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:36.112 single_target o frost_strike Fluffy_Pillow 106.7/124: 86% runic_power
4.0/6: 67% rune
icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:37.452 single_target p obliterate Fluffy_Pillow 76.7/124: 62% runic_power
5.0/6: 83% rune
icy_talons(3), killing_machine, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:38.792 single_target q howling_blast Fluffy_Pillow 96.7/124: 78% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:40.132 single_target o frost_strike Fluffy_Pillow 104.7/124: 84% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:41.472 single_target v frost_strike Fluffy_Pillow 79.7/124: 64% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
3:42.812 single_target p obliterate Fluffy_Pillow 49.7/124: 40% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
3:44.152 single_target v frost_strike Fluffy_Pillow 74.7/124: 60% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
3:45.492 cooldowns i pillar_of_frost PR_Death_Knight_Frost 44.7/124: 36% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
3:45.492 single_target v frost_strike Fluffy_Pillow 44.7/124: 36% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
3:46.832 high_prio_actions n remorseless_winter Fluffy_Pillow 14.7/124: 12% runic_power
6.0/6: 100% rune
unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, bonegrinder_frost, unleashed_frenzy(3)
3:48.172 single_target s obliterate Fluffy_Pillow 27.1/124: 22% runic_power
5.0/6: 83% rune
unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, unleashed_frenzy(3)
3:49.511 single_target q howling_blast Fluffy_Pillow 58.1/124: 47% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy(3)
3:50.851 single_target s obliterate Fluffy_Pillow 68.0/124: 55% runic_power
3.0/6: 50% rune
unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3)
3:52.191 high_prio_actions m frost_strike Fluffy_Pillow 92.8/124: 75% runic_power
1.0/6: 17% rune
unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3)
3:53.531 single_target q howling_blast Fluffy_Pillow 69.0/124: 56% runic_power
1.0/6: 17% rune
rune_of_hysteria, icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3)
3:54.871 single_target v frost_strike Fluffy_Pillow 78.9/124: 64% runic_power
1.0/6: 17% rune
rune_of_hysteria, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3)
3:56.210 single_target s obliterate Fluffy_Pillow 55.1/124: 44% runic_power
2.0/6: 33% rune
rune_of_hysteria, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3)
3:57.550 single_target q howling_blast Fluffy_Pillow 86.1/124: 69% runic_power
2.0/6: 33% rune
rune_of_hysteria, icy_talons(3), gathering_storm(8), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
3:58.890 single_target o frost_strike Fluffy_Pillow 102.2/124: 82% runic_power
2.0/6: 33% rune
rune_of_hysteria, icy_talons(3), gathering_storm(9), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
4:00.230 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 72.2/124: 58% runic_power
3.0/6: 50% rune
rune_of_hysteria, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
4:00.230 single_target v frost_strike Fluffy_Pillow 72.2/124: 58% runic_power
3.0/6: 50% rune
antimagic_shell, rune_of_hysteria, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
4:01.570 cooldowns g abomination_limb Fluffy_Pillow 54.6/124: 44% runic_power
4.0/6: 67% rune
antimagic_shell, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:02.910 cooldowns k raise_dead PR_Death_Knight_Frost 59.6/124: 48% runic_power
4.0/6: 67% rune
antimagic_shell, rune_of_hysteria, abomination_limb, icy_talons(3), killing_machine, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:02.910 single_target p obliterate Fluffy_Pillow 59.6/124: 48% runic_power
4.0/6: 67% rune
antimagic_shell, rune_of_hysteria, abomination_limb, icy_talons(3), killing_machine, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:04.250 single_target q howling_blast Fluffy_Pillow 84.4/124: 68% runic_power
3.0/6: 50% rune
antimagic_shell, rune_of_hysteria, abomination_limb, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:05.590 cooldowns j breath_of_sindragosa Fluffy_Pillow 100.6/124: 81% runic_power
4.0/6: 67% rune
antimagic_shell, rune_of_hysteria, abomination_limb, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:05.590 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 100.6/124: 81% runic_power
6.0/6: 100% rune
antimagic_shell, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:05.590 Waiting     1.023s 100.6/124: 81% runic_power
6.0/6: 100% rune
antimagic_shell, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
4:06.613 high_prio_actions n remorseless_winter Fluffy_Pillow 82.6/124: 67% runic_power
6.0/6: 100% rune
antimagic_shell, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:08.172 breath T howling_blast Fluffy_Pillow 77.0/124: 62% runic_power
5.0/6: 83% rune
rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:09.512 breath V obliterate Fluffy_Pillow 75.1/124: 61% runic_power
5.0/6: 83% rune
unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:10.852 breath V obliterate Fluffy_Pillow 70.1/124: 57% runic_power
5.0/6: 83% rune
unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:12.192 breath W obliterate Fluffy_Pillow 77.1/124: 62% runic_power
5.0/6: 83% rune
unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:13.531 breath Z obliterate Fluffy_Pillow 84.1/124: 68% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(7), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:14.869 breath T howling_blast Fluffy_Pillow 73.1/124: 59% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(9), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:15.596 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 63.1/124: 51% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:16.208 breath V obliterate Fluffy_Pillow 68.1/124: 55% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:17.373 breath T howling_blast Fluffy_Pillow 75.1/124: 61% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:18.537 breath W obliterate Fluffy_Pillow 70.1/124: 57% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:19.702 breath T howling_blast Fluffy_Pillow 59.1/124: 48% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:20.867 breath V obliterate Fluffy_Pillow 55.3/124: 45% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:22.032 cooldowns i pillar_of_frost PR_Death_Knight_Frost 62.1/124: 50% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:22.032 breath T howling_blast Fluffy_Pillow 62.1/124: 50% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:23.197 breath V obliterate Fluffy_Pillow 60.2/124: 49% runic_power
4.0/6: 67% rune
unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
4:24.362 breath V obliterate Fluffy_Pillow 67.0/124: 54% runic_power
2.0/6: 33% rune
unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:25.527 breath W obliterate Fluffy_Pillow 73.8/124: 60% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:25.623 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 86.8/124: 70% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
4:26.692 high_prio_actions n remorseless_winter Fluffy_Pillow 75.0/124: 60% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
4:27.997 breath T howling_blast Fluffy_Pillow 69.4/124: 56% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
4:29.160 breath V obliterate Fluffy_Pillow 59.4/124: 48% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
4:30.325 breath T howling_blast Fluffy_Pillow 66.4/124: 54% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
4:31.490 breath V obliterate Fluffy_Pillow 66.4/124: 54% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
4:32.655 breath T howling_blast Fluffy_Pillow 55.4/124: 45% runic_power
4.0/6: 67% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), corrupting_rage
4:33.818 breath W obliterate Fluffy_Pillow 50.4/124: 41% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, enduring_strength_builder(5), unleashed_frenzy(3), corrupting_rage
4:34.982 breath W obliterate Fluffy_Pillow 52.4/124: 42% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:36.146 breath T howling_blast Fluffy_Pillow 59.4/124: 48% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:37.485 breath V obliterate Fluffy_Pillow 54.4/124: 44% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:38.824 breath W obliterate Fluffy_Pillow 49.4/124: 40% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:40.164 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 56.2/124: 45% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:40.230 breath T howling_blast Fluffy_Pillow 56.2/124: 45% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:41.570 breath W obliterate Fluffy_Pillow 48.1/124: 39% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:42.910 breath T howling_blast Fluffy_Pillow 43.1/124: 35% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:44.250 breath V obliterate Fluffy_Pillow 35.0/124: 28% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:45.589 breath T howling_blast Fluffy_Pillow 41.8/124: 34% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:46.929 high_prio_actions n remorseless_winter Fluffy_Pillow 18.8/124: 15% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:48.269 single_target p obliterate Fluffy_Pillow 10.8/124: 9% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
4:49.608 single_target q howling_blast Fluffy_Pillow 35.8/124: 29% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
4:50.948 single_target s obliterate Fluffy_Pillow 48.8/124: 39% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
4:52.288 single_target s obliterate Fluffy_Pillow 68.8/124: 56% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3)
4:53.628 high_prio_actions m frost_strike Fluffy_Pillow 93.8/124: 76% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(7), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3)
4:54.966 cooldowns h pillar_of_frost PR_Death_Knight_Frost 63.8/124: 51% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(7), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3)
4:54.966 single_target q howling_blast Fluffy_Pillow 63.8/124: 51% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(7), killing_machine, pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3)
4:56.306 single_target p obliterate Fluffy_Pillow 76.8/124: 62% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3)
4:57.646 single_target q howling_blast Fluffy_Pillow 96.8/124: 78% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3)
4:58.986 single_target o frost_strike Fluffy_Pillow 109.8/124: 89% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3)

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5690 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3848 0 16538 15751 9278
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 330760 315020 0
Runic Power 124 124 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 30.85% 24.64% 2995
Haste 12.25% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 5974 5598 0
Mastery 46.03% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +923 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +111 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +519 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=sizzling_seafood_medley
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
actions.precombat+=/variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h
# Protects Breath from starving itself on ERW charges depending on anticipated resource gains. More resources enable more aggressive use.
actions.precombat+=/variable,name=erw_pooling_time,op=setif,value=30,value_else=45,condition=death_knight.ams_absorb_percent>0.59

# Executed every time the actor is available.
actions=auto_attack
# Choose Action list to run
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/frostscythe,if=!death_and_decay.ticking&equipped.fyralath_the_dreamrender&(cooldown.rage_of_fyralath_417131.remains<3|!dot.mark_of_fyralath.ticking)
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=howling_blast,if=variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&(buff.killing_machine.react|runic_power>45)
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up
actions.breath+=/remorseless_winter,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/death_and_decay,if=(set_bonus.tier31_4pc&variable.st_planning&talent.unholy_ground&!death_and_decay.ticking&runic_power.deficit>=10)|runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/howling_blast,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=set_bonus.tier31_2pc&buff.chilling_rage.remains<3
actions.cooldowns+=/chill_streak,if=!set_bonus.tier31_2pc&active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react&rune>2|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>50|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
actions.high_prio_actions=invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions.high_prio_actions+=/mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40&death_knight.first_ams_cast<time
actions.high_prio_actions+=/antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.ready|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up))
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions.high_prio_actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&((!talent.obliteration|talent.obliteration&(!cooldown.pillar_of_frost.ready|buff.pillar_of_frost.up&!buff.killing_machine.react))|(equipped.fyralath_the_dreamrender&!dot.mark_of_fyralath.ticking))
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/remorseless_winter,if=variable.rw_buffs|variable.adds_remain

# Obliteration Active Rotation
actions.obliteration=howling_blast,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&buff.rime.react
actions.obliteration+=/frost_strike,if=(active_enemies<=1|!talent.glacial_advance)&buff.killing_machine.react<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/glacial_advance,if=buff.killing_machine.react<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&(variable.frostscythe_priority|active_enemies>3&!death_and_decay.ticking&equipped.fyralath_the_dreamrender&(cooldown.rage_of_fyralath_417131.remains<3|!dot.mark_of_fyralath.ticking))
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&(!dot.frost_fever.ticking|buff.rime.react&set_bonus.tier30_2pc&!variable.rp_buffs)
actions.obliteration+=/glacial_advance,if=!buff.killing_machine.react&(!death_knight.runeforge.razorice&(!talent.avalanche|debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)|((variable.rp_buffs|rune<2)&active_enemies>1))
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(rune<2|variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<30
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<30
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=frost_strike,if=buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
actions.single_target+=/howling_blast,if=buff.rime.react&set_bonus.tier30_2pc&buff.killing_machine.stack<2
actions.single_target+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes&buff.remorseless_winter.up
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets
actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.pillar_of_frost.up&!buff.empower_rune_weapon.up&!death_and_decay.ticking&(active_enemies<2|dot.frost_fever.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&((variable.damage_trinket_priority=1|trinket.2.cooldown.remains)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&((variable.damage_trinket_priority=2|trinket.1.cooldown.remains)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions.variables+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions.variables+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions.variables+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
actions.variables+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains>10|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up
actions.variables+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>8|!death_and_decay.ticking&active_enemies>4))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions.variables+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions.variables+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions.variables+=/variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions.variables+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=9278
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 56734 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
56733.6 56733.6 44.6 / 0.079% 7577.9 / 13.4% 4150.2
APS APS Error APS Range APR
163.9 3.8 / 2.314% 427.7 / 261.0% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.6 7.7 Runic Power 1.36% 52.6 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 56734
Apocalypse 239 (8116) 0.4% (14.3%) 6.8 46.29s 357561 292069 Direct 6.8 (535.1) 8766 17588 10566 20.4% (20.3%)

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.80 6.80 0.00 0.00 0.00 1.2243 0.0000 71815.08 71815.08 0.00% 292069.07 292069.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.60% 5.41 1 8 8766.15 6910 13296 8760.40 6910 11049 47427 47427 0.00%
crit 20.40% 1.39 0 7 17587.71 12689 26342 13802.04 0 26342 24389 24389 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for {$?a134735=false}[every {$s3=2} Festering {$=}LWound:Wounds;][each Festering Wound] you burst. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [U]:5.80
  • if_expr:variable.st_planning&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [Y]:1.00
  • if_expr:debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell CooldownArmy of the Damned2768373ADD-45000.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
    main_hand 9498  / 4166 7.4% 257.6 4.33s 4843 3218 Direct 257.6 4027 8052 4843 20.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 257.56 257.56 0.00 0.00 0.00 1.5051 0.0000 1247383.26 1782021.52 30.00% 3217.87 3217.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.72% 205.33 145 272 4026.83 1961 6631 4032.58 3638 4458 826818 1181199 30.00%
crit 20.28% 52.23 26 90 8052.21 3921 13084 8063.23 6968 9272 420565 600823 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 2262  / 992 1.8% 188.6 5.98s 1576 1576 Direct 188.6 1311 2621 1576 20.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 188.63 188.63 0.00 0.00 0.00 1.0000 0.0000 297344.76 424789.06 30.00% 1576.38 1576.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.72% 150.37 100 201 1310.56 655 2186 1312.05 1204 1455 197066 281530 30.00%
crit 20.28% 38.26 15 74 2621.13 1331 4372 2623.90 2190 3100 100279 143259 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:47.16
    default
    [ ]:47.16
    default
    [ ]:47.16
    default
    [ ]:47.16
    Frostbolt 1480  / 649 1.1% 19.7 14.92s 9855 6243 Direct 19.7 8189 16368 9859 20.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.75 19.74 0.00 0.00 0.00 1.5786 0.0000 194599.81 194599.81 0.00% 6243.38 6243.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.57% 15.70 7 23 8188.74 4610 13856 8196.52 7047 9473 128603 128603 0.00%
crit 20.43% 4.03 0 12 16367.55 9676 27712 16197.86 0 27320 65996 65996 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:19.85
    Shadow Bolt 4717  / 2069 3.6% 62.4 4.53s 9923 6605 Direct 62.4 8253 16499 9927 20.3%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.40 62.37 0.00 0.00 0.00 1.5024 0.0000 619163.85 619163.85 0.00% 6604.77 6604.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.70% 49.71 30 70 8253.16 4271 13580 8262.49 7362 9250 410289 410289 0.00%
crit 20.30% 12.66 2 27 16499.33 8670 26791 16517.07 12767 21807 208875 208875 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:69.09
Army of the Dead 0 (6172) 0.0% (10.8%) 2.0 0.00s 914013 1388023

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6588 0.4688 0.00 0.00 0.00% 207329.76 1388023.13

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    high_prio_actions
    [h]:1.00
  • if_expr:talent.summon_gargoyle&cooldown.summon_gargoyle.remains<3*gcd|!talent.summon_gargoyle|fight_remains<35
    main_hand 17096  / 3861 6.7% 333.0 0.85s 3434 2641 Direct 333.0 2852 5694 3434 20.5%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 333.04 333.04 0.00 0.00 0.00 1.3001 0.0000 1143495.95 1633607.29 30.00% 2640.94 2640.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.53% 264.85 222 302 2851.55 1230 4229 2850.57 2289 3107 755235 1078934 30.00%
crit 20.47% 68.19 38 98 5693.90 2461 8459 5690.82 4301 6478 388261 554673 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 3271  / 739 1.3% 204.0 1.48s 1073 1073 Direct 204.0 891 1776 1073 20.5%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 203.98 203.98 0.00 0.00 0.00 1.0000 0.0000 218812.93 312597.87 30.00% 1072.74 1072.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.49% 162.14 137 187 891.29 411 1413 891.01 727 984 144516 206457 30.00%
crit 20.51% 41.83 20 64 1776.03 822 2827 1775.12 1323 2181 74297 106141 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:27.08
    default
    [ ]:24.78
    default
    [ ]:25.13
    default
    [ ]:27.21
    default
    [ ]:25.45
    default
    [ ]:24.47
    default
    [ ]:25.15
    default
    [ ]:24.70
    Frostbolt 1368  / 277 0.5% 8.0 30.89s 10264 7154 Direct 8.0 8514 16913 10263 20.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.00 1.4346 0.0000 82108.51 82108.51 0.00% 7154.18 7154.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.17% 6.33 2 8 8514.36 4203 13856 8516.15 5015 12337 53927 53927 0.00%
crit 20.83% 1.67 0 6 16912.61 8406 27712 14308.52 0 27712 28181 28181 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:8.00
    Shadow Bolt 6393  / 1295 2.3% 35.6 6.32s 10789 8136 Direct 35.6 8968 17916 10789 20.4%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.55 35.55 0.00 0.00 0.00 1.3261 0.0000 383609.08 383609.08 0.00% 8136.27 8136.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 28.32 18 36 8968.36 3953 13580 8965.40 7140 10215 253975 253975 0.00%
crit 20.35% 7.24 0 18 17916.12 7905 27159 17905.90 0 24594 129634 129634 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:37.55
auto_attack_mh 2706 4.8% 146.9 2.46s 5524 2259 Direct 146.9 4591 9176 5524 20.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 146.90 146.90 0.00 0.00 0.00 2.4449 0.0000 811452.21 1159246.99 30.00% 2259.37 2259.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 117.01 82 157 4590.92 3685 6812 4590.58 4348 4814 537175 767413 30.00%
crit 20.35% 29.89 12 53 9175.83 7371 13444 9175.00 8336 9989 274277 391834 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 96 0.2% 2.0 179.88s 14251 0 Direct 2.0 11772 23519 14250 21.1%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 28506.72 28506.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.90% 1.58 0 3 11772.13 10402 15146 11232.71 0 15146 18580 18580 0.00%
crit 21.10% 0.42 0 2 23519.33 20804 29205 8836.43 0 29205 9926 9926 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Clawing Shadows 7897 13.9% 70.5 4.12s 33566 28216 Direct 70.5 27890 55699 33566 20.4%

Stats Details: Clawing Shadows

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 70.47 70.47 0.00 0.00 0.00 1.1896 0.0000 2365246.14 2365246.14 0.00% 28216.14 28216.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.59% 56.08 33 79 27890.10 13735 53210 27915.62 23370 32213 1564172 1564172 0.00%
crit 20.41% 14.38 3 30 55699.31 27825 106420 55782.40 39234 80986 801074 801074 0.00%

Action Details: Clawing Shadows

  • id:207311
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207311
  • name:Clawing Shadows
  • school:shadow
  • tooltip:
  • description:Deals {$s2=0} Shadow damage and causes 1 Festering Wound to burst.

Action Priority List

    st
    [n]:70.16
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    st
    [q]:0.31
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Rotten Touch39027610.500
Crit Damage on Debuff Lingering Chill41087910.400
Dark Transformation 0 (209) 0.0% (0.4%) 6.9 46.21s 9055 7182

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.92 0.00 0.00 0.00 0.00 1.2610 0.0000 0.00 0.00 0.00% 7181.88 7181.88

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [T]:5.92
  • if_expr:cooldown.apocalypse.remains<5
    garg_setup
    [d]:1.00
  • if_expr:talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownUnholy Command3169411ADD-15000.000
    Dark Transformation (_damage) 209 0.4% 0.0 0.00s 0 0 Direct 6.9 7530 15047 9055 20.3%

Stats Details: Dark Transformation Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 6.92 0.00 0.00 0.00 0.0000 0.0000 62690.66 62690.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.71% 5.52 1 8 7530.38 6182 11077 7525.11 6459 9566 41556 41556 0.00%
crit 20.29% 1.40 0 6 15046.51 12363 21229 11809.98 0 20757 21135 21135 0.00%

Action Details: Dark Transformation Damage

  • id:344955
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344955
  • name:Dark Transformation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc63560=Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Death and Decay 269 0.5% 8.4 36.51s 9582 8055 Periodic 91.6 733 1466 882 20.3% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.43 0.00 0.00 91.61 0.00 1.1896 0.0000 80779.48 80779.48 0.00% 8054.59 8054.59
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.68% 72.99 34 109 732.75 492 1234 733.55 656 826 53485 53485 0.00%
crit 20.32% 18.62 5 40 1466.29 996 2467 1467.64 1185 1867 27295 27295 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    garg_setup
    [Z]:1.00
  • if_expr:!death_and_decay.ticking&debuff.festering_wound.stack>1
    st
    [m]:7.43
  • if_expr:!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Death Coil 7305 (9458) 12.9% (16.7%) 95.8 3.09s 29575 24470 Direct 95.8 (232.0) 18992 37985 22856 20.3% (20.3%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.83 95.78 0.00 0.00 0.00 1.2086 0.0000 2189231.25 2189231.25 0.00% 24469.79 24469.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.66% 76.30 51 104 18992.05 12367 32578 19002.84 17555 20415 1449032 1449032 0.00%
crit 20.34% 19.49 7 40 37984.70 25191 66080 38007.27 31511 46735 740199 740199 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Details: Death Coil Damage

  • id:47632
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47632
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fire a blast of unholy energy, causing Shadow damage to an enemy target or healing a friendly Undead target.

Action Priority List

    high_prio_actions
    [i]:6.96
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
    st
    [l]:80.95
  • if_expr:!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
    st
    [p]:7.92

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Death Coil3775801PCT0.300
Spell TargetsImproved Death Coil3775802ADD1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Percent Cost Sudden Doom813401-1.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
    Coil of Devastation 2152 3.8% 0.0 0.00s 0 0 Periodic 136.2 4734 0 4734 0.0% 90.8%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 136.25 136.25 81.27 0.0000 2.0000 644957.95 644957.95 0.00% 2366.84 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 136.25 103 171 4733.54 1889 22086 4740.64 4086 5603 644958 644958 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:unknown

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 924 1.6% 6.8 46.62s 40842 0 Direct 6.8 33985 67974 40874 20.3%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.80 6.79 0.00 0.00 0.00 0.0000 0.0000 277620.03 396610.16 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.73% 5.42 0 9 33985.32 33373 35042 33996.24 0 35042 184048 262933 29.99%
crit 20.27% 1.38 0 7 67973.65 66746 70083 52033.57 0 70083 93572 133678 22.96%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1545 2.7% 22.5 13.33s 20646 16978 Direct 22.5 17177 34271 20647 20.3%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.45 22.45 0.00 0.00 0.00 1.2161 0.0000 463557.40 662241.74 30.00% 16978.26 16978.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.70% 17.89 8 28 17176.65 12163 30228 17162.45 15265 19277 307373 439116 30.00%
crit 20.30% 4.56 0 13 34270.67 24325 62335 33967.89 0 52553 156184 223126 29.78%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [e]:1.00
  • if_expr:debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
    st
    [o]:21.45
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack<4
  • target_if_expr:debuff.festering_wound.stack

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Festering Strike3168671PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Festering Wound 2507 4.4% 97.7 3.79s 7696 0 Direct 97.7 6394 12791 7696 20.4%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.65 97.65 0.00 0.00 0.00 0.0000 0.0000 751531.22 751531.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.64% 77.77 50 107 6393.52 4272 11685 6395.04 5903 6857 497234 497234 0.00%
crit 20.36% 19.88 6 39 12790.67 8543 23369 12793.66 10644 16089 254298 254298 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Festering Strike3168671PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Outbreak 86 0.2% 11.6 27.03s 2230 1840 Direct 11.6 1853 3698 2230 20.4%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.2119 0.0000 25923.76 25923.76 0.00% 1840.26 1840.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.55% 9.25 3 14 1852.73 1317 3252 1853.04 1512 2260 17133 17133 0.00%
crit 20.45% 2.38 0 10 3698.13 2638 6503 3431.14 0 6409 8790 8790 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    high_prio_actions
    [j]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Raise Dead 0 (7910) 0.0% (14.0%) 1.0 0.00s 2368203 0

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
    auto_attack 5480  / 5480 9.7% 186.0 1.61s 8820 5483 Direct 186.0 7332 14646 8820 20.3%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 185.98 185.98 0.00 0.00 0.00 1.6086 0.0000 1640416.46 2343511.84 30.00% 5483.26 5483.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 148.14 105 195 7332.13 2482 18960 7341.22 6500 8268 1086164 1551703 30.00%
crit 20.35% 37.85 15 65 14645.52 4964 37920 14667.20 10249 19422 554252 791809 30.00%

Action Details: Auto Attack

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:1.00
    Sweeping Claws 1989  / 1989 3.5% 62.6 4.67s 9506 9471 Direct 62.6 7891 15790 9506 20.4%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.62 62.62 0.00 0.00 0.00 1.0036 0.0000 595241.94 595241.94 0.00% 9471.29 9471.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.55% 49.82 31 68 7890.51 5505 14017 7893.64 7189 8672 393081 393081 0.00%
crit 20.45% 12.80 1 31 15790.39 11010 27657 15795.64 12079 21259 202161 202161 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:62.62
    Claw 440  / 440 0.8% 40.0 7.60s 3305 3293 Direct 40.0 2745 5482 3305 20.5%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.98 39.98 0.00 0.00 0.00 1.0036 0.0000 132132.85 188766.02 30.00% 3293.19 3293.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.53% 31.80 17 48 2744.82 2234 9591 2743.19 2501 2995 87273 124679 30.00%
crit 20.47% 8.18 0 19 5482.18 4468 18883 5478.83 0 7427 44860 64087 29.99%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:39.98
  • if_expr:energy>70
    Gnaw 1  / 1 0.0% 3.7 90.08s 110 110 Direct 3.7 91 182 110 20.8%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0036 0.0000 411.83 588.35 30.00% 109.97 109.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.21% 2.96 0 4 91.46 79 113 91.08 0 109 270 386 29.88%
crit 20.79% 0.78 0 4 182.36 158 225 106.20 0 222 142 202 17.47%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:3.73
Soul Reaper 732 (4123) 1.3% (7.3%) 15.4 6.97s 80546 63699 Direct 15.4 (30.8) 11875 23766 14296 20.4% (20.4%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.38 15.38 0.00 0.00 0.00 1.2645 0.0000 219929.57 219929.57 0.00% 63698.60 63698.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.64% 12.25 4 19 11874.51 7133 18448 11886.85 10266 13617 145476 145476 0.00%
crit 20.36% 3.13 0 11 23765.63 14265 36372 22982.02 0 35849 74453 74453 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [X]:15.38
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370075PCT0.150
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
    Soul Reaper (_execute) 3392 6.0% 15.4 6.97s 66254 0 Direct 15.4 55013 110025 66254 20.4%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.38 15.38 0.00 0.00 0.00 0.0000 0.0000 1019199.32 1019199.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.57% 12.24 5 20 55013.03 42544 84643 55094.94 47860 65080 673334 673334 0.00%
crit 20.43% 3.14 0 11 110025.46 85087 171690 106313.76 0 164481 345866 345866 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370075PCT0.150
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Summon Gargoyle 0 (3053) 0.0% (5.3%) 2.0 185.35s 452265 0

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [S]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead
    garg_setup
    [a]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
    Gargoyle Strike 18091  / 3053 5.3% 27.1 7.85s 33335 21271 Direct 27.1 27686 55298 33334 20.5%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.13 27.13 0.00 0.00 0.00 1.5672 0.0000 904530.20 904530.20 0.00% 21270.55 21270.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.54% 21.58 12 28 27686.16 8081 61637 27684.53 22492 33774 597580 597580 0.00%
crit 20.46% 5.55 0 14 55297.70 16161 123273 55120.51 0 103574 306950 306950 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.
Unholy Assault 393 0.7% 3.6 91.81s 32436 28568 Direct 3.6 26876 53939 32435 20.5%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.63 3.63 0.00 0.00 0.00 1.1356 0.0000 117755.78 117755.78 0.00% 28567.63 28567.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.46% 2.88 0 4 26875.76 20686 36264 26765.90 0 36264 77525 77525 0.00%
crit 20.54% 0.75 0 4 53939.47 41190 72527 30408.06 0 72527 40231 40231 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Damage increased by {$s4=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing all damage done by {$s4=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [W]:3.36
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [c]:0.27
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Virulent Plague 1268 2.2% 11.6 27.03s 32727 0 Periodic 99.5 3177 6353 3824 20.4% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.50 99.50 10.62 0.0000 3.0000 380443.53 380443.53 0.00% 1274.54 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.63% 79.23 49 108 3176.61 2330 6069 3176.89 3008 3360 251686 251686 0.00%
crit 20.37% 20.27 7 38 6352.99 4378 12139 6353.94 5453 7694 128758 128758 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.172500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Tick Time Plaguebringer3901781-0.500Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 164
Anti-Magic Shell 164 99.9% 6.9 45.41s 7061 0 Direct 3.1 15824 0 15824 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.95 3.10 0.00 0.00 0.00 0.0000 0.0000 49056.40 49056.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.10 0 15 15823.90 15824 15824 13433.11 0 15824 49056 49056 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [f]:6.95
  • if_expr:runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownAnti-Magic Barrier2057271ADD-20000.000
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Algeth'ar Puzzle (_box_channel) 2.0 182.56s

Stats Details: Algethar Puzzle Box Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 2.00 0.00 0.00 1.5530 1.5530 0.00 0.00 0.00% 0.00 0.00

Action Details: Algethar Puzzle Box Channel

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 184.98s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [k]:2.00
  • if_expr:(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
Empower Rune Weapon 2.4 168.68s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.38 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [V]:2.11
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
    garg_setup
    [b]:0.27
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929621SET1.000
Festering Wound (_application) 101.5 5.28s

Stats Details: Festering Wound Application

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 101.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Festering Wound Application

  • id:197147
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:197147
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:Festering Strike applies a pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$195757s1=3} Runic Power. Stacks up to {$194310u=6} times on any target.
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382154
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Outbreak (_aoe) 11.6 27.03s

Stats Details: Outbreak Aoe

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Outbreak Aoe

  • id:196780
  • school:shadow
  • range:200.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196780
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:{$@spelldesc77575=Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}}
Elemental Potion of Ultimate Power 1.5 302.74s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    high_prio_actions
    [g]:1.45
  • if_expr:(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Unholy Strength 20.7 14.14s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.72 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 183.0s 183.0s 30.0s 20.27% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1411.05

Trigger Details

  • interval_min/max:181.8s / 185.7s
  • trigger_min/max:181.8s / 185.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s
  • uptime_min/max:16.67% / 25.00%

Stack Uptimes

  • algethar_puzzle_1:20.27%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Anti-Magic Shell 6.9 0.0 45.5s 45.5s 6.9s 16.07% 18.33% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.40
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 120.7s
  • trigger_min/max:40.0s / 120.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:11.46% / 17.67%

Stack Uptimes

  • antimagic_shell_1:16.07%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Berserking 2.0 0.0 185.0s 185.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.4s / 192.9s
  • trigger_min/max:181.4s / 192.9s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Commander of the Dead 6.9 0.0 46.2s 46.2s 28.5s 65.82% 86.65% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 57.4s
  • trigger_min/max:45.0s / 57.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:61.11% / 68.63%

Stack Uptimes

  • commander_of_the_dead_1:65.82%

Spelldata

  • id:390260
  • name:Commander of the Dead
  • tooltip:Your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead ghouls deal {$390264s1=35}% increased damage.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.3s 58.9s 50.2s 80.21% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 350.0s
  • trigger_min/max:15.0s / 312.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 353.1s
  • uptime_min/max:48.83% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.21%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Transformation 6.9 0.0 46.2s 46.2s 21.8s 50.40% 54.84% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 57.4s
  • trigger_min/max:45.0s / 57.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.0s
  • uptime_min/max:45.18% / 55.77%

Stack Uptimes

  • dark_transformation_1:50.40%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Dragon Games Equipment 2.7 0.0 120.0s 120.0s 0.7s 0.68% 0.00% 6.8 (6.8) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.73
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.1s
  • trigger_min/max:120.0s / 120.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s
  • uptime_min/max:0.54% / 0.84%

Stack Uptimes

  • dragon_games_equipment_1:0.68%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.8s 302.8s 27.4s 13.01% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.5s
  • trigger_min/max:300.0s / 325.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.80% / 17.89%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.01%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 168.7s 168.7s 19.3s 15.26% 0.00% 6.9 (6.9) 2.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 198.8s
  • trigger_min/max:120.0s / 198.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:12.34% / 18.14%

Stack Uptimes

  • empower_rune_weapon_1:15.26%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Festermight 13.0 64.3 23.4s 3.8s 19.2s 83.40% 0.00% 0.0 (0.0) 12.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 46.5s
  • trigger_min/max:0.8s / 27.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:72.20% / 91.15%

Stack Uptimes

  • festermight_1:7.69%
  • festermight_2:8.09%
  • festermight_3:8.41%
  • festermight_4:16.16%
  • festermight_5:11.04%
  • festermight_6:9.96%
  • festermight_7:7.92%
  • festermight_8:5.62%
  • festermight_9:3.88%
  • festermight_10:2.02%
  • festermight_11:0.86%
  • festermight_12:0.62%
  • festermight_13:0.58%
  • festermight_14:0.42%
  • festermight_15:0.12%
  • festermight_16:0.01%
  • festermight_17:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 94.8 176.8s 3.1s 292.2s 98.18% 0.00% 92.8 (92.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:49.2s / 326.4s
  • trigger_min/max:0.8s / 16.4s
  • trigger_pct:100.00%
  • duration_min/max:4.2s / 354.6s
  • uptime_min/max:95.18% / 98.52%

Stack Uptimes

  • icy_talons_1:0.33%
  • icy_talons_2:0.34%
  • icy_talons_3:97.51%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 11.9 7.8 25.0s 14.7s 10.6s 41.82% 0.00% 7.8 (7.8) 11.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 169.0s
  • trigger_min/max:0.8s / 154.9s
  • trigger_pct:15.06%
  • duration_min/max:0.0s / 56.9s
  • uptime_min/max:15.47% / 74.11%

Stack Uptimes

  • rune_mastery_1:41.82%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 39.3 6.6 7.5s 6.4s 2.8s 36.72% 0.00% 6.6 (6.6) 38.9

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 70.7s
  • trigger_min/max:0.8s / 70.7s
  • trigger_pct:47.94%
  • duration_min/max:0.0s / 23.3s
  • uptime_min/max:20.95% / 50.85%

Stack Uptimes

  • runic_corruption_1:36.72%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 19.6 0.7 15.0s 14.4s 1.5s 9.49% 0.00% 0.7 (0.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.6s / 55.1s
  • trigger_min/max:1.6s / 55.1s
  • trigger_pct:14.17%
  • duration_min/max:0.0s / 9.5s
  • uptime_min/max:1.88% / 21.84%

Stack Uptimes

  • sudden_doom_1:9.49%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.6 0.0 91.8s 91.8s 19.5s 23.63% 28.78% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.6s
  • trigger_min/max:90.0s / 98.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.84% / 26.69%

Stack Uptimes

  • unholy_assault_1:23.63%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Damage increased by {$s4=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing all damage done by {$s4=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Ground 8.4 0.0 36.5s 36.5s 9.9s 27.76% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 134.3s
  • trigger_min/max:10.0s / 134.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.9s
  • uptime_min/max:18.58% / 36.81%

Stack Uptimes

  • unholy_ground_1:27.76%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 12.2 35.8s 14.1s 23.9s 67.71% 0.00% 12.2 (12.2) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 169.4s
  • trigger_min/max:0.0s / 58.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 166.2s
  • uptime_min/max:44.37% / 91.52%

Stack Uptimes

  • unholy_strength_1:67.71%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 184.4s 184.4s 24.5s 98.06% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.4s / 199.1s
  • trigger_min/max:180.4s / 199.1s
  • trigger_pct:100.00%
  • duration_min/max:21.0s / 25.0s
  • uptime_min/max:90.14% / 98.07%

Stack Uptimes

  • dark_empowerment_1:98.06%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (sizzling_seafood_medley)

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sizzling_seafood_medley
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382154
  • name:Well Fed
  • tooltip:Haste and mastery increased by {$=}w1.
  • description:Increases Haste and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 24.5 8.0 47.0 11.9s 1.6s 111.3s
Rune ready 150.0 112.0 187.0 2.1s 0.0s 13.9s
Runic Corruption from Runic Power Spent 46.0 24.0 70.0 6.4s 0.8s 70.7s
Festering Wound from Festering Strike 56.2 34.0 78.0 13.3s 1.1s 88.5s
Festering Wound from Infected Claws 30.8 13.0 55.0 9.6s 1.0s 111.1s
Festering Wound from Unholy Assault 14.5 12.0 16.0 91.8s 90.0s 98.6s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.13% 0.00% 10.62% 1.5s 0.0s 11.5s
ghoul - Energy Cap 0.44% 0.03% 1.28% 0.2s 0.0s 1.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Raise Dead0.0000.0000.000300.000240.008359.984
Army of the Dead4.7250.000138.5549.4520.000138.554
Summon Gargoyle4.8761.37720.1049.7525.72924.504
Apocalypse2.4010.00014.78416.4779.80733.252
Unholy Assault3.8970.00010.20914.1518.27123.050
Dark Transformation1.6650.00012.42211.5465.84425.538
Empower Rune Weapon32.1880.00078.81176.70768.964100.845
Death and Decay6.6530.00083.04360.5745.515156.221
Soul Reaper13.3460.000233.491207.775157.789257.472
Anti-Magic Shell5.7760.00080.66340.71526.893119.312

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=342283)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1282.088 / 1.3216.34723.714
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
36.37262.89095.293 / 93.489132.912188.978

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
Anti-Magic ShellRunic Power3.1015.370.66%4.960.130.87%
ApocalypseRune13.5912.018.01%0.881.5811.62%
Empower Rune WeaponRunic Power11.4255.442.39%4.851.662.90%
Empower Rune WeaponRune11.4210.356.90%0.911.079.34%
Festering WoundRunic Power97.65290.5712.55%2.982.390.81%
Rune RegenerationRune127.65127.6585.09%1.000.000.00%
Runic AttenuationRunic Power71.63348.4915.05%4.879.652.69%
Army of the DeadRunic Power2.0019.730.85%9.870.271.34%
Clawing ShadowsRunic Power70.47704.6530.44%10.000.000.00%
Death and DecayRunic Power8.4384.313.64%10.000.000.00%
Festering StrikeRunic Power22.45449.0419.40%20.000.000.00%
OutbreakRunic Power11.62112.414.86%9.673.833.30%
Soul ReaperRunic Power15.38147.356.37%9.586.494.22%
Summon GargoyleRunic Power2.0087.393.78%43.7012.6112.61%
pet - ghoul
Dark TransformationEnergy6.92337.498.36%48.75354.8151.25%
Energy RegenEnergy1349.103697.9691.64%2.7431.270.84%
pet - army_ghoul
Energy RegenEnergy834.176813.55100.00%8.17535.517.29%
pet - apoc_ghoul
Energy RegenEnergy670.995223.66100.00%7.791548.9722.87%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.31%1.001.00914013.23
Clawing ShadowsRune 70.4770.4746.11%1.001.0033566.13
Death and DecayRune 8.438.435.52%1.001.009581.39
Death CoilRunic Power 95.832289.61100.00%23.8923.891237.85
Festering StrikeRune 22.4544.9029.39%2.002.0010323.20
OutbreakRune 11.6211.627.61%1.001.002230.06
Soul ReaperRune 15.3815.3810.07%1.001.0080546.87
pet - ghoul
ClawEnergy 39.981599.0938.97%40.0040.0082.63
Sweeping ClawsEnergy 62.622504.8261.03%40.0040.00237.64
pet - army_ghoul
ClawEnergy 203.978158.98100.00%40.0040.0026.82
pet - apoc_ghoul
ClawEnergy 188.637545.04100.00%40.0040.0039.41
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 327940.0 758.85 875.90 261662.5 292824.9 -5355.1 327940.0
Runic Power 8.0 7.72 7.64 37.0 23.2 0.0 75.0
Rune 5.0 0.50 0.51 0.0 3.2 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 56733.58
Minimum 49073.61
Maximum 65183.71
Spread ( max - min ) 16110.10
Range [ ( max - min ) / 2 * 100% ] 14.20%
Standard Deviation 1969.1397
5th Percentile 53773.50
95th Percentile 60252.97
( 95th Percentile - 5th Percentile ) 6479.47
Mean Distribution
Standard Deviation 22.7392
95.00% Confidence Interval ( 56689.01 - 56778.15 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4628
0.1 Scale Factor Error with Delta=300 33101
0.05 Scale Factor Error with Delta=300 132403
0.01 Scale Factor Error with Delta=300 3310067
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 56733.58
Minimum 49073.61
Maximum 65183.71
Spread ( max - min ) 16110.10
Range [ ( max - min ) / 2 * 100% ] 14.20%
Standard Deviation 1969.1397
5th Percentile 53773.50
95th Percentile 60252.97
( 95th Percentile - 5th Percentile ) 6479.47
Mean Distribution
Standard Deviation 22.7392
95.00% Confidence Interval ( 56689.01 - 56778.15 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4628
0.1 Scale Factor Error with Delta=300 33101
0.05 Scale Factor Error with Delta=300 132403
0.01 Scale Factor Error with Delta=300 3310067
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 56733.58
Minimum 49073.61
Maximum 65183.71
Spread ( max - min ) 16110.10
Range [ ( max - min ) / 2 * 100% ] 14.20%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 9510640.09
Minimum 7147339.75
Maximum 12120695.39
Spread ( max - min ) 4973355.64
Range [ ( max - min ) / 2 * 100% ] 26.15%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 875.16
Minimum 0.00
Maximum 2295.65
Spread ( max - min ) 2295.65
Range [ ( max - min ) / 2 * 100% ] 131.16%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 756.85
Minimum 0.00
Maximum 1860.48
Spread ( max - min ) 1860.48
Range [ ( max - min ) / 2 * 100% ] 122.91%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2,if=!equipped.fyralath_the_dreamrender|raid_event.adds.exists
6 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
7 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
A 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
B 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
E 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
F 0.00 variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
Default action list Executed every time the actor is available.
# count action,conditions
G 1.00 auto_attack
H 0.00 call_action_list,name=variables
Call Action Lists
I 0.00 call_action_list,name=high_prio_actions
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=racials
L 0.00 run_action_list,name=garg_setup,if=variable.garg_setup_complete=0
M 0.00 call_action_list,name=cooldowns,if=variable.st_planning
N 0.00 call_action_list,name=aoe_cooldowns,if=variable.adds_remain
O 0.00 call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
P 0.00 call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
Q 0.00 call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
R 0.00 call_action_list,name=st,if=active_enemies<=3
actions.cooldowns
# count action,conditions
S 1.00 summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
ST/Cleave Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
T 5.92 dark_transformation,if=cooldown.apocalypse.remains<5
U 5.80 apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
V 2.11 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 abomination_limb,if=rune<3&variable.st_planning
W 3.36 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
X 15.38 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.garg_setup
# count action,conditions
Y 1.00 apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)
Garg Setup
0.00 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
Z 1.00 any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>1
a 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
b 0.27 empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=23
c 0.27 unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=23
d 1.00 dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
e 1.00 festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
0.00 death_coil,if=rune<=1
actions.high_prio_actions
# count action,conditions
0.00 mind_freeze,if=target.debuff.casting.react
Priority Actions
f 6.95 antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
0.00 antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle))
0.00 antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
0.00 invoke_external_buff,name=power_infusion,if=(variable.st_planning|variable.adds_remain)&(pet.gargoyle.active&pet.gargoyle.remains<=22|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.army_ghoul.remains<=18|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+10>cooldown.invoke_external_buff_power_infusion.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
g 1.45 potion,if=(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
0.00 any_dnd,if=variable.adds_remain&!death_and_decay.ticking&!talent.bursting_sores&talent.defile&buff.defile.remains<gcd
h 1.00 army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<3*gcd|!talent.summon_gargoyle|fight_remains<35
i 6.96 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|cooldown.unholy_assault.ready|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains|!talent.summon_gargoyle)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
j 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd&time>15|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration+3
k 2.00 berserking,if=(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(18>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=18|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|active_enemies>=2&death_and_decay.ticking)|fight_remains<=18
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration+3
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.st
# count action,conditions
l 80.95 death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
Single Target
0.00 epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
m 7.43 any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)
n 70.16 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
o 21.45 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4
p 7.92 death_coil
q 0.31 wound_spender,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack>=4
actions.trinkets
# count action,conditions
0.00 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&(active_enemies<5|active_enemies>21|fight_remains<4)&(debuff.festering_wound.stack>=2|time>15)
Trinkets
r 2.00 use_item,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<16|!talent.summon_gargoyle&pet.army_ghoul.active&pet.army_ghoul.remains<16)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(variable.damage_trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
s 2.73 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(variable.damage_trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGjreZdagiifiYVWlnnnkmlnnlnnljllonlnlnolnllnsnlolnnllolnlofjlTmqUlnlonlnnolllnnjlnlnnlopnnfpnpollTomUjWilnlnnnlnnlollnnnnjpfnlloloTlmUnlnolslnjnnollnnlnpnlppoppnnjrhTiSiifVXWUmllXknlnnlXmlljoXlnlnXllnlXnlolXnfonTjiUXlllmXlnnnXlolnljXlnlnXfpsnpXloTpWUXmljlXlnlnnl

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 4 raise_dead PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 5 army_of_the_dead PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 6 trinket_1_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat 7 trinket_2_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat A trinket_1_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat B trinket_2_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat E trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat F damage_trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
0:00.000 default G auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
0:00.000 high_prio_actions j outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, corrupting_rage
0:01.016 trinkets r use_item_algethar_puzzle_box Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, corrupting_rage
0:02.366 garg_setup e festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, algethar_puzzle, corrupting_rage
0:03.382 garg_setup Z death_and_decay Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune
bloodlust, algethar_puzzle, corrupting_rage
0:04.398 garg_setup d dark_transformation PR_Death_Knight_Unholy 53.0/100: 53% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_ground, algethar_puzzle, corrupting_rage
0:04.398 garg_setup a summon_gargoyle PR_Death_Knight_Unholy 53.0/100: 53% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:05.365 high_prio_actions g potion Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:05.365 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.332 high_prio_actions i death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_ground, icy_talons, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.299 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 40.0/100: 40% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(2), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.299 high_prio_actions i death_coil Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, rune_mastery, unholy_ground, icy_talons(2), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:08.267 garg_setup Y apocalypse Fluffy_Pillow 10.0/100: 10% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.234 cooldowns V empower_rune_weapon PR_Death_Knight_Unholy 27.0/100: 27% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.234 cooldowns W unholy_assault Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:10.077 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:10.919 st n clawing_shadows Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:11.761 st n clawing_shadows Fluffy_Pillow 45.0/100: 45% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:12.604 st n clawing_shadows Fluffy_Pillow 58.0/100: 58% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.446 racials k berserking PR_Death_Knight_Unholy 71.0/100: 71% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.446 st m death_and_decay Fluffy_Pillow 71.0/100: 71% runic_power
3.0/6: 50% rune
bloodlust, berserking, antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:14.250 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
3.0/6: 50% rune
bloodlust, berserking, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:15.016 st n clawing_shadows Fluffy_Pillow 61.0/100: 61% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:15.782 st n clawing_shadows Fluffy_Pillow 79.0/100: 79% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:16.548 st l death_coil Fluffy_Pillow 92.0/100: 92% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:17.314 st n clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:18.079 st n clawing_shadows Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:18.843 st l death_coil Fluffy_Pillow 98.0/100: 98% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:19.609 high_prio_actions j outbreak Fluffy_Pillow 73.0/100: 73% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:20.375 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:21.141 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:21.907 st o festering_strike Fluffy_Pillow 58.0/100: 58% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:22.673 st n clawing_shadows Fluffy_Pillow 78.0/100: 78% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:23.439 st l death_coil Fluffy_Pillow 96.0/100: 96% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:24.205 st n clawing_shadows Fluffy_Pillow 66.0/100: 66% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:25.009 st l death_coil Fluffy_Pillow 89.0/100: 89% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:25.813 st n clawing_shadows Fluffy_Pillow 59.0/100: 59% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:26.698 st o festering_strike Fluffy_Pillow 72.0/100: 72% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:27.582 st l death_coil Fluffy_Pillow 97.0/100: 97% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:28.465 st n clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:29.350 st l death_coil Fluffy_Pillow 85.0/100: 85% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:30.366 st l death_coil Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:31.383 st n clawing_shadows Fluffy_Pillow 60.0/100: 60% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:32.368 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 73.0/100: 73% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(2), commander_of_the_dead, corrupting_rage, elemental_potion_of_ultimate_power
0:32.400 st n clawing_shadows Fluffy_Pillow 73.0/100: 73% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(2), commander_of_the_dead, dragon_games_equipment, corrupting_rage, elemental_potion_of_ultimate_power
0:33.415 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(3), commander_of_the_dead, corrupting_rage, elemental_potion_of_ultimate_power
0:34.431 st o festering_strike Fluffy_Pillow 61.0/100: 61% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage, elemental_potion_of_ultimate_power
0:35.448 st l death_coil Fluffy_Pillow 86.0/100: 86% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(3)
0:36.465 st n clawing_shadows Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), runic_corruption, festermight(3)
0:37.482 st n clawing_shadows Fluffy_Pillow 69.0/100: 69% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), festermight(4)
0:38.499 st l death_coil Fluffy_Pillow 82.0/100: 82% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), festermight(5)
0:39.516 st l death_coil Fluffy_Pillow 52.0/100: 52% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), runic_corruption, festermight(5)
0:40.532 st o festering_strike Fluffy_Pillow 22.0/100: 22% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), festermight(5)
0:41.853 st l death_coil Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(5)
0:43.174 st n clawing_shadows Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(5)
0:44.495 st l death_coil Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(6)
0:45.815 st o festering_strike Fluffy_Pillow 0.0/100: 0% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(6)
0:47.136 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 20.0/100: 20% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(6)
0:47.299 high_prio_actions j outbreak Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(6)
0:48.620 st l death_coil Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3)
0:49.941 cooldowns T dark_transformation PR_Death_Knight_Unholy 5.0/100: 5% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption
0:51.261 st m death_and_decay Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:52.582 st q clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:53.840 cooldowns U apocalypse Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, corrupting_rage
0:55.098 st l death_coil Fluffy_Pillow 55.0/100: 55% runic_power
6.0/6: 100% rune
unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
0:56.356 st n clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune
unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
0:57.614 st l death_coil Fluffy_Pillow 43.0/100: 43% runic_power
5.0/6: 83% rune
unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, corrupting_rage
0:58.872 st o festering_strike Fluffy_Pillow 43.0/100: 43% runic_power
5.0/6: 83% rune
unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
1:00.130 st n clawing_shadows Fluffy_Pillow 68.0/100: 68% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:01.388 st l death_coil Fluffy_Pillow 81.0/100: 81% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
1:02.709 st n clawing_shadows Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead, corrupting_rage
1:04.030 st n clawing_shadows Fluffy_Pillow 64.0/100: 64% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, corrupting_rage
1:05.351 st o festering_strike Fluffy_Pillow 77.0/100: 77% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, corrupting_rage
1:06.671 st l death_coil Fluffy_Pillow 97.0/100: 97% runic_power
1.0/6: 17% rune
icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, corrupting_rage
1:07.992 st l death_coil Fluffy_Pillow 72.0/100: 72% runic_power
1.0/6: 17% rune
icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, corrupting_rage
1:09.313 st l death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, corrupting_rage
1:10.633 st n clawing_shadows Fluffy_Pillow 12.0/100: 12% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, runic_corruption, festermight(9), commander_of_the_dead, corrupting_rage
1:11.953 st n clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(10), commander_of_the_dead, corrupting_rage
1:13.273 high_prio_actions j outbreak Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), commander_of_the_dead, corrupting_rage
1:14.592 st l death_coil Fluffy_Pillow 48.0/100: 48% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), commander_of_the_dead, corrupting_rage
1:15.912 st n clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), runic_corruption, commander_of_the_dead, corrupting_rage
1:17.232 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
1:18.553 st n clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
1:19.874 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(2), commander_of_the_dead, corrupting_rage
1:21.195 st l death_coil Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(3), corrupting_rage
1:22.516 st o festering_strike Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
1:23.837 st p death_coil Fluffy_Pillow 62.0/100: 62% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
1:25.156 st n clawing_shadows Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
1:26.477 st n clawing_shadows Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
1:27.797 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 58.0/100: 58% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(5), corrupting_rage
1:27.797 st p death_coil Fluffy_Pillow 58.0/100: 58% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
1:29.117 st n clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
1:30.438 st p death_coil Fluffy_Pillow 41.0/100: 41% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
1:31.758 st o festering_strike Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(6), corrupting_rage
1:33.079 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
1:34.400 st l death_coil Fluffy_Pillow 11.0/100: 11% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(6), corrupting_rage
1:35.721 cooldowns T dark_transformation PR_Death_Knight_Unholy 11.0/100: 11% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
1:37.042 st o festering_strike Fluffy_Pillow 16.0/100: 16% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
1:38.363 st m death_and_decay Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
1:39.683 cooldowns U apocalypse Fluffy_Pillow 51.0/100: 51% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
1:40.941 high_prio_actions j outbreak Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
1:42.199 cooldowns W unholy_assault Fluffy_Pillow 73.0/100: 73% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
1:43.457 high_prio_actions i death_coil Fluffy_Pillow 73.0/100: 73% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:44.715 st l death_coil Fluffy_Pillow 43.0/100: 43% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:45.972 st n clawing_shadows Fluffy_Pillow 13.0/100: 13% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:47.230 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
1:48.488 st n clawing_shadows Fluffy_Pillow 1.0/100: 1% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
1:49.809 st n clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
1:51.130 st n clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:52.450 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, corrupting_rage
1:53.770 st n clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, corrupting_rage
1:55.091 st n clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), unholy_assault, festermight(9), commander_of_the_dead, corrupting_rage
1:56.412 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), unholy_assault, festermight(10), commander_of_the_dead, corrupting_rage
1:57.732 st o festering_strike Fluffy_Pillow 11.0/100: 11% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, unholy_assault, festermight(10), commander_of_the_dead, corrupting_rage
1:59.052 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(10), commander_of_the_dead, corrupting_rage
2:00.372 st l death_coil Fluffy_Pillow 6.0/100: 6% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, unholy_assault, commander_of_the_dead, corrupting_rage
2:01.692 st n clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, commander_of_the_dead, corrupting_rage
2:03.013 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
2:04.334 st n clawing_shadows Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), commander_of_the_dead, corrupting_rage
2:05.655 st n clawing_shadows Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), commander_of_the_dead, corrupting_rage
2:06.976 high_prio_actions j outbreak Fluffy_Pillow 58.0/100: 58% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(4), corrupting_rage
2:08.297 st p death_coil Fluffy_Pillow 68.0/100: 68% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), festermight(4), corrupting_rage
2:09.618 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 43.0/100: 43% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(4)
2:09.618 st n clawing_shadows Fluffy_Pillow 43.0/100: 43% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, icy_talons(3), festermight(4)
2:10.938 st l death_coil Fluffy_Pillow 56.0/100: 56% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, icy_talons(3), festermight(5)
2:12.259 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, icy_talons(3), festermight(5)
2:13.580 Waiting     2.167s 6.0/100: 6% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), festermight(5)
2:15.747 st o festering_strike Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), festermight(5)
2:17.068 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
0.0/6: 0% rune
icy_talons(3), festermight(5)
2:18.388 Waiting     0.807s 11.0/100: 11% runic_power
1.0/6: 17% rune
icy_talons(3), runic_corruption, festermight(5)
2:19.195 st o festering_strike Fluffy_Pillow 11.0/100: 11% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, festermight(5)
2:20.516 cooldowns T dark_transformation PR_Death_Knight_Unholy 31.0/100: 31% runic_power
0.0/6: 0% rune
icy_talons(3), festermight(5)
2:22.041 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead
2:23.361 st m death_and_decay Fluffy_Pillow 1.0/100: 1% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead
2:24.682 cooldowns U apocalypse Fluffy_Pillow 16.0/100: 16% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
2:25.941 st n clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
2:27.197 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:28.455 st n clawing_shadows Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(5), commander_of_the_dead, corrupting_rage
2:29.711 st o festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:30.969 st l death_coil Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:32.227 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, festermight(6), commander_of_the_dead, corrupting_rage
2:32.368 st l death_coil Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, festermight(6), commander_of_the_dead, dragon_games_equipment, corrupting_rage
2:33.625 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
2:34.946 high_prio_actions j outbreak Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead, corrupting_rage
2:36.266 st n clawing_shadows Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
2:37.587 st n clawing_shadows Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(8), commander_of_the_dead, corrupting_rage
2:38.908 st o festering_strike Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(9), commander_of_the_dead, corrupting_rage
2:40.228 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(9), commander_of_the_dead, corrupting_rage
2:41.549 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead, corrupting_rage
2:42.870 st n clawing_shadows Fluffy_Pillow 63.0/100: 63% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead, corrupting_rage
2:44.191 st n clawing_shadows Fluffy_Pillow 76.0/100: 76% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(10), commander_of_the_dead, corrupting_rage
2:45.511 st l death_coil Fluffy_Pillow 94.0/100: 94% runic_power
1.0/6: 17% rune
icy_talons(3), commander_of_the_dead, corrupting_rage
2:46.832 st n clawing_shadows Fluffy_Pillow 64.0/100: 64% runic_power
1.0/6: 17% rune
icy_talons(3), commander_of_the_dead, corrupting_rage
2:48.153 st p death_coil Fluffy_Pillow 77.0/100: 77% runic_power
0.0/6: 0% rune
icy_talons(3), sudden_doom, festermight, commander_of_the_dead, corrupting_rage
2:49.474 st n clawing_shadows Fluffy_Pillow 77.0/100: 77% runic_power
1.0/6: 17% rune
icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
2:50.795 st l death_coil Fluffy_Pillow 95.0/100: 95% runic_power
0.0/6: 0% rune
icy_talons(3), festermight(2), corrupting_rage
2:52.113 st p death_coil Fluffy_Pillow 65.0/100: 65% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(2), corrupting_rage
2:53.433 st p death_coil Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(2), corrupting_rage
2:54.753 st o festering_strike Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(2), corrupting_rage
2:56.074 st p death_coil Fluffy_Pillow 30.0/100: 30% runic_power
0.0/6: 0% rune
icy_talons(3), sudden_doom, festermight(2), corrupting_rage
2:57.395 st p death_coil Fluffy_Pillow 30.0/100: 30% runic_power
0.0/6: 0% rune
icy_talons(3), festermight(2), corrupting_rage
2:58.716 st n clawing_shadows Fluffy_Pillow 0.0/100: 0% runic_power
1.0/6: 17% rune
icy_talons(3), runic_corruption, festermight(2), corrupting_rage
3:00.037 st n clawing_shadows Fluffy_Pillow 18.0/100: 18% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(3), corrupting_rage
3:01.358 high_prio_actions j outbreak Fluffy_Pillow 31.0/100: 31% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(4), corrupting_rage
3:02.679 trinkets r use_item_algethar_puzzle_box Fluffy_Pillow 46.0/100: 46% runic_power
0.0/6: 0% rune
icy_talons(3), festermight(4), corrupting_rage
3:04.435 high_prio_actions h army_of_the_dead PR_Death_Knight_Unholy 46.0/100: 46% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(4), algethar_puzzle, corrupting_rage
3:05.755 cooldowns T dark_transformation PR_Death_Knight_Unholy 56.0/100: 56% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(4), algethar_puzzle, corrupting_rage
3:07.076 high_prio_actions i death_coil Fluffy_Pillow 61.0/100: 61% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:08.395 cooldowns S summon_gargoyle PR_Death_Knight_Unholy 61.0/100: 61% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:08.395 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:09.716 high_prio_actions i death_coil Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:11.036 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 45.0/100: 45% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:11.036 cooldowns V empower_rune_weapon PR_Death_Knight_Unholy 45.0/100: 45% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:11.036 cooldowns X soul_reaper Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:12.185 cooldowns W unholy_assault Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:13.348 cooldowns U apocalypse Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:14.495 st m death_and_decay Fluffy_Pillow 72.0/100: 72% runic_power
6.0/6: 100% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:15.644 st l death_coil Fluffy_Pillow 82.0/100: 82% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:16.737 st l death_coil Fluffy_Pillow 92.0/100: 92% runic_power
6.0/6: 100% rune
antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:17.831 cooldowns X soul_reaper Fluffy_Pillow 62.0/100: 62% runic_power
6.0/6: 100% rune
antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:18.925 racials k berserking PR_Death_Knight_Unholy 72.0/100: 72% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:18.925 st n clawing_shadows Fluffy_Pillow 72.0/100: 72% runic_power
5.0/6: 83% rune
berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:19.919 st l death_coil Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:20.914 st n clawing_shadows Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:21.909 st n clawing_shadows Fluffy_Pillow 73.0/100: 73% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:22.904 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:23.899 cooldowns X soul_reaper Fluffy_Pillow 61.0/100: 61% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:24.894 st m death_and_decay Fluffy_Pillow 76.0/100: 76% runic_power
2.0/6: 33% rune
berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:25.939 st l death_coil Fluffy_Pillow 86.0/100: 86% runic_power
2.0/6: 33% rune
berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:26.934 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:27.929 high_prio_actions j outbreak Fluffy_Pillow 61.0/100: 61% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:28.924 st o festering_strike Fluffy_Pillow 76.0/100: 76% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:29.919 cooldowns X soul_reaper Fluffy_Pillow 96.0/100: 96% runic_power
2.0/6: 33% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:30.913 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:31.907 st n clawing_shadows Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), runic_corruption, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:33.165 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:34.422 st n clawing_shadows Fluffy_Pillow 58.0/100: 58% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:35.680 cooldowns X soul_reaper Fluffy_Pillow 71.0/100: 71% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
3:37.240 st l death_coil Fluffy_Pillow 81.0/100: 81% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight, corrupting_rage
3:38.561 st l death_coil Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight, corrupting_rage
3:39.881 st n clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), festermight, corrupting_rage
3:41.202 st l death_coil Fluffy_Pillow 39.0/100: 39% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(2), corrupting_rage
3:42.523 cooldowns X soul_reaper Fluffy_Pillow 14.0/100: 14% runic_power
4.0/6: 67% rune
icy_talons(3), festermight(2), corrupting_rage
3:43.844 st n clawing_shadows Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(2), corrupting_rage
3:45.165 st l death_coil Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(3), corrupting_rage
3:46.486 st o festering_strike Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
3:47.807 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), sudden_doom, festermight(3), corrupting_rage
3:49.127 cooldowns X soul_reaper Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
3:50.447 st n clawing_shadows Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(3), corrupting_rage
3:51.768 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 55.0/100: 55% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(4), corrupting_rage
3:51.768 st o festering_strike Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, icy_talons(3), festermight(4), corrupting_rage
3:53.087 st n clawing_shadows Fluffy_Pillow 80.0/100: 80% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:54.408 cooldowns T dark_transformation PR_Death_Knight_Unholy 93.0/100: 93% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
3:55.729 high_prio_actions j outbreak Fluffy_Pillow 93.0/100: 93% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:57.050 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:58.370 cooldowns U apocalypse Fluffy_Pillow 75.0/100: 75% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:59.691 cooldowns X soul_reaper Fluffy_Pillow 87.0/100: 87% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:01.011 st l death_coil Fluffy_Pillow 97.0/100: 97% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:02.331 st l death_coil Fluffy_Pillow 67.0/100: 67% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead, corrupting_rage
4:03.652 st l death_coil Fluffy_Pillow 37.0/100: 37% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:04.973 st m death_and_decay Fluffy_Pillow 7.0/100: 7% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:06.294 cooldowns X soul_reaper Fluffy_Pillow 22.0/100: 22% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:07.552 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:08.809 st n clawing_shadows Fluffy_Pillow 2.0/100: 2% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:10.067 st n clawing_shadows Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:11.324 st n clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
4:12.582 cooldowns X soul_reaper Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
4:13.840 st l death_coil Fluffy_Pillow 56.0/100: 56% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
4:15.098 st o festering_strike Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
4:16.419 st l death_coil Fluffy_Pillow 46.0/100: 46% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), commander_of_the_dead, corrupting_rage
4:17.740 st n clawing_shadows Fluffy_Pillow 16.0/100: 16% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), commander_of_the_dead, corrupting_rage
4:19.061 st l death_coil Fluffy_Pillow 34.0/100: 34% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
4:20.382 Waiting     1.659s 4.0/100: 4% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
4:22.041 high_prio_actions j outbreak Fluffy_Pillow 9.0/100: 9% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
4:23.361 Waiting     0.097s 19.0/100: 19% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
4:23.458 cooldowns X soul_reaper Fluffy_Pillow 19.0/100: 19% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
4:24.779 st l death_coil Fluffy_Pillow 34.0/100: 34% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), corrupting_rage
4:26.100 st n clawing_shadows Fluffy_Pillow 4.0/100: 4% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), corrupting_rage
4:27.421 st l death_coil Fluffy_Pillow 17.0/100: 17% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight, corrupting_rage
4:28.741 Waiting     0.388s 17.0/100: 17% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, corrupting_rage
4:29.129 st n clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, corrupting_rage
4:30.449 cooldowns X soul_reaper Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
4:31.769 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 50.0/100: 50% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
4:31.769 st p death_coil Fluffy_Pillow 50.0/100: 50% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
4:32.368 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 20.0/100: 20% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
4:33.090 st n clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(2), dragon_games_equipment, corrupting_rage
4:34.411 st p death_coil Fluffy_Pillow 33.0/100: 33% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
4:35.731 Waiting     0.550s 3.0/100: 3% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(3)
4:36.281 cooldowns X soul_reaper Fluffy_Pillow 3.0/100: 3% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), runic_corruption, festermight(3)
4:37.769 st l death_coil Fluffy_Pillow 18.0/100: 18% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), sudden_doom, festermight(3)
4:39.089 st o festering_strike Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(3)
4:40.410 cooldowns T dark_transformation PR_Death_Knight_Unholy 48.0/100: 48% runic_power
0.0/6: 0% rune
icy_talons(3), festermight(3)
4:41.730 st p death_coil Fluffy_Pillow 48.0/100: 48% runic_power
0.0/6: 0% rune
icy_talons(3), dark_transformation, festermight(3), commander_of_the_dead
4:43.051 cooldowns W unholy_assault Fluffy_Pillow 18.0/100: 18% runic_power
0.0/6: 0% rune
icy_talons(3), dark_transformation, festermight(3), commander_of_the_dead
4:44.372 cooldowns U apocalypse Fluffy_Pillow 18.0/100: 18% runic_power
1.0/6: 17% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(3), commander_of_the_dead
4:45.693 cooldowns X soul_reaper Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead
4:47.013 st m death_and_decay Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead
4:48.332 st l death_coil Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead
4:49.590 high_prio_actions j outbreak Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead
4:50.848 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, commander_of_the_dead, corrupting_rage
4:52.106 cooldowns X soul_reaper Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, commander_of_the_dead, corrupting_rage
4:53.364 st l death_coil Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:54.621 st n clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, commander_of_the_dead, corrupting_rage
4:55.877 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight, commander_of_the_dead, corrupting_rage
4:57.135 st n clawing_shadows Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight, commander_of_the_dead, corrupting_rage
4:58.454 st n clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
4:59.775 st l death_coil Fluffy_Pillow 34.0/100: 34% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(3), commander_of_the_dead, corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6014 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3848 0 16397 15616 9166
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 327940 312320 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 21.57% 15.36% 1504
Haste 13.88% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6314 5922 0
Mastery 44.93% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +923 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +923 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=sizzling_seafood_medley
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2,if=!equipped.fyralath_the_dreamrender|raid_event.adds.exists
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
actions.precombat+=/variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl

# Executed every time the actor is available.
actions=auto_attack
# Call Action Lists
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup_complete=0
actions+=/call_action_list,name=cooldowns,if=variable.st_planning
actions+=/call_action_list,name=aoe_cooldowns,if=variable.adds_remain
actions+=/call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
actions+=/call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
actions+=/call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
actions+=/call_action_list,name=st,if=active_enemies<=3

# Generic AoE
actions.aoe=epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# AoE Burst
actions.aoe_burst=epidemic,if=(rune<1|talent.bursting_sores&death_knight.fwounded_targets=0|!talent.bursting_sores)&!variable.pooling_runic_power&(active_enemies>=6|runic_power.deficit<30|buff.festermight.stack=20)
actions.aoe_burst+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=1
actions.aoe_burst+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_burst+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe_burst+=/wound_spender

# AoE Cooldowns
actions.aoe_cooldowns=vile_contagion,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.aoe_cooldowns+=/summon_gargoyle
actions.aoe_cooldowns+=/abomination_limb,if=rune<2|buff.festermight.stack>10|!talent.festermight|buff.festermight.up&buff.festermight.remains<12
actions.aoe_cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=talent.bursting_sores&debuff.festering_wound.up&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
actions.aoe_cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=!talent.bursting_sores&debuff.festering_wound.stack>=4|set_bonus.tier31_2pc&debuff.festering_wound.stack>=1
actions.aoe_cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.stack<=2|buff.dark_transformation.up
actions.aoe_cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.aoe_cooldowns+=/dark_transformation,if=(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.aoe_cooldowns+=/empower_rune_weapon,if=buff.dark_transformation.up
actions.aoe_cooldowns+=/sacrificial_pact,if=!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# AoE Setup
actions.aoe_setup=any_dnd,if=(!talent.bursting_sores|death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets>=8|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5)&(!talent.defile|talent.defile&buff.defile.remains<gcd)
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies&talent.bursting_sores
actions.aoe_setup+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies
actions.aoe_setup+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=cooldown.apocalypse.remains<variable.apoc_timing&debuff.festering_wound.stack<4
actions.aoe_setup+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# ST/Cleave Cooldowns
actions.cooldowns=summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=cooldown.apocalypse.remains<5
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)

# Garg Setup
actions.garg_setup=apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.garg_setup+=/any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>1
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
actions.garg_setup+=/empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=23
actions.garg_setup+=/unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=23
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
actions.garg_setup+=/festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
actions.garg_setup+=/death_coil,if=rune<=1

# Priority Actions
actions.high_prio_actions=mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
actions.high_prio_actions+=/antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle))
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
actions.high_prio_actions+=/invoke_external_buff,name=power_infusion,if=(variable.st_planning|variable.adds_remain)&(pet.gargoyle.active&pet.gargoyle.remains<=22|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.army_ghoul.remains<=18|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+10>cooldown.invoke_external_buff_power_infusion.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))
actions.high_prio_actions+=/potion,if=(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
actions.high_prio_actions+=/any_dnd,if=variable.adds_remain&!death_and_decay.ticking&!talent.bursting_sores&talent.defile&buff.defile.remains<gcd
actions.high_prio_actions+=/army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<3*gcd|!talent.summon_gargoyle|fight_remains<35
actions.high_prio_actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|cooldown.unholy_assault.ready|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
actions.high_prio_actions+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains|!talent.summon_gargoyle)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
actions.high_prio_actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd&time>15|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration+3
actions.racials+=/berserking,if=(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(18>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=18|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|active_enemies>=2&death_and_decay.ticking)|fight_remains<=18
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration+3
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Single Target
actions.st=death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
actions.st+=/epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
actions.st+=/any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)
actions.st+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.st+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4
actions.st+=/death_coil
actions.st+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack>=4

# Trinkets
actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&(active_enemies<5|active_enemies>21|fight_remains<4)&(debuff.festering_wound.stack>=2|time>15)
actions.trinkets+=/use_item,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<16|!talent.summon_gargoyle&pet.army_ghoul.active&pet.army_ghoul.remains<16)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(variable.damage_trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(variable.damage_trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
actions.variables+=/variable,name=garg_setup_complete,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&(cooldown.apocalypse.remains>1|!talent.apocalypse)|!talent.summon_gargoyle|time>20
actions.variables+=/variable,name=apoc_timing,op=setif,value=7,value_else=3,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
actions.variables+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
actions.variables+=/variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4|set_bonus.tier31_4pc&(pet.apoc_magus.active|pet.army_magus.active)&debuff.festering_wound.stack>=1)|fight_remains<5&debuff.festering_wound.stack>=1
actions.variables+=/variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions.variables+=/variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies=1&(!raid_event.adds.exists|raid_event.adds.in>15)
actions.variables+=/variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
actions.variables+=/variable,name=spend_rp,op=setif,value=1,value_else=0,condition=(!talent.rotten_touch|talent.rotten_touch&!debuff.rotten_touch.up|runic_power.deficit<20)&(!set_bonus.tier31_4pc|set_bonus.tier31_4pc&!(pet.apoc_magus.active|pet.army_magus.active)|runic_power.deficit<20|rune<3)&((talent.improved_death_coil&(active_enemies=2|talent.coil_of_devastation)|rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3|!variable.pop_wounds&debuff.festering_wound.stack>=4))

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=9166
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 18070 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
18069.6 18069.6 10.6 / 0.059% 1811.1 / 10.0% 190.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
92.2 91.7 Mana 0.00% 51.9 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 18070
Devouring Plague 4402 24.4% 21.0 14.24s 62779 53922 Direct 21.0 25038 50198 28372 13.3%
Periodic 65.1 9795 19640 11099 13.2% 41.5%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.00 21.00 65.12 65.12 0.00 1.1643 1.9097 1318653.99 1318653.99 0.00% 8861.21 53921.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.75% 18.22 9 25 25037.75 23608 34132 25041.42 24043 26366 456222 456222 0.00%
crit 13.25% 2.78 0 11 50197.70 47215 68264 47523.95 0 68264 139708 139708 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.75% 56.49 37 74 9794.91 2435 16211 9796.72 9045 10758 553338 553338 0.00%
crit 13.25% 8.62 1 20 19639.95 4870 32421 19653.07 7672 27587 169386 169386 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.912450
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.06

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.908300
  • base_td:0.00
  • base_td_mult:1.06
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 191.2%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [P]:21.00
  • if_expr:remains<=gcd.max|insanity.deficit<=16
  • target_if_expr:!talent.distorted_reality|active_enemies=1|remains<=gcd.max

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Percent Cost Mind Devourer3732041-1.000Spell Data
Mind Blast 2693 14.9% 36.0 8.41s 22457 19179 Direct 36.0 19803 39694 22457 13.3%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.95 35.95 0.00 0.00 0.00 1.1710 0.0000 807451.76 807451.76 0.00% 19178.92 19178.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.65% 31.16 18 43 19802.75 18267 28539 19808.01 19048 20745 616989 616989 0.00%
crit 13.35% 4.80 0 14 39694.33 36535 57078 39462.53 0 52047 190463 190463 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:625
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.16

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage{$?s424509=false}[ and increases your spell damage to the target by {$424509s1=10}% for {$214621d=9 seconds}.][.]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s2=0}/100} Insanity.|r][]

Action Priority List

    main
    [S]:36.10
  • if_expr:(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703313PCT0.490
Spell Direct AmountShadow Priest13703322PCT0.370
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Mind Spike 6770 37.5% 179.3 1.66s 11323 9670 Direct 179.3 9991 20029 11323 13.3%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 179.26 179.26 0.00 0.00 0.00 1.1709 0.0000 2029726.66 2029726.66 0.00% 9670.06 9670.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.73% 155.47 114 202 9990.78 9238 14432 9993.15 9740 10416 1553289 1553289 0.00%
crit 13.27% 23.79 9 43 20028.73 18476 28864 20035.05 18677 21899 476438 476438 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.808652
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.06

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage. |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity.|r

Action Priority List

    filler
    [M]:179.95
  • target_if_expr:dot.devouring_plague.remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Shadow Weaving 61 0.3% 33.0 6.42s 544 0 Direct 33.0 544 0 544 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.00 33.00 0.00 0.00 0.00 0.0000 0.0000 17963.95 17963.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 33.00 33 33 544.36 326 1603 544.36 472 698 17964 17964 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:363.56
  • base_dd_max:363.56
  • base_dd_mult:1.06

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Shadow Word: Death 607 3.3% 4.1 15.00s 43751 36150 Direct 4.1 38225 76950 43751 14.3%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.14 4.14 0.00 0.00 0.00 1.2105 0.0000 181329.39 181329.39 0.00% 36150.20 36150.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.73% 3.55 0 5 38225.25 34080 49273 38230.55 0 49273 135819 135819 0.00%
crit 14.27% 0.59 0 4 76949.71 68160 98545 36490.76 0 98545 45510 45510 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.98

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to your target. If your target is not killed by Shadow Word: Death, you take backlash damage equal to {$s5=8}% of your maximum health.{$?=}A364675[ Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][ Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s4=0}/100} Insanity.|r][]

Action Priority List

    filler
    [J]:4.14
  • target_if_expr:(target.health.pct<20|buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703315PCT0.600
Spell Direct AmountShadow Priest13703320PCT-0.420
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Soulseeker Arrow 1032 5.7% 7.0 38.35s 44483 0 Periodic 79.1 3916 0 3916 0.0% 37.4%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.97 0.00 79.14 79.14 2.32 0.0000 1.4162 309868.98 309868.98 0.00% 2764.89 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 79.14 14 164 3915.54 121 4407 3911.54 3807 4107 309869 309869 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3629.20
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1730}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 2009 11.1% 13.5 21.06s 44692 37967 Periodic 127.8 4159 8333 4713 13.3% 99.4%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.48 0.00 127.81 127.81 13.48 1.1772 2.3333 602352.95 602352.95 0.00% 1917.78 37967.41
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.72% 110.84 81 142 4158.75 9 5947 4159.72 4026 4328 460951 460951 0.00%
crit 13.28% 16.97 4 34 8332.51 19 11895 8334.16 7316 9342 141402 141402 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.59
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [R]:13.48
  • if_expr:refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash|!talent.whispering_shadows)&(!action.shadow_crash.in_flight|!talent.whispering_shadows)
  • target_if_expr:remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Periodic AmountShadow Priest1370334PCT0.500
Spell Direct AmountShadow Priest1370335PCT0.500
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
pet - shadowfiend 4191 / 496
melee 4191 2.7% 33.0 6.42s 4445 4297 Direct 33.0 3935 7868 4445 13.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.00 33.00 0.00 0.00 0.00 1.0344 0.0000 146684.27 146684.27 0.00% 4297.31 4297.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 87.03% 28.72 20 33 3934.77 3718 4573 3934.83 3814 4287 113002 113002 0.00%
crit 12.97% 4.28 0 13 7867.61 7435 9147 7785.20 0 9147 33682 33682 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 1.0 0.00s

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    cds
    [F]:1.00
  • if_expr:buff.power_infusion.up|fight_remains<=15
Devouring Plague (_heal) 86.1 3.40s

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 86.12 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 191.2%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Percent Cost Mind Devourer3732041-1.000Spell Data
Phial of Static Empowerment 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.00
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Shadowfiend 2.0 0.00s

Stats Details: Shadowfiend

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0791 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowfiend

  • id:34433
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:343726
  • description:Summons a shadowy fiend to attack the target for {$d=15 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$262485s1=200}/100} Insanity each time the Shadowfiend attacks.|r][ |cFFFFFFFFGenerates {$=}{{$s4=5}/10}.1% Mana each time the Shadowfiend attacks.|r]

Action Priority List

    main
    [O]:2.00
  • if_expr:variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
Shadowform 1.0 0.00s

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 1.0 0.00s

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 127.8 2.33s

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 127.81 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Periodic AmountShadow Priest1370334PCT0.500
Spell Direct AmountShadow Priest1370335PCT0.500
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 1.0 0.0 0.0s 0.0s 14.4s 4.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.8s / 15.0s
  • uptime_min/max:3.84% / 6.23%

Stack Uptimes

  • blood_fury_1:4.87%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Devoured Pride 1.0 0.0 0.0s 0.0s 15.0s 5.07% 5.84% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s
  • uptime_min/max:4.17% / 6.25%

Stack Uptimes

  • devoured_pride_1:5.07%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0s 0.0s 29.4s 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.8s / 30.0s
  • uptime_min/max:8.01% / 12.48%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0s 0.0s 300.0s 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 61.1s 46.0s 16.5s 23.66% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 224.7s
  • trigger_min/max:0.0s / 224.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 74.1s
  • uptime_min/max:4.85% / 54.27%

Stack Uptimes

  • sophic_devotion_1:23.66%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.3 0.0 0.0s 0.0s 19.4s 1.72% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.8s / 20.0s
  • uptime_min/max:0.00% / 8.25%

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:1.72%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.2 0.0 0.0s 0.0s 19.4s 1.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.8s / 20.0s
  • uptime_min/max:0.00% / 8.26%

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:1.63%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.2 0.0 0.0s 0.0s 19.4s 1.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.8s / 20.0s
  • uptime_min/max:0.00% / 8.26%

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:1.60%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.2 0.0 0.0s 0.0s 19.4s 1.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.8s / 20.0s
  • uptime_min/max:0.00% / 8.26%

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:1.60%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0s 0.0s 300.0s 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:Primary stat is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Idol of Y'Shaarj Devoured Violence procs 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 85.78% 83.39% 87.39% 6.6s 0.0s 8.9s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Shadow Word: Death62.9620.000294.154261.818201.183316.354
Shadowfiend0.3500.0000.7280.7000.6720.728
Mind Blast0.221-0.0001.9038.0507.7679.304

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Mana RegenMana714.1027520.10100.00%38.54739257.5496.41%
ShadowfiendInsanity33.0066.006.15%2.000.000.00%
Mind BlastInsanity35.95215.7320.10%6.000.000.00%
Mind SpikeInsanity179.26717.0466.81%4.000.000.00%
Shadow Word: DeathInsanity4.1416.581.54%4.000.000.00%
Vampiric TouchInsanity14.4857.915.40%4.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 21.001050.23100.00%50.0050.001255.59
Mind BlastMana 35.9522471.8481.27%625.00625.0035.93
Shadow Word: DeathMana 4.145180.6418.73%1250.001249.9935.00
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 273300.0 267.99 288.15 495898.6 267252.5 252018.9 273300.0
Mana 250000.0 91.73 92.18 739257.7 249867.6 248130.1 250000.0
Insanity 4.0 3.58 3.50 0.0 23.0 0.0 48.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 18069.58
Minimum 16584.95
Maximum 19908.70
Spread ( max - min ) 3323.75
Range [ ( max - min ) / 2 * 100% ] 9.20%
Standard Deviation 470.3857
5th Percentile 17337.75
95th Percentile 18871.83
( 95th Percentile - 5th Percentile ) 1534.08
Mean Distribution
Standard Deviation 5.4319
95.00% Confidence Interval ( 18058.93 - 18080.22 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2604
0.1 Scale Factor Error with Delta=300 1889
0.05 Scale Factor Error with Delta=300 7556
0.01 Scale Factor Error with Delta=300 188883
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 18069.58
Minimum 16584.95
Maximum 19908.70
Spread ( max - min ) 3323.75
Range [ ( max - min ) / 2 * 100% ] 9.20%
Standard Deviation 470.3857
5th Percentile 17337.75
95th Percentile 18871.83
( 95th Percentile - 5th Percentile ) 1534.08
Mean Distribution
Standard Deviation 5.4319
95.00% Confidence Interval ( 18058.93 - 18080.22 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2604
0.1 Scale Factor Error with Delta=300 1889
0.05 Scale Factor Error with Delta=300 7556
0.01 Scale Factor Error with Delta=300 188883
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 18069.58
Minimum 16584.95
Maximum 19908.70
Spread ( max - min ) 3323.75
Range [ ( max - min ) / 2 * 100% ] 9.20%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 5267347.67
Minimum 3998588.60
Maximum 6792721.61
Spread ( max - min ) 2794133.00
Range [ ( max - min ) / 2 * 100% ] 26.52%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 288.87
Minimum 212.54
Maximum 354.64
Spread ( max - min ) 142.10
Range [ ( max - min ) / 2 * 100% ] 24.60%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 268.49
Minimum 207.62
Maximum 354.26
Spread ( max - min ) 146.64
Range [ ( max - min ) / 2 * 100% ] 27.31%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 shadowform,if=!buff.shadowform.up
5 0.00 arcane_torrent
6 0.00 shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(!set_bonus.tier31_4pc|spell_targets.shadow_crash>1)
7 0.00 vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice|set_bonus.tier31_4pc&spell_targets.shadow_crash=1
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=holding_crash,op=set,value=raid_event.adds.in<15
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
8 0.00 run_action_list,name=aoe,if=active_enemies>2
9 0.00 run_action_list,name=main
actions.cds
# count action,conditions
E 1.00 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
TODO: Check VE/DA enter conditions based on dots
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
F 1.00 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 use_item,name=nymues_unraveling_spindle,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<3+gcd.max|fight_remains<15)
Use Nymue's before we go into our cooldowns
0.00 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
Sync Power Infusion with Voidform or Dark Ascension
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
0.00 dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
G 0.00 call_action_list,name=trinkets
0.00 desperate_prayer,if=health.pct<=75
Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.filler
# count action,conditions
0.00 vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
H 0.00 call_action_list,name=heal_for_tof,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&(talent.rhapsody|talent.divine_star|talent.halo)
0.00 power_word_shield,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&talent.crystalline_reflection
Use PWS with CR talented to trigger TOF if there are no better alternatives available to do this as we still get insanity for a PWS cast.
I 0.00 call_action_list,name=empowered_filler,if=dot.devouring_plague.remains>action.mind_spike.cast_time|!talent.mind_spike
J 4.14 shadow_word_death,target_if=(target.health.pct<20|buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking
Cast Shadow Word: Death if the target is in execute, you have a Deathspeaker proc or you have the Season 3 2-piece bonus
0.00 shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
0.00 mindgames,target_if=max:dot.devouring_plague.remains
0.00 devouring_plague,if=buff.voidform.up|cooldown.dark_ascension.up|buff.mind_devourer.up
0.00 halo,if=spell_targets>1
Save up to 20s if adds are coming soon.
0.00 power_word_life,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up
Using a heal with no damage kickbacks for TOF is damage neutral, so we will do it.
K 0.00 call_action_list,name=empowered_filler
L 0.00 call_action_list,name=heal_for_tof,if=equipped.rashoks_molten_heart&(active_allies-(10-buff.molten_radiance.value))>=10&buff.molten_radiance.up,line_cd=5
M 179.95 mind_spike,target_if=max:dot.devouring_plague.remains
0.00 mind_flay,target_if=max:dot.devouring_plague.remains,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 divine_star
0.00 shadow_crash,if=raid_event.adds.in>20&!set_bonus.tier31_4pc
Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 shadow_word_death,target_if=max:dot.devouring_plague.remains
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain,target_if=max:dot.devouring_plague.remains,if=set_bonus.tier31_4pc
Use Shadow Word: Pain while moving as a low-priority action with T31 4pc
0.00 shadow_word_pain,target_if=min:remains,if=!set_bonus.tier31_4pc
Use Shadow Word: Pain while moving as a low-priority action without T31 4pc
actions.main
# count action,conditions
0.00 variable,name=dots_up,op=set,value=active_dot.vampiric_touch=active_enemies|action.shadow_crash.in_flight&talent.whispering_shadows
N 0.00 call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
O 2.00 mindbender,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active and sync with Dark Ascension
0.00 void_bolt,if=variable.dots_up
Use Void Bolt at the highest priority
P 21.00 devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=remains<=gcd.max|insanity.deficit<=16
0.00 shadow_word_death,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)&dot.devouring_plague.ticking
0.00 mind_blast,target_if=dot.devouring_plague.remains>execute_time&(cooldown.mind_blast.full_recharge_time<=gcd.max+execute_time)|pet.fiend.remains<=execute_time+gcd.max,if=pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>execute_time&active_enemies<=7
High priority Mind Blast action when using Inescapable Torment
0.00 shadow_word_death,target_if=dot.devouring_plague.ticking&pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
Q 0.00 call_action_list,name=heal_for_tof,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&(talent.rhapsody|talent.divine_star|talent.halo)
0.00 devouring_plague,if=fight_remains<=duration+4
Spend your Insanity on Devouring Plague at will if the fight will end in less than 10s
0.00 devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=insanity.deficit<=35&talent.distorted_reality|buff.dark_ascension.up|buff.mind_devourer.up&cooldown.mind_blast.up
Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
0.00 void_torrent,if=!variable.holding_crash&talent.idol_of_cthun&cooldown.mind_blast.full_recharge_time>=3&talent.void_eruption,target_if=dot.devouring_plague.remains>=2.5
0.00 shadow_word_death,if=set_bonus.tier31_2pc
0.00 shadow_crash,if=!variable.holding_crash&(dot.vampiric_touch.refreshable|buff.deaths_torment.stack>9&set_bonus.tier31_4pc&active_enemies>1)
Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
0.00 shadow_word_pain,if=buff.deaths_torment.stack>9&set_bonus.tier31_4pc&active_enemies=1
Consume T31 4pc SWPs
0.00 shadow_word_death,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
R 13.48 vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash|!talent.whispering_shadows)&(!action.shadow_crash.in_flight|!talent.whispering_shadows)
Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
S 36.10 mind_blast,if=(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
0.00 void_torrent,if=!variable.holding_crash&(!talent.idol_of_cthun|!talent.void_eruption),target_if=dot.devouring_plague.remains>=2.5,interrupt_if=cooldown.shadow_word_death.ready&pet.fiend.active&set_bonus.tier31_2pc
Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
T 0.00 call_action_list,name=filler
Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=(buff.power_infusion.up|fight_remains<20)&equipped.voidmenders_shadowgem
0.00 use_item,name=iridal_the_earths_master,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
0.00 use_item,name=dreambinder_loom_of_the_great_cycle,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno,if=equipped.darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime,if=equipped.darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance,if=equipped.darkmoon_deck_box_dance
0.00 use_item,name=conjured_chillglobe
0.00 use_item,name=iceblood_deathsnare,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.iceblood_deathsnare>=5)|fight_remains<20
0.00 use_item,name=erupting_spear_fragment,if=(buff.power_infusion.up|raid_event.adds.up|fight_remains<20)&equipped.erupting_spear_fragment
Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
0.00 use_item,name=belorrelos_the_suncaller,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5|fight_remains<20)&equipped.belorrelos_the_suncaller
Use Belor'relos on cooldown except to hold for incoming adds or if already facing 5 or more targets
0.00 use_item,name=beacon_to_the_beyond,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20)&equipped.beacon_to_the_beyond
Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
U 1.00 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex,if=equipped.desperate_invokers_codex

Sample Sequence

01247OSMMMMMMPSMMMMMMRPSMMMMMMSMMMPMMSMMMMMMRSMPMMMMSMMMMMMSPMRMMMSMMMMMPSMMMMMRSMMMMPMSMMMMMMSMRPMMMSMMMMMMSMPMMRMSMMMMMMSPMMMMMSMRMMMPSMMMMMMSMMMMPRSMMMMMMSMMPMMOSRMMMMMPSMMMMMMPSMRMMMMSMMMMPMSMMMMMRSMMPMMMSMMMMMMSMPRJMMSMMMMMMSPJMMRMSEMMMMMPSJUMMMMFMSMMMMPJSMMM

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 4 shadowform PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 7 vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment
0:00.000 main O shadowfiend Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity
bloodlust, shadowform, static_empowerment
0:00.939 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity
bloodlust, shadowform, devoured_pride, static_empowerment
0:01.878 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
16.0/100: 16% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(2)
0:02.817 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(3)
0:03.756 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(4)
0:04.695 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:05.633 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:06.571 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:07.510 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:08.449 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:09.388 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:10.326 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:11.265 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:12.204 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:13.143 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:14.081 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:15.020 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity
bloodlust, shadowform, static_empowerment(5)
0:15.959 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity
bloodlust, shadowform, static_empowerment(5)
0:16.898 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity
bloodlust, shadowform, static_empowerment(5)
0:17.837 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
8.0/100: 8% insanity
bloodlust, shadowform, static_empowerment(5)
0:18.776 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity
bloodlust, shadowform, static_empowerment(5)
0:19.715 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity
bloodlust, shadowform, static_empowerment(5)
0:20.653 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity
bloodlust, shadowform, static_empowerment(5)
0:21.592 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity
bloodlust, shadowform, static_empowerment(5)
0:22.531 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity
bloodlust, shadowform, static_empowerment(5)
0:23.470 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity
bloodlust, shadowform, static_empowerment(5)
0:24.409 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
38.0/100: 38% insanity
bloodlust, shadowform, static_empowerment(5)
0:25.348 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity
bloodlust, shadowform, static_empowerment(5)
0:26.287 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity
bloodlust, shadowform, static_empowerment(5)
0:27.226 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:28.165 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:29.103 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:30.042 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:30.981 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
14.0/100: 14% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:31.920 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:32.859 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:33.797 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:34.736 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:35.675 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:36.613 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:37.552 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:38.491 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
48.0/100: 48% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:39.430 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:40.368 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:41.588 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:42.808 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity
shadowform, static_empowerment(5)
0:44.027 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity
shadowform, static_empowerment(5)
0:45.245 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity
shadowform, static_empowerment(5)
0:46.550 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
24.0/100: 24% insanity
shadowform, static_empowerment(5)
0:47.770 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity
shadowform, static_empowerment(5)
0:48.990 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity
shadowform, static_empowerment(5)
0:50.210 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity
shadowform, static_empowerment(5)
0:51.430 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity
shadowform, static_empowerment(5)
0:52.650 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity
shadowform, static_empowerment(5)
0:53.870 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity
shadowform, static_empowerment(5)
0:55.090 main P devouring_plague Fluffy_Pillow 249385.2/250000: 100% mana
54.0/100: 54% insanity
shadowform, static_empowerment(5)
0:56.310 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity
shadowform, static_empowerment(5)
0:57.530 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity
shadowform, static_empowerment(5)
0:58.750 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity
shadowform, static_empowerment(5)
0:59.968 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity
shadowform, static_empowerment(5)
1:01.188 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity
shadowform, static_empowerment(5)
1:02.408 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity
shadowform, static_empowerment(5)
1:03.628 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
30.0/100: 30% insanity
shadowform, static_empowerment(5)
1:04.847 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity
shadowform, static_empowerment(5)
1:06.067 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity
shadowform, static_empowerment(5)
1:07.287 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity
shadowform, static_empowerment(5)
1:08.506 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity
shadowform, static_empowerment(5)
1:09.726 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity
shadowform, static_empowerment(5)
1:10.946 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment(5)
1:12.166 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity
shadowform, static_empowerment(5)
1:13.386 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity
shadowform, static_empowerment(5)
1:14.606 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity
shadowform, static_empowerment(5)
1:15.825 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity
shadowform, static_empowerment(5)
1:17.044 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity
shadowform, static_empowerment(5)
1:18.264 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity
shadowform, static_empowerment(5)
1:19.483 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity
shadowform, static_empowerment(5)
1:20.703 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity
shadowform, static_empowerment(5)
1:21.922 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity
shadowform, static_empowerment(5)
1:23.142 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity
shadowform, static_empowerment(5)
1:24.362 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity
shadowform, static_empowerment(5)
1:25.581 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity
shadowform, static_empowerment(5)
1:26.800 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity
shadowform, static_empowerment(5)
1:28.020 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity
shadowform, static_empowerment(5)
1:29.239 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
12.0/100: 12% insanity
shadowform, static_empowerment(5)
1:30.459 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity
shadowform, static_empowerment(5)
1:31.677 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity
shadowform, static_empowerment(5)
1:32.897 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity
shadowform, static_empowerment(5)
1:34.117 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity
shadowform, static_empowerment(5)
1:35.337 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity
shadowform, static_empowerment(5)
1:36.556 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity
shadowform, static_empowerment(5)
1:37.776 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
42.0/100: 42% insanity
shadowform, static_empowerment(5)
1:38.995 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity
shadowform, static_empowerment(5)
1:40.215 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity
shadowform, static_empowerment(5)
1:41.434 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment(5)
1:42.653 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity
shadowform, static_empowerment(5)
1:43.873 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity
shadowform, static_empowerment(5)
1:45.093 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity
shadowform, static_empowerment(5)
1:46.312 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
18.0/100: 18% insanity
shadowform, static_empowerment(5)
1:47.532 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity
shadowform, static_empowerment(5)
1:48.752 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:49.972 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:51.192 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:52.412 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:53.632 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:54.852 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
48.0/100: 48% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:56.072 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:57.291 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:58.511 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:59.730 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:00.950 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:02.168 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:03.387 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
24.0/100: 24% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:04.607 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity
shadowform, static_empowerment(5)
2:05.827 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity
shadowform, static_empowerment(5)
2:07.047 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity
shadowform, static_empowerment(5)
2:08.267 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity
shadowform, static_empowerment(5)
2:09.486 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity
shadowform, static_empowerment(5)
2:10.706 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity
shadowform, static_empowerment(5)
2:11.924 main P devouring_plague Fluffy_Pillow 249380.1/250000: 100% mana
54.0/100: 54% insanity
shadowform, static_empowerment(5)
2:13.144 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity
shadowform, static_empowerment(5)
2:14.364 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity
shadowform, static_empowerment(5)
2:15.584 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity
shadowform, static_empowerment(5)
2:16.804 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity
shadowform, static_empowerment(5)
2:18.023 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity
shadowform, static_empowerment(5)
2:19.242 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity
shadowform, static_empowerment(5)
2:20.462 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
30.0/100: 30% insanity
shadowform, static_empowerment(5)
2:21.682 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity
shadowform, static_empowerment(5)
2:22.902 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity
shadowform, static_empowerment(5)
2:24.122 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity
shadowform, static_empowerment(5)
2:25.342 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity
shadowform, static_empowerment(5)
2:26.561 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity
shadowform, static_empowerment(5)
2:27.780 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment(5)
2:29.000 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity
shadowform, static_empowerment(5)
2:30.219 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity
shadowform, static_empowerment(5)
2:31.439 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity
shadowform, static_empowerment(5)
2:32.659 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity
shadowform, static_empowerment(5)
2:33.879 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity
shadowform, static_empowerment(5)
2:35.099 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity
shadowform, static_empowerment(5)
2:36.319 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity
shadowform, static_empowerment(5)
2:37.539 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity
shadowform, static_empowerment(5)
2:38.759 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity
shadowform, static_empowerment(5)
2:39.979 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity
shadowform, static_empowerment(5)
2:41.199 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity
shadowform, static_empowerment(5)
2:42.419 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity
shadowform, static_empowerment(5)
2:43.639 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity
shadowform, static_empowerment(5)
2:44.859 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity
shadowform, static_empowerment(5)
2:46.078 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
12.0/100: 12% insanity
shadowform, static_empowerment(5)
2:47.297 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity
shadowform, static_empowerment(5)
2:48.517 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity
shadowform, static_empowerment(5)
2:49.737 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity
shadowform, static_empowerment(5)
2:50.956 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity
shadowform, static_empowerment(5)
2:52.176 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity
shadowform, static_empowerment(5)
2:53.396 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity
shadowform, static_empowerment(5)
2:54.615 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
42.0/100: 42% insanity
shadowform, static_empowerment(5)
2:55.834 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity
shadowform, static_empowerment(5)
2:57.053 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity
shadowform, static_empowerment(5)
2:58.271 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment(5)
2:59.491 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity
shadowform, static_empowerment(5)
3:00.710 main O shadowfiend Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity
shadowform, static_empowerment(5)
3:01.928 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity
shadowform, static_empowerment(5)
3:03.148 main R vampiric_touch Fluffy_Pillow 249385.2/250000: 100% mana
18.0/100: 18% insanity
shadowform, static_empowerment(5)
3:04.368 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity
shadowform, static_empowerment(5)
3:05.587 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:06.807 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:08.027 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:09.247 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:10.467 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
54.0/100: 54% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:11.686 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:12.906 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
14.0/100: 14% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:14.126 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:15.345 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:16.565 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:17.785 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:19.005 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:20.225 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity
shadowform, static_empowerment(5)
3:21.444 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment(5)
3:22.664 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity
shadowform, static_empowerment(5)
3:23.884 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity
shadowform, static_empowerment(5)
3:25.102 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity
shadowform, static_empowerment(5)
3:26.322 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity
shadowform, static_empowerment(5)
3:27.541 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity
shadowform, static_empowerment(5)
3:28.759 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity
shadowform, static_empowerment(5)
3:29.979 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity
shadowform, static_empowerment(5)
3:31.199 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity
shadowform, static_empowerment(5)
3:32.419 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity
shadowform, static_empowerment(5)
3:33.639 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity
shadowform, static_empowerment(5)
3:34.858 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity
shadowform, static_empowerment(5)
3:36.077 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity
shadowform, static_empowerment(5)
3:37.296 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity
shadowform, static_empowerment(5)
3:38.516 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity
shadowform, static_empowerment(5)
3:39.736 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity
shadowform, static_empowerment(5)
3:40.956 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity
shadowform, static_empowerment(5)
3:42.176 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity
shadowform, static_empowerment(5)
3:43.396 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity
shadowform, static_empowerment(5)
3:44.616 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity
shadowform, static_empowerment(5)
3:45.836 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity
shadowform, static_empowerment(5)
3:47.055 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity
shadowform, static_empowerment(5)
3:48.275 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
42.0/100: 42% insanity
shadowform, static_empowerment(5)
3:49.494 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity
shadowform, static_empowerment(5)
3:50.714 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity
shadowform, static_empowerment(5)
3:51.934 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment(5)
3:53.154 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity
shadowform, static_empowerment(5)
3:54.374 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity
shadowform, static_empowerment(5)
3:55.594 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity
shadowform, static_empowerment(5)
3:56.814 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
18.0/100: 18% insanity
shadowform, static_empowerment(5)
3:58.034 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity
shadowform, static_empowerment(5)
3:59.254 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity
shadowform, static_empowerment(5)
4:00.474 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity
shadowform, static_empowerment(5)
4:01.694 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity
shadowform, static_empowerment(5)
4:02.914 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity
shadowform, static_empowerment(5)
4:04.134 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity
shadowform, static_empowerment(5)
4:05.354 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
48.0/100: 48% insanity
shadowform, static_empowerment(5)
4:06.574 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity
shadowform, static_empowerment(5)
4:07.793 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity
shadowform, static_empowerment(5)
4:09.013 filler J shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity
shadowform, static_empowerment(5)
4:10.233 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity
shadowform, static_empowerment(5)
4:11.453 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity
shadowform, static_empowerment(5)
4:12.673 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity
shadowform, static_empowerment(5)
4:13.893 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
24.0/100: 24% insanity
shadowform, static_empowerment(5)
4:15.113 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity
shadowform, static_empowerment(5)
4:16.333 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity
shadowform, static_empowerment(5)
4:17.553 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity
shadowform, static_empowerment(5)
4:18.773 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity
shadowform, static_empowerment(5)
4:19.993 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity
shadowform, static_empowerment(5)
4:21.212 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity
shadowform, static_empowerment(5)
4:22.432 main P devouring_plague Fluffy_Pillow 249385.2/250000: 100% mana
54.0/100: 54% insanity
shadowform, static_empowerment(5)
4:23.652 filler J shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity
shadowform, static_empowerment(5)
4:24.872 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity
shadowform, static_empowerment(5)
4:26.092 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity
shadowform, static_empowerment(5)
4:27.312 main R vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity
shadowform, static_empowerment(5)
4:28.532 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity
shadowform, static_empowerment(5)
4:29.751 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity
shadowform, static_empowerment(5)
4:30.970 cds E potion Fluffy_Pillow 249382.7/250000: 100% mana
30.0/100: 30% insanity
shadowform, static_empowerment(5)
4:30.970 filler M mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
30.0/100: 30% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:32.189 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:33.409 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:34.628 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:35.847 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:37.066 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:38.286 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:39.505 filler J shadow_word_death Fluffy_Pillow 249382.7/250000: 100% mana
6.0/100: 6% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.725 trinkets U use_items Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.725 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity
shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:41.945 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity
shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:43.165 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity
shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:44.385 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity
shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.604 cds F blood_fury PR_Priest_Shadow 250000.0/250000: 100% mana
26.0/100: 26% insanity
shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.604 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:46.824 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:48.044 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:49.264 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:50.484 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:51.704 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:52.924 main P devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:54.143 filler J shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:55.363 main S mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:56.583 filler M mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:57.803 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:59.022 filler M mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3848 1 13665 13015 9166
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 273300 260300 0
Mana 250000 250000 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 2560 2560 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +923 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +692 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +923 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +923 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +111 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +692 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +519 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +519 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +923 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Talents

RowPriest Talents [1]
1
2
3
4
5
6
7
8
9
10
RowShadow Talents [2]
1
2
3
4
5
6
7
8
9
10

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(!set_bonus.tier31_4pc|spell_targets.shadow_crash>1)
actions.precombat+=/vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice|set_bonus.tier31_4pc&spell_targets.shadow_crash=1

# Executed every time the actor is available.
actions=variable,name=holding_crash,op=set,value=raid_event.adds.in<15
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
actions+=/run_action_list,name=aoe,if=active_enemies>2
actions+=/run_action_list,name=main

actions.aoe=call_action_list,name=aoe_variables
# High Priority action to put out Vampiric Touch on enemies that will live at least 18 seconds, up to 12 targets manually while prepping AoE
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.dots_up),if=variable.max_vts>0&!variable.manual_vts_applied&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Crash to apply Vampiric Touch to as many adds as possible while being efficient with Vampiric Touch refresh windows
actions.aoe+=/shadow_crash,if=!variable.holding_crash,target_if=dot.vampiric_touch.refreshable|dot.vampiric_touch.remains<=target.time_to_die&!buff.voidform.up&(raid_event.adds.in-dot.vampiric_touch.remains)<15
actions.aoe+=/call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend or Mindbender on cooldown if DoTs are active and sync with Dark Ascension
actions.aoe+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.dots_up|action.shadow_crash.in_flight&talent.whispering_shadows)&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
# Use Void Bolt at the highest priority
actions.aoe+=/void_bolt,target_if=max:target.time_to_die
actions.aoe+=/devouring_plague,target_if=max:target.time_to_die*(!dot.devouring_plague.ticking),if=talent.distorted_reality&(active_dot.devouring_plague=0|insanity.deficit<=20)
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff or if Inescapable Torment is talented with Mindbender active. Only use when facing 3-7 targets.
actions.aoe+=/mind_blast,target_if=max:dot.devouring_plague.remains,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&active_enemies<=7&!buff.mind_devourer.up&dot.devouring_plague.remains>execute_time
# High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
actions.aoe+=/call_action_list,name=heal_for_tof,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&(talent.rhapsody|talent.divine_star|talent.halo)
# Use Devouring Plague on enemies that will live the longest with distorted reality.
actions.aoe+=/devouring_plague,target_if=max:target.time_to_die*(!dot.devouring_plague.ticking),if=talent.distorted_reality
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.aoe+=/devouring_plague,if=(remains<=gcd.max&!variable.pool_for_cds|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2)&!talent.distorted_reality
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.dots_up),if=variable.max_vts>0&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash)&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
# High Priority Mind Spike: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up&variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# # Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.aoe+=/mind_blast,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent action list for AoE
actions.aoe+=/void_torrent,target_if=max:dot.devouring_plague.remains,if=(!variable.holding_crash|raid_event.adds.count%(active_dot.vampiric_touch+raid_event.adds.count)<1.5)&(dot.devouring_plague.remains>=2.5|buff.voidform.up)
# High priority action for Mind Flay: Insanity to fish for Idol of C'Thun procs, cancel as soon as something else is more important and most of the channel has completed
actions.aoe+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up&talent.idol_of_cthun,interrupt_if=ticks>=2,interrupt_immediate=1
actions.aoe+=/call_action_list,name=filler

actions.aoe_variables=variable,name=max_vts,op=set,default=12,value=spell_targets.vampiric_touch>?12
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
# TODO: Revamp to fix undesired behaviour with unstacked fights
actions.aoe_variables+=/variable,name=dots_up,op=set,value=(active_dot.vampiric_touch+8*(action.shadow_crash.in_flight&talent.whispering_shadows))>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=holding_crash,op=set,value=(variable.max_vts-active_dot.vampiric_touch)<4|raid_event.adds.in<10&raid_event.adds.count>(variable.max_vts-active_dot.vampiric_touch),if=variable.holding_crash&talent.whispering_shadows
actions.aoe_variables+=/variable,name=manual_vts_applied,op=set,value=(active_dot.vampiric_touch+8*!variable.holding_crash)>=variable.max_vts|!variable.is_vt_possible

# TODO: Check VE/DA enter conditions based on dots
actions.cds=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
actions.cds+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions.cds+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions.cds+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions.cds+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
# Use Nymue's before we go into our cooldowns
actions.cds+=/use_item,name=nymues_unraveling_spindle,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<3+gcd.max|fight_remains<15)
# Sync Power Infusion with Voidform or Dark Ascension
actions.cds+=/power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
# Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
# Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
actions.cds+=/call_action_list,name=trinkets
# Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.cds+=/desperate_prayer,if=health.pct<=75

actions.empowered_filler=mind_spike_insanity,target_if=max:dot.devouring_plague.remains
actions.empowered_filler+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up

# Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
actions.filler=vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
actions.filler+=/call_action_list,name=heal_for_tof,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&(talent.rhapsody|talent.divine_star|talent.halo)
# Use PWS with CR talented to trigger TOF if there are no better alternatives available to do this as we still get insanity for a PWS cast.
actions.filler+=/power_word_shield,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&talent.crystalline_reflection
actions.filler+=/call_action_list,name=empowered_filler,if=dot.devouring_plague.remains>action.mind_spike.cast_time|!talent.mind_spike
# Cast Shadow Word: Death if the target is in execute, you have a Deathspeaker proc or you have the Season 3 2-piece bonus
actions.filler+=/shadow_word_death,target_if=(target.health.pct<20|buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking
actions.filler+=/shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
actions.filler+=/mindgames,target_if=max:dot.devouring_plague.remains
actions.filler+=/devouring_plague,if=buff.voidform.up|cooldown.dark_ascension.up|buff.mind_devourer.up
# Save up to 20s if adds are coming soon.
actions.filler+=/halo,if=spell_targets>1
# Using a heal with no damage kickbacks for TOF is damage neutral, so we will do it.
actions.filler+=/power_word_life,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up
actions.filler+=/call_action_list,name=empowered_filler
actions.filler+=/call_action_list,name=heal_for_tof,if=equipped.rashoks_molten_heart&(active_allies-(10-buff.molten_radiance.value))>=10&buff.molten_radiance.up,line_cd=5
actions.filler+=/mind_spike,target_if=max:dot.devouring_plague.remains
actions.filler+=/mind_flay,target_if=max:dot.devouring_plague.remains,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
actions.filler+=/divine_star
# Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
actions.filler+=/shadow_crash,if=raid_event.adds.in>20&!set_bonus.tier31_4pc
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.filler+=/shadow_word_death,target_if=target.health.pct<20
# Use Shadow Word: Death while moving as a low-priority action
actions.filler+=/shadow_word_death,target_if=max:dot.devouring_plague.remains
# Use Shadow Word: Pain while moving as a low-priority action with T31 4pc
actions.filler+=/shadow_word_pain,target_if=max:dot.devouring_plague.remains,if=set_bonus.tier31_4pc
# Use Shadow Word: Pain while moving as a low-priority action without T31 4pc
actions.filler+=/shadow_word_pain,target_if=min:remains,if=!set_bonus.tier31_4pc

# Use Halo to acquire Twist of Fate if an ally can be healed for it and it is not currently up.
actions.heal_for_tof=halo
# Use Divine Star to acquire Twist of Fate if an ally can be healed for it and it is not currently up.
actions.heal_for_tof+=/divine_star
# Use Holy Nova when Rhapsody is fully stacked to acquire Twist of Fate if an ally can be healed for it and it is not currently up.
actions.heal_for_tof+=/holy_nova,if=buff.rhapsody.stack=20&talent.rhapsody

actions.main=variable,name=dots_up,op=set,value=active_dot.vampiric_touch=active_enemies|action.shadow_crash.in_flight&talent.whispering_shadows
actions.main+=/call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active and sync with Dark Ascension
actions.main+=/mindbender,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
# Use Void Bolt at the highest priority
actions.main+=/void_bolt,if=variable.dots_up
actions.main+=/devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=remains<=gcd.max|insanity.deficit<=16
actions.main+=/shadow_word_death,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)&dot.devouring_plague.ticking
# High priority Mind Blast action when using Inescapable Torment
actions.main+=/mind_blast,target_if=dot.devouring_plague.remains>execute_time&(cooldown.mind_blast.full_recharge_time<=gcd.max+execute_time)|pet.fiend.remains<=execute_time+gcd.max,if=pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>execute_time&active_enemies<=7
# High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
actions.main+=/shadow_word_death,target_if=dot.devouring_plague.ticking&pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
actions.main+=/call_action_list,name=heal_for_tof,if=!buff.twist_of_fate.up&buff.twist_of_fate_can_trigger_on_ally_heal.up&(talent.rhapsody|talent.divine_star|talent.halo)
# Spend your Insanity on Devouring Plague at will if the fight will end in less than 10s
actions.main+=/devouring_plague,if=fight_remains<=duration+4
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.main+=/devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=insanity.deficit<=35&talent.distorted_reality|buff.dark_ascension.up|buff.mind_devourer.up&cooldown.mind_blast.up
actions.main+=/void_torrent,if=!variable.holding_crash&talent.idol_of_cthun&cooldown.mind_blast.full_recharge_time>=3&talent.void_eruption,target_if=dot.devouring_plague.remains>=2.5
actions.main+=/shadow_word_death,if=set_bonus.tier31_2pc
# Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
actions.main+=/shadow_crash,if=!variable.holding_crash&(dot.vampiric_touch.refreshable|buff.deaths_torment.stack>9&set_bonus.tier31_4pc&active_enemies>1)
# Consume T31 4pc SWPs
actions.main+=/shadow_word_pain,if=buff.deaths_torment.stack>9&set_bonus.tier31_4pc&active_enemies=1
# Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
actions.main+=/shadow_word_death,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
# Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
actions.main+=/vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash|!talent.whispering_shadows)&(!action.shadow_crash.in_flight|!talent.whispering_shadows)
# Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.main+=/mind_blast,if=(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
actions.main+=/void_torrent,if=!variable.holding_crash&(!talent.idol_of_cthun|!talent.void_eruption),target_if=dot.devouring_plague.remains>=2.5,interrupt_if=cooldown.shadow_word_death.ready&pet.fiend.active&set_bonus.tier31_2pc
# Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.main+=/call_action_list,name=filler

actions.trinkets=use_item,name=voidmenders_shadowgem,if=(buff.power_infusion.up|fight_remains<20)&equipped.voidmenders_shadowgem
actions.trinkets+=/use_item,name=iridal_the_earths_master,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
actions.trinkets+=/use_item,name=dreambinder_loom_of_the_great_cycle,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno,if=equipped.darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime,if=equipped.darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance,if=equipped.darkmoon_deck_box_dance
actions.trinkets+=/use_item,name=conjured_chillglobe
actions.trinkets+=/use_item,name=iceblood_deathsnare,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.iceblood_deathsnare>=5)|fight_remains<20
# Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
actions.trinkets+=/use_item,name=erupting_spear_fragment,if=(buff.power_infusion.up|raid_event.adds.up|fight_remains<20)&equipped.erupting_spear_fragment
# Use Belor'relos on cooldown except to hold for incoming adds or if already facing 5 or more targets
actions.trinkets+=/use_item,name=belorrelos_the_suncaller,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5|fight_remains<20)&equipped.belorrelos_the_suncaller
# Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
actions.trinkets+=/use_item,name=beacon_to_the_beyond,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20)&equipped.beacon_to_the_beyond
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
actions.trinkets+=/use_item,name=desperate_invokers_codex,if=equipped.desperate_invokers_codex

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=9166
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 50062 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
50061.7 50061.7 51.7 / 0.103% 8875.6 / 17.7% 69.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
678.0 676.4 Mana 0.90% 52.1 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQJJSIAAAAAAAAAAAAgSESCJkioQSDAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 50062
Doom Winds 101 0.2% 3.7 90.41s 8068 7284 Direct 3.7 6664 13387 8068 20.9% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.1077 0.0000 30113.05 43019.74 30.00% 7284.24 7284.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.12% 2.95 0 4 6663.90 3767 12981 6651.16 0 9816 19680 28115 29.88%
crit 20.88% 0.78 0 4 13386.61 7534 24183 7798.93 0 24183 10433 14904 17.48%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.73
  • if_expr:raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Flame Shock 1679 3.4% 29.5 10.03s 17047 45103 Direct 29.5 3012 6033 3636 20.7% 0.0%
Periodic 184.2 1783 3567 2151 20.6% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.54 29.54 184.23 184.23 27.95 0.3780 1.5777 503614.78 503614.78 0.00% 1668.50 45102.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.34% 23.44 10 37 3012.06 2557 4889 3012.04 2707 3408 70605 70605 0.00%
crit 20.66% 6.10 0 17 6032.59 5113 9681 6018.50 0 8407 36810 36810 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.39% 146.27 102 195 1782.92 1 2868 1782.52 1636 1992 260788 260788 0.00%
crit 20.61% 37.96 16 67 3566.93 9 5735 3566.29 3176 4176 135411 135411 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.08

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:1.08
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Volcanic damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Volcanic damage and then an additional {$=}o2 Volcanic damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Volcanic damage and knocking them into the air.]

Action Priority List

    single
    [O]:1.59
  • if_expr:!ticking
    single
    [W]:7.91

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.090
Spell Periodic AmountEnhancement Shaman13704115PCT-0.090
Spell Direct AmountFire and Ice3828861PCT0.030
Spell Periodic AmountFire and Ice3828862PCT0.030
Flametongue Weapon 0 (1369) 0.0% (2.7%) 1.0 0.00s 410202 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFire and Ice3828861PCT0.030
    Flametongue Attack 1369 2.7% 991.8 0.68s 414 0 Direct 991.8 343 686 414 20.6% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 991.79 991.79 0.00 0.00 0.00 0.0000 0.0000 410202.09 410202.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.36% 787.05 554 1051 342.71 285 555 342.80 319 382 269731 269731 0.00%
crit 20.64% 204.74 117 292 686.08 569 1110 686.28 630 768 140471 140471 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Forgestorm Ignited (_damage) 1233 2.5% 28.4 7.66s 13028 0 Direct 28.4 10806 21617 13028 20.6% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.40 28.40 0.00 0.00 0.00 0.0000 0.0000 369958.15 369958.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.44% 22.56 1 73 10806.19 10705 11241 10798.41 10705 11169 243776 243776 0.00%
crit 20.56% 5.84 0 20 21616.57 21411 22481 21348.56 0 22481 126183 126183 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1061 2.1% 14.2 19.51s 22346 18685 Direct 14.2 18561 37103 22346 20.4% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.24 14.24 0.00 0.00 0.00 1.1960 0.0000 318273.44 318273.44 0.00% 18684.60 18684.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.58% 11.33 2 25 18560.65 8260 32545 18621.91 14160 24194 210381 210381 0.00%
crit 20.42% 2.91 0 12 37103.15 16520 61993 35404.18 0 58831 107892 107892 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.08

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [U]:14.24

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownEnhancement Shaman1370417ADD6000.000
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.090
Spell Periodic AmountEnhancement Shaman13704115PCT-0.090
Spell Direct AmountFire and Ice3828861PCT0.030
Ice Strike 1880 3.8% 21.5 13.79s 26171 22069 Direct 21.5 21688 43412 26170 20.6% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.54 21.54 0.00 0.00 0.00 1.1859 0.0000 563805.91 563805.91 0.00% 22069.36 22069.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.37% 17.10 8 26 21688.45 17716 34905 21684.12 19347 24891 370825 370825 0.00%
crit 20.63% 4.45 0 12 43412.26 35433 69810 43059.45 0 65385 192981 192981 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [P]:20.52
  • if_expr:!buff.ice_strike.up
    single
    [R]:1.02

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Lava Lash 1764 3.5% 20.0 14.70s 26399 22199 Direct 20.0 21871 43768 26399 20.7% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.04 20.04 0.00 0.00 0.00 1.1893 0.0000 529124.89 529124.89 0.00% 22198.56 22198.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.32% 15.90 8 25 21871.50 18658 35182 21863.80 19552 25398 347727 347727 0.00%
crit 20.68% 4.14 0 12 43767.96 37316 70019 43213.99 0 62199 181398 181398 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [Q]:20.04

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownMolten Assault3340331ADD-3000.000
Spell Direct AmountFire and Ice3828861PCT0.030
Lightning Bolt 13787 27.5% 68.1 4.37s 60668 51299 Direct 68.1 50224 100715 60668 20.7% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.13 68.13 0.00 0.00 0.00 1.1826 0.0000 4133391.08 4133391.08 0.00% 51299.32 51299.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.31% 54.04 30 79 50223.86 34014 100176 50237.29 43219 57933 2713975 2713975 0.00%
crit 20.69% 14.09 3 30 100714.74 68027 201926 100734.08 76535 129744 1419416 1419416 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.09

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [N]:68.13
  • if_expr:((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
Spell Direct AmountThorim's Invocation3844442PCT0.200
main_hand 1788 3.6% 193.3 1.81s 2773 1556 Direct 193.3 2661 5323 2773 20.6% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.31 193.31 0.00 0.00 0.00 1.7823 0.0000 535981.14 765706.87 30.00% 1555.64 1555.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.00% 121.79 73 171 2660.61 2257 4253 2660.59 2454 2932 324028 462909 30.00%
crit 20.60% 39.82 16 76 5322.78 4513 8506 5322.78 4733 6089 211953 302798 30.00%
miss 16.40% 31.71 12 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 897 1.8% 193.4 1.80s 1390 779 Direct 193.4 1332 2667 1390 20.7% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.44 193.44 0.00 0.00 0.00 1.7837 0.0000 268802.59 384013.49 30.00% 779.08 779.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.96% 121.78 75 173 1331.92 1128 2151 1331.97 1234 1461 162206 231729 30.00%
crit 20.66% 39.97 18 69 2666.86 2257 4244 2666.86 2405 3031 106596 152284 30.00%
miss 16.38% 31.68 13 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (9736) 0.0% (19.4%) 90.9 3.29s 32098 27355

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.89 0.00 0.00 0.00 0.00 1.1734 0.0000 0.00 0.00 0.00% 27355.05 27355.05

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:57.37
  • if_expr:buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
    single
    [S]:33.51

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
    Stormstrike (_mh) 5274 (6490) 10.5% (13.0%) 121.1 2.46s 16061 0 Direct 121.1 (173.8) 10820 21658 13052 20.6% (14.4%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 121.08 121.08 0.00 0.00 0.00 0.0000 0.0000 1580347.20 2257696.43 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.40% 96.14 56 144 10819.89 3255 27719 10839.64 9206 13247 1040198 1486035 30.00%
crit 20.60% 24.94 8 47 21658.22 6510 56080 21699.65 14404 29082 540149 771662 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
        Stormblast (_stormstrike_mh) 1216 2.4% 52.7 5.62s 6912 0 Direct 52.7 6912 0 6912 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.70 52.70 0.00 0.00 0.00 0.0000 0.0000 364241.77 364241.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 52.70 23 85 6911.77 3572 24623 6913.56 5448 9585 364242 364242 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2638 (3247) 5.3% (6.5%) 121.1 2.46s 8034 0 Direct 121.1 (173.8) 5409 10833 6529 20.6% (14.4%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 121.08 121.08 0.00 0.00 0.00 0.0000 0.0000 790540.54 1129372.42 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 96.08 54 150 5409.48 1627 14020 5419.16 4593 6510 519732 742493 30.00%
crit 20.65% 25.00 6 47 10832.63 3255 26705 10853.52 7067 14533 270809 386879 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
        Stormblast (_stormstrike_offhand) 608 1.2% 52.7 5.62s 3457 0 Direct 52.7 3457 0 3457 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.70 52.70 0.00 0.00 0.00 0.0000 0.0000 182177.26 182177.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 52.70 23 85 3457.01 1786 12311 3458.45 2725 4466 182177 182177 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 972 1.9% 6.0 50.59s 48444 40748 Direct 6.0 40228 80354 48445 20.5% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 6.02 0.00 0.00 0.00 1.1890 0.0000 291711.79 291711.79 0.00% 40747.56 40747.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.52% 4.79 0 8 40227.60 26247 82299 40232.43 0 61263 192631 192631 0.00%
crit 20.48% 1.23 0 5 80354.32 52493 166401 58920.38 0 166401 99081 99081 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [T]:6.02
  • if_expr:raid_event.adds.in>=action.sundering.cooldown

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Tempest Strikes 3783 7.6% 162.6 1.84s 6972 0 Direct 162.6 5778 11577 6972 20.6% 0.0%

Stats Details: Tempest Strikes

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 162.64 162.64 0.00 0.00 0.00 0.0000 0.0000 1133999.86 1133999.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.41% 129.15 77 185 5778.34 4847 9378 5778.79 5317 6506 746290 746290 0.00%
crit 20.59% 33.49 13 60 11577.27 9694 18576 11578.72 10288 13654 387710 387710 0.00%

Action Details: Tempest Strikes

  • id:428078
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:428078
  • name:Tempest Strikes
  • school:nature
  • tooltip:
  • description:{$@spelldesc428071=Stormstrike, Ice Strike, and Lava Lash have a {$h=100}% chance to discharge electricity at your target, dealing {$428078s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Windfury Weapon 0 (6894) 0.0% (13.8%) 1.0 0.00s 2063390 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6894 13.8% 374.9 2.50s 5503 0 Direct 374.9 4556 9134 5503 20.7% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 374.94 374.94 0.00 0.00 0.00 0.0000 0.0000 2063390.34 2947775.64 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.31% 297.37 176 430 4556.15 1878 11863 4557.46 3988 5374 1354836 1935530 30.00%
crit 20.69% 77.57 39 125 9134.37 3756 23726 9136.95 7629 12038 708554 1012246 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
pet - greater_earth_elemental 431 / 89
melee 431 0.2% 38.9 2.23s 682 438 Direct 38.9 566 1131 682 20.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.91 38.91 0.00 0.00 0.00 1.5583 0.0000 26536.61 37910.41 30.00% 437.63 437.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.41% 30.90 4 55 565.65 488 915 564.68 488 730 17480 24972 30.00%
crit 20.59% 8.01 0 23 1130.71 976 1789 1129.27 0 1563 9057 12939 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4091 / 3029
melee 4091 6.0% 383.3 1.56s 2367 2039 Direct 383.3 1961 3927 2367 20.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 383.30 383.30 0.00 0.00 0.00 1.1607 0.0000 907130.59 1295933.89 30.00% 2038.98 2038.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.38% 304.26 207 430 1961.37 1630 3124 1961.75 1811 2183 596770 852551 30.00%
crit 20.62% 79.04 40 129 3926.62 3260 6247 3927.42 3545 4406 310360 443383 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.1 308.84s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.11 0.00 0.00 0.00 0.00 1.0422 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [V]:1.11
Feral Spirit 15.5 20.39s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.50 0.00 0.00 0.00 0.00 1.1689 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:15.50

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 302.03s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 3.1 114.03s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.08 0.00 0.00 0.00 0.00 0.5578 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Action Priority List

    single
    [M]:1.49
  • if_expr:!buff.windfury_totem.up
    single
    [X]:0.59
  • if_expr:buff.windfury_totem.remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.7s 50.1s 80.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 342.0s
  • trigger_min/max:15.0s / 285.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.7s
  • uptime_min/max:50.75% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.14%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Crumbling Power 2.0 0.0 180.4s 5.4s 18.4s 12.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.1s
  • trigger_min/max:0.0s / 164.3s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s
  • uptime_min/max:10.25% / 15.41%

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.36%
  • crumbling_power_3:0.72%
  • crumbling_power_4:0.74%
  • crumbling_power_5:0.75%
  • crumbling_power_6:0.71%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.67%
  • crumbling_power_19:0.70%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4s 90.4s 7.9s 9.88% 12.55% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.4s
  • trigger_min/max:90.0s / 92.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s
  • uptime_min/max:8.77% / 11.45%

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 15.5 0.0 22.2s 19.9s 16.9s 74.03% 100.00% 0.0 (0.0) 12.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 95.3s
  • trigger_min/max:4.8s / 39.2s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 85.5s
  • uptime_min/max:61.77% / 86.74%

Stack Uptimes

  • earthen_weapon_2:72.30%
  • earthen_weapon_4:1.73%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 301.2s 302.0s 27.5s 13.45% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 315.7s
  • trigger_min/max:300.0s / 315.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.97% / 18.13%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.45%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 13.1 2.4 23.7s 20.4s 16.9s 74.04% 0.00% 62.3 (62.3) 12.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 95.3s
  • trigger_min/max:4.8s / 39.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 85.5s
  • uptime_min/max:61.78% / 86.75%

Stack Uptimes

  • feral_spirit_1:74.04%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 36.8 446.3 8.2s 0.6s 7.2s 88.18% 92.42% 446.3 (1082.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 71.8s
  • trigger_min/max:0.0s / 14.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.1s
  • uptime_min/max:78.04% / 96.07%

Stack Uptimes

  • flurry_1:19.00%
  • flurry_2:36.01%
  • flurry_3:33.18%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 107.8 17.9s 2.4s 14.6s 83.76% 100.00% 47.8 (47.8) 16.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 49.6s
  • trigger_min/max:0.0s / 38.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:66.27% / 94.22%

Stack Uptimes

  • forceful_winds_1:16.12%
  • forceful_winds_2:15.07%
  • forceful_winds_3:13.14%
  • forceful_winds_4:10.62%
  • forceful_winds_5:28.81%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=20}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.3s 46.3s 12.9s 19.48% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 213.3s
  • trigger_min/max:0.1s / 210.2s
  • trigger_pct:98.79%
  • duration_min/max:0.0s / 49.7s
  • uptime_min/max:3.62% / 46.82%

Stack Uptimes

  • forgestorm_ignited_1:19.48%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.5 1.0 14.5s 13.8s 8.9s 61.02% 87.74% 1.0 (1.0) 7.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.7s / 63.6s
  • trigger_min/max:8.7s / 42.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.7s
  • uptime_min/max:38.97% / 80.58%

Stack Uptimes

  • ice_strike_1:61.02%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 25.1 23.6 11.9s 6.1s 8.1s 67.91% 100.00% 23.6 (23.6) 24.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 56.8s
  • trigger_min/max:0.9s / 29.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.6s
  • uptime_min/max:56.93% / 79.91%

Stack Uptimes

  • legacy_of_the_frost_witch_1:67.91%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your Physical and Frost abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 69.0 400.5 4.4s 0.6s 3.7s 83.94% 100.00% 58.9 (58.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 23.6s
  • trigger_min/max:0.0s / 7.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.2s
  • uptime_min/max:77.89% / 89.05%

Stack Uptimes

  • maelstrom_weapon_1:9.82%
  • maelstrom_weapon_2:10.48%
  • maelstrom_weapon_3:11.47%
  • maelstrom_weapon_4:11.95%
  • maelstrom_weapon_5:10.00%
  • maelstrom_weapon_6:7.30%
  • maelstrom_weapon_7:5.12%
  • maelstrom_weapon_8:3.76%
  • maelstrom_weapon_9:2.83%
  • maelstrom_weapon_10:11.19%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.9s 45.5s 16.5s 23.85% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 214.2s
  • trigger_min/max:0.0s / 206.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 81.0s
  • uptime_min/max:4.65% / 58.59%

Stack Uptimes

  • sophic_devotion_1:23.85%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.8 76.3s 46.1s 32.0s 37.99% 0.00% 25.3 (25.3) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 256.5s
  • trigger_min/max:0.0s / 205.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 183.1s
  • uptime_min/max:8.13% / 86.11%

Stack Uptimes

  • spiraling_winds_1:2.34%
  • spiraling_winds_2:2.31%
  • spiraling_winds_3:2.30%
  • spiraling_winds_4:2.28%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.22%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.57%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Stormbringer 52.9 15.1 5.6s 4.4s 1.1s 19.53% 57.76% 15.1 (15.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 75.1s
  • trigger_min/max:0.0s / 75.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s
  • uptime_min/max:8.34% / 30.31%

Stack Uptimes

  • stormbringer_1:19.53%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.5 36.0 66.0 17.9s 15.0s 49.6s
Windfury-ForcefulWinds: 2 50.6 33.0 66.0 18.2s 0.2s 78.5s
Windfury-ForcefulWinds: 3 48.4 27.0 66.0 19.0s 0.8s 89.2s
Windfury-ForcefulWinds: 4 43.8 21.0 63.0 20.9s 1.2s 91.2s
Windfury-ForcefulWinds: 5 180.7 72.0 282.0 5.0s 0.0s 89.8s
Windfury (Main Hand) 26.7 9.0 47.0 11.0s 1.3s 132.6s
Windfury (Off Hand) 26.7 10.0 50.0 10.9s 1.3s 133.7s
Windfury: Unruly Winds 125.0 75.0 174.0 2.5s 0.0s 38.1s
Stormflurry 30.2 8.0 70.0 9.5s 0.0s 141.0s
Flametongue: Windfury Attack 374.9 225.0 522.0 2.5s 0.0s 38.1s
Stormbringer: Windfury Attack 38.3 13.0 69.0 8.6s 0.0s 121.2s
Flametongue: main_hand 161.6 109.0 217.0 2.2s 1.3s 17.6s
Windfury: main_hand 60.8 34.0 97.0 5.4s 1.3s 63.8s
Flametongue: offhand 161.8 112.0 216.0 2.2s 1.3s 16.0s
Flametongue: Doom Winds 3.7 3.0 4.0 90.4s 90.0s 92.4s
Windfury: Doom Winds 3.7 3.0 4.0 90.4s 90.0s 92.4s
Flametongue: Lava Lash 20.0 13.0 27.0 14.7s 8.7s 57.1s
Stormbringer: Lava Lash 2.0 0.0 8.0 77.8s 8.8s 341.1s
Flametongue: Sundering 6.0 2.0 9.0 50.6s 40.0s 165.7s
Stormbringer: Sundering 0.6 0.0 5.0 111.5s 40.0s 329.8s
Windfury: Sundering 1.9 0.0 7.0 94.2s 40.0s 338.7s
Flametongue: Ice Strike 21.5 15.0 28.0 13.8s 8.7s 42.1s
Stormbringer: Ice Strike 2.2 0.0 11.0 74.9s 8.7s 337.3s
Windfury: Ice Strike 7.1 0.0 17.0 38.8s 8.7s 295.3s
Flametongue: Stormstrike 121.1 72.0 184.0 2.5s 0.0s 19.8s
Stormbringer: Stormstrike 12.4 1.0 30.0 22.3s 0.0s 269.2s
Windfury: Stormstrike 51.4 24.0 86.0 5.7s 0.0s 86.0s
Flametongue: Stormstrike Off-Hand 121.1 72.0 184.0 2.5s 0.0s 19.8s
Stormbringer: Stormstrike Off-Hand 12.4 1.0 31.0 22.3s 0.1s 269.4s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 36.01% 23.36% 44.57% 0.6s 0.0s 5.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike
Stormstrike
1.3240.0008.252120.86267.603184.963
Feral Spirit0.7900.0001.48812.2704.53120.927
Doom Winds0.5320.0002.4021.9860.8645.674
Lava Lash3.2600.00044.77866.06926.266125.841
Sundering12.0340.000125.84474.92518.359197.040
Ice Strike2.2530.00029.74448.94813.86099.781
Frost Shock15.4410.000171.828232.477159.599322.720
Flame Shock24.5010.000278.205255.673178.092340.725
Earth Elemental32.3170.000243.40837.51210.385263.024

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack73.416.514.83%27.97%
main_hand34.74.17.00%7.04%
offhand34.44.46.94%7.47%
Feral Spirit76.19.315.37%15.82%
Doom Winds0.80.10.17%0.11%
Lightning Bolt98.40.019.86%0.00%
Lava Lash24.90.05.02%0.00%
Sundering1.40.00.29%0.00%
Ice Strike26.70.05.38%0.00%
Stormstrike75.915.015.33%25.42%
Stormstrike (_mh)24.44.74.94%7.91%
Stormstrike Off-Hand24.14.94.87%8.27%
Overflow Stacks0.058.90.00%10.63%
Actual Stacks495.30.089.37%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt491.2100.00%
Total Spent491.2100.00%
Casts per Maelstrom Weapon Stack Consumed
Ability 0 1 2 3 4 5 6 7 8 9 10
Lightning Bolt          18.43 13.40 9.06 6.32 4.53 16.39
Total           18.43
(27.05%)
13.40
(19.66%)
9.06
(13.30%)
6.32
(9.28%)
4.53
(6.65%)
16.39
(24.06%)

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
Mana RegenMana652.50202908.40100.00%310.97564123.8773.55%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 270980.0 0.00 873.76 0.0 8851.9 -459565.5 270980.0
Mana 250000.0 676.36 677.97 564123.5 249519.4 247000.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.001000.000.49%1000.001000.000.00
Flame ShockMana 9.507124.553.50%750.00241.1670.69
Frost ShockMana 14.247121.053.50%500.00499.9844.69
Ice StrikeMana 21.5435545.7217.48%1650.001649.9915.86
Lava LashMana 20.048017.173.94%400.00400.0066.00
Lightning BoltMana 68.1334065.9216.75%500.00500.00121.34
StormstrikeMana 90.8990887.6144.69%1000.001000.0032.10
SunderingMana 6.0218064.398.88%3000.002999.9316.15
Windfury TotemMana 3.081562.590.77%506.77506.760.00

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 50061.67
Minimum 42030.09
Maximum 60278.48
Spread ( max - min ) 18248.39
Range [ ( max - min ) / 2 * 100% ] 18.23%
Standard Deviation 2284.0150
5th Percentile 46378.69
95th Percentile 53919.13
( 95th Percentile - 5th Percentile ) 7540.44
Mean Distribution
Standard Deviation 26.3753
95.00% Confidence Interval ( 50009.97 - 50113.36 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 80
0.1% Error 7997
0.1 Scale Factor Error with Delta=300 44533
0.05 Scale Factor Error with Delta=300 178132
0.01 Scale Factor Error with Delta=300 4453297
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 50061.67
Minimum 42030.09
Maximum 60278.48
Spread ( max - min ) 18248.39
Range [ ( max - min ) / 2 * 100% ] 18.23%
Standard Deviation 2284.0150
5th Percentile 46378.69
95th Percentile 53919.13
( 95th Percentile - 5th Percentile ) 7540.44
Mean Distribution
Standard Deviation 26.3753
95.00% Confidence Interval ( 50009.97 - 50113.36 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 80
0.1% Error 7997
0.1 Scale Factor Error with Delta=300 44533
0.05 Scale Factor Error with Delta=300 178132
0.01 Scale Factor Error with Delta=300 4453297
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 50061.67
Minimum 42030.09
Maximum 60278.48
Spread ( max - min ) 18248.39
Range [ ( max - min ) / 2 * 100% ] 18.23%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 14069675.90
Minimum 9914472.34
Maximum 18663048.79
Spread ( max - min ) 8748576.45
Range [ ( max - min ) / 2 * 100% ] 31.09%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 874.41
Minimum 0.00
Maximum 2180.44
Spread ( max - min ) 2180.44
Range [ ( max - min ) / 2 * 100% ] 124.68%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
0.00 primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
G 15.50 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
H 3.73 doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
J 0.00 call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
K 0.00 call_action_list,name=funnel,if=active_enemies>1&rotation.funnel
actions.single
# count action,conditions
0.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
L 57.37 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
0.00 lava_lash,if=buff.hot_hand.up
M 1.49 windfury_totem,if=!buff.windfury_totem.up
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
N 68.13 lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
0.00 primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
O 1.59 flame_shock,if=!ticking
0.00 ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
0.00 lava_lash,if=talent.lashing_flames.enabled
P 20.52 ice_strike,if=!buff.ice_strike.up
0.00 frost_shock,if=buff.hailstorm.up
Q 20.04 lava_lash
R 1.02 ice_strike
0.00 windstrike
S 33.51 stormstrike
T 6.02 sundering,if=raid_event.adds.in>=action.sundering.cooldown
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
0.00 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
U 14.24 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
V 1.11 earth_elemental
W 7.91 flame_shock
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
X 0.59 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGHLLLLLLLNLLNGNOPLNQTUNNSUPNSLNLGNQLRUNSVUWQNNPLNNLUWGQNPSNTUWSLNQPSLNSUWGNNPQNSUWXHLLLLNGNPQSNSTUWNSPNQSUWNSUPWQGNNSUWPNNQSUNWTLPULGNQLUNSPNLUWNQSUWPSNEFSHGLNLQLLNNPSNTUQSGLNPLNSNMQSLNSLGNPLNQUWNLNUPWSNNQLTUGNPSNNQSLNSUPLLNGNQSNHLNLLLLLGNPQNSNSTUWNPLNQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 250000.0/250000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 2 augmentation PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 3 windfury_weapon PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 4 flametongue_weapon PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 6 windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
0:00.000 default B bloodlust Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), corrupting_rage
0:00.000 default C potion Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage
0:00.000 default D auto_attack Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default F berserking PR_Shaman_Enhancement 249000.0/250000: 100% mana bloodlust, flurry(3), forceful_winds, stormbringer, crumbling_power(20), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, berserking, flurry(3), forceful_winds, stormbringer, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:00.866 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:01.731 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, crumbling_power(18), corrupting_rage, elemental_potion_of_ultimate_power
0:02.595 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds, crumbling_power(17), spiraling_winds, corrupting_rage, elemental_potion_of_ultimate_power
0:03.461 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds, crumbling_power(16), spiraling_winds, corrupting_rage, elemental_potion_of_ultimate_power
0:04.327 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(15), spiraling_winds(2), corrupting_rage, elemental_potion_of_ultimate_power
0:05.192 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(14), spiraling_winds(2), corrupting_rage, elemental_potion_of_ultimate_power
0:06.058 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(13), spiraling_winds(3), corrupting_rage, elemental_potion_of_ultimate_power
0:06.924 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(12), spiraling_winds(3), corrupting_rage, elemental_potion_of_ultimate_power
0:07.790 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(11), spiraling_winds(4), corrupting_rage, elemental_potion_of_ultimate_power
0:08.656 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds(4), corrupting_rage, elemental_potion_of_ultimate_power
0:09.522 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(4), elemental_potion_of_ultimate_power
0:10.388 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(5), elemental_potion_of_ultimate_power
0:11.254 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(5), elemental_potion_of_ultimate_power
0:12.120 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(6), elemental_potion_of_ultimate_power
0:13.073 single O flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(6), elemental_potion_of_ultimate_power
0:14.026 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(7), elemental_potion_of_ultimate_power
0:14.978 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), spiraling_winds(7), elemental_potion_of_ultimate_power
0:15.931 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, crumbling_power(2), spiraling_winds(8), elemental_potion_of_ultimate_power
0:16.884 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power, spiraling_winds(8), elemental_potion_of_ultimate_power
0:17.837 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, spiraling_winds(9), elemental_potion_of_ultimate_power
0:18.790 single U frost_shock Fluffy_Pillow 249439.7/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, spiraling_winds(9), elemental_potion_of_ultimate_power
0:19.742 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), elemental_potion_of_ultimate_power
0:20.695 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(10), elemental_potion_of_ultimate_power
0:21.648 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_potion_of_ultimate_power
0:22.601 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_potion_of_ultimate_power
0:23.554 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_potion_of_ultimate_power
0:24.506 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage, elemental_potion_of_ultimate_power
0:25.458 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage, elemental_potion_of_ultimate_power
0:26.410 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage, elemental_potion_of_ultimate_power
0:27.363 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds(5), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, corrupting_rage, elemental_potion_of_ultimate_power
0:28.316 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage, elemental_potion_of_ultimate_power
0:29.267 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage, elemental_potion_of_ultimate_power
0:30.220 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:31.173 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:32.125 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:33.078 single R ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, corrupting_rage
0:34.031 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, corrupting_rage
0:34.983 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), corrupting_rage
0:35.936 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
0:36.887 single V earth_elemental Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
0:37.840 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
0:38.793 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, corrupting_rage
0:39.746 Waiting     0.949s 250000.0/250000: 100% mana bloodlust, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, corrupting_rage
0:40.695 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(3), sophic_devotion, corrupting_rage
0:42.101 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(4), sophic_devotion, corrupting_rage
0:43.339 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(4), sophic_devotion, corrupting_rage
0:44.577 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, corrupting_rage
0:45.815 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(3), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, corrupting_rage
0:47.052 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, corrupting_rage
0:48.290 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(3), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage
0:49.527 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(4), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage
0:50.764 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, corrupting_rage
0:52.002 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion, corrupting_rage
0:53.239 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(9), corrupting_rage
0:54.505 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
0:55.743 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), corrupting_rage
0:56.980 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
0:58.218 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
0:59.456 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
1:00.694 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
1:01.932 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, sophic_devotion, corrupting_rage
1:03.170 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), sophic_devotion, corrupting_rage
1:04.406 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), sophic_devotion, corrupting_rage
1:05.644 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(7), sophic_devotion, corrupting_rage
1:06.881 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), sophic_devotion, corrupting_rage
1:08.118 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:09.356 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:10.594 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:11.832 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:13.070 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(10), ice_strike, sophic_devotion, corrupting_rage
1:14.308 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:15.546 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:16.784 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
1:18.022 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(4), legacy_of_the_frost_witch, corrupting_rage
1:19.260 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), corrupting_rage
1:20.498 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, corrupting_rage
1:21.736 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, corrupting_rage
1:22.974 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:24.211 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:25.448 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:26.686 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:27.923 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
1:29.160 Waiting     0.912s 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
1:30.072 single X windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), corrupting_rage
1:30.898 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), corrupting_rage
1:32.135 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), doom_winds, corrupting_rage
1:33.373 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(4), stormbringer, maelstrom_weapon(10), doom_winds, corrupting_rage
1:34.609 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, corrupting_rage
1:35.847 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, corrupting_rage
1:37.085 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(10), doom_winds, corrupting_rage
1:38.322 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, corrupting_rage
1:39.560 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, corrupting_rage
1:40.796 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, corrupting_rage
1:42.034 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:43.271 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:44.507 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:45.745 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:46.982 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
1:48.220 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), corrupting_rage
1:49.458 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(2), corrupting_rage
1:50.695 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(3), sophic_devotion, corrupting_rage
1:51.933 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), spiraling_winds(4), sophic_devotion, corrupting_rage
1:53.171 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(4), sophic_devotion, corrupting_rage
1:54.408 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(2), maelstrom_weapon(7), ice_strike, spiraling_winds(5), sophic_devotion, corrupting_rage
1:55.646 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, corrupting_rage
1:56.882 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, corrupting_rage
1:58.120 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage
1:59.358 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage
2:00.596 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(5), spiraling_winds(8), sophic_devotion, corrupting_rage
2:01.833 Waiting     1.044s 250000.0/250000: 100% mana flurry, forceful_winds(2), spiraling_winds(9), sophic_devotion
2:02.877 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(2), spiraling_winds(9), sophic_devotion
2:04.290 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(2), maelstrom_weapon(2), spiraling_winds(10), sophic_devotion
2:05.527 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(2), maelstrom_weapon(3), spiraling_winds(10)
2:06.765 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(2), maelstrom_weapon(4), ice_strike, spiraling_winds(10)
2:08.003 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(4), ice_strike, spiraling_winds(10)
2:09.241 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(5), ice_strike, spiraling_winds(10)
2:10.479 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(10)
2:11.717 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch
2:12.954 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch
2:14.192 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch
2:15.430 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch
2:16.667 Waiting     0.997s 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, corrupting_rage
2:17.664 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), corrupting_rage
2:19.104 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, corrupting_rage
2:20.342 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, corrupting_rage
2:21.580 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:22.818 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:24.056 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:25.294 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:26.532 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(2), maelstrom_weapon, sophic_devotion, corrupting_rage
2:27.770 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(2), maelstrom_weapon, sophic_devotion, corrupting_rage
2:29.008 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds, stormbringer, maelstrom_weapon, sophic_devotion, corrupting_rage
2:30.245 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds, maelstrom_weapon(2), sophic_devotion, corrupting_rage
2:31.482 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(4), ice_strike, sophic_devotion, corrupting_rage
2:32.720 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(2), stormbringer, maelstrom_weapon(5), sophic_devotion, corrupting_rage
2:33.957 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(8), sophic_devotion, corrupting_rage
2:35.194 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), sophic_devotion, corrupting_rage
2:36.430 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:37.668 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, corrupting_rage
2:38.905 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
2:40.142 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, corrupting_rage
2:41.380 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, corrupting_rage
2:42.618 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
2:43.856 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:45.094 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch
2:46.332 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike
2:47.570 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4)
2:48.807 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), forgestorm_ignited
2:50.045 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited
2:51.283 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited
2:52.521 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited
2:53.758 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited
2:54.995 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(3), forgestorm_ignited
2:56.232 Waiting     1.038s 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(4), ice_strike, sophic_devotion, forgestorm_ignited
2:57.270 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(4), ice_strike, sophic_devotion, forgestorm_ignited
2:58.691 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(3), maelstrom_weapon(9), ice_strike, sophic_devotion, forgestorm_ignited
2:59.929 default E use_item_irideus_fragment Fluffy_Pillow 250000.0/250000: 100% mana ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited
3:00.000 default F berserking PR_Shaman_Enhancement 250000.0/250000: 100% mana ice_strike, legacy_of_the_frost_witch, crumbling_power(20), sophic_devotion, forgestorm_ignited, corrupting_rage
3:00.000 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, ice_strike, legacy_of_the_frost_witch, crumbling_power(19), sophic_devotion, forgestorm_ignited, corrupting_rage
3:01.124 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), forceful_winds, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(19), sophic_devotion, corrupting_rage
3:02.249 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, forceful_winds(3), stormbringer, maelstrom_weapon(7), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(18), sophic_devotion, corrupting_rage
3:03.373 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(17), sophic_devotion, corrupting_rage
3:04.498 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(16), sophic_devotion, corrupting_rage
3:05.623 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), sophic_devotion, corrupting_rage
3:06.748 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), sophic_devotion, corrupting_rage
3:07.872 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds, legacy_of_the_frost_witch, crumbling_power(13), sophic_devotion, corrupting_rage
3:08.996 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, crumbling_power(12), sophic_devotion, corrupting_rage
3:10.121 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), crumbling_power(11), sophic_devotion, corrupting_rage
3:11.246 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(10), sophic_devotion, corrupting_rage
3:12.371 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power(9), sophic_devotion, corrupting_rage
3:13.609 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(8), sophic_devotion, corrupting_rage
3:14.847 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), sophic_devotion, corrupting_rage
3:16.085 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), sophic_devotion, corrupting_rage
3:17.322 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon, ice_strike, crumbling_power(5), sophic_devotion, corrupting_rage
3:18.558 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(2), crumbling_power(4), sophic_devotion, corrupting_rage
3:19.800 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), maelstrom_weapon(4), crumbling_power(3), sophic_devotion, corrupting_rage
3:21.037 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds, stormbringer, maelstrom_weapon(8), corrupting_rage
3:22.274 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), corrupting_rage
3:23.512 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), corrupting_rage
3:24.748 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, corrupting_rage
3:25.986 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:27.224 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:28.461 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:29.699 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:30.937 single M windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:31.763 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:33.001 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:34.238 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:35.475 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, corrupting_rage
3:36.713 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:37.951 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:39.189 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:40.426 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:41.664 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:42.902 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:44.140 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:45.378 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:46.616 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, spiraling_winds, forgestorm_ignited, corrupting_rage
3:47.853 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), spiraling_winds, forgestorm_ignited, corrupting_rage
3:49.090 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(2), corrupting_rage
3:50.327 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(3), corrupting_rage
3:51.564 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(3), corrupting_rage
3:52.802 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(4), corrupting_rage
3:54.040 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(4), corrupting_rage
3:55.278 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(2), ice_strike, spiraling_winds(5), corrupting_rage
3:56.516 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon(2), ice_strike, spiraling_winds(6), corrupting_rage
3:57.754 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(5), ice_strike, spiraling_winds(6), corrupting_rage
3:58.992 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), corrupting_rage
4:00.229 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), corrupting_rage
4:01.467 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), corrupting_rage
4:02.704 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), corrupting_rage
4:03.942 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(4), ice_strike, spiraling_winds(9), corrupting_rage
4:05.180 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
4:06.427 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), corrupting_rage
4:07.665 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:08.901 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:10.139 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
4:11.377 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:12.614 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:13.852 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:15.090 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:16.328 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:17.566 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:18.804 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:20.042 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, corrupting_rage
4:21.280 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds, stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:22.518 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds, stormbringer, maelstrom_weapon(9), ice_strike, corrupting_rage
4:23.756 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(10), ice_strike, corrupting_rage
4:24.993 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:26.231 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:27.469 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:28.707 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:29.945 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:31.183 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:32.421 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds, corrupting_rage
4:33.659 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), doom_winds, corrupting_rage
4:34.897 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, corrupting_rage
4:36.134 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), doom_winds, legacy_of_the_frost_witch, corrupting_rage
4:37.372 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, corrupting_rage
4:38.610 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, corrupting_rage
4:39.847 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), corrupting_rage
4:41.085 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(10), spiraling_winds, corrupting_rage
4:42.323 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds, corrupting_rage
4:43.560 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(2), corrupting_rage
4:44.797 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, corrupting_rage
4:46.035 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, corrupting_rage
4:47.272 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, corrupting_rage
4:48.510 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(5), sophic_devotion, corrupting_rage
4:49.748 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, corrupting_rage
4:50.985 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, corrupting_rage
4:52.223 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage
4:53.461 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, corrupting_rage
4:54.699 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(8), sophic_devotion, corrupting_rage
4:55.935 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion, corrupting_rage
4:57.173 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion, corrupting_rage
4:58.411 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
4:59.649 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 250000 250000 0
Spell Power 2280 6148 0
Crit 21.84% 15.63% 1013
Haste 21.55% 21.55% 3663
Versatility 3.93% 0.93% 191
Mana Regen 2560 2560 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQJJSIAAAAAAAAAAAAgSESCJkioQSDAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
actions+=/primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
actions+=/call_action_list,name=funnel,if=active_enemies>1&rotation.funnel

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.funnel=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.funnel+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.funnel+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/windstrike,if=(talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1)|buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/stormstrike,if=buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&buff.crackling_thunder.up
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)|(talent.converging_storms.enabled&buff.converging_storms.stack<buff.converging_storms.max_stack)
actions.funnel+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.funnel+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.funnel+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.funnel+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.funnel+=/sundering
actions.funnel+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.funnel+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=3
actions.funnel+=/stormstrike,if=buff.crash_lightning.up&talent.deeply_rooted_elements.enabled
actions.funnel+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.funnel+=/windstrike
actions.funnel+=/stormstrike
actions.funnel+=/ice_strike
actions.funnel+=/lava_lash
actions.funnel+=/crash_lightning
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=2
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5
actions.funnel+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.funnel+=/flame_shock,if=!ticking
actions.funnel+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
actions.single+=/primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
actions.single+=/lava_lash,if=talent.lashing_flames.enabled
actions.single+=/ice_strike,if=!buff.ice_strike.up
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/ice_strike
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=action.sundering.cooldown
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Ele : 60900 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
60900.4 60900.4 56.7 / 0.093% 9830.8 / 16.1% 110.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
525.6 524.5 Mana 0.32% 53.7 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkESSSDlEAAAAAAAAAAAAAKRIJkQKiCJNAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Ele 60900
Elemental Blast 11380 18.7% 24.8 12.22s 137570 120255 Direct 24.8 113451 227672 137622 21.2% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.79 24.78 0.00 0.00 0.00 1.1440 0.0000 3410779.35 3410779.35 0.00% 120254.53 120254.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.84% 19.54 9 29 113451.25 46819 267596 113454.49 91952 135250 2216795 2216795 0.00%
crit 21.16% 5.24 0 14 227671.79 93638 510439 226938.96 0 412731 1193984 1193984 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:0.29
  • if_expr:buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
    single
    [O]:6.32
  • if_expr:buff.maelstrom_weapon.stack>=5&charges=max_charges
    single
    [Q]:18.18
  • if_expr:buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Resource Cost 2Enhancement Shaman13704112PCT-1.000
Spell Direct AmountEnhancement Shaman13704122PCT-0.090
Spell Direct AmountEnhancement Shaman13704123PCT0.100
Spell Direct AmountFire and Ice3828861PCT0.030
Flame Shock 6427 10.6% 90.5 3.32s 21294 167150 Direct 90.5 7675 15366 9339 21.6% 0.0%
Periodic 196.0 4534 9081 5518 21.6% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.46 90.46 195.99 195.99 89.46 0.1274 1.5215 1926237.62 1926237.62 0.00% 6219.43 167150.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.36% 70.88 43 103 7674.59 4306 19396 7675.59 6696 9125 544009 544009 0.00%
crit 21.64% 19.57 4 39 15366.22 8613 38873 15367.31 11963 19555 300765 300765 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 78.36% 153.58 110 197 4534.10 2489 11354 4534.59 3961 5244 696338 696338 0.00%
crit 21.64% 42.41 16 69 9080.86 4979 23124 9082.39 7729 11004 385125 385125 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.08

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:1.08
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Volcanic damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Volcanic damage and then an additional {$=}o2 Volcanic damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Volcanic damage and knocking them into the air.]

Action Priority List

    single
    [a]:9.75

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.090
Spell Periodic AmountEnhancement Shaman13704115PCT-0.090
Spell Direct AmountFire and Ice3828861PCT0.030
Spell Periodic AmountFire and Ice3828862PCT0.030
Flametongue Weapon 0 (968) 0.0% (1.6%) 1.0 0.00s 290038 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFire and Ice3828861PCT0.030
    Flametongue Attack 968 1.6% 610.3 0.74s 475 0 Direct 610.3 391 782 475 21.6% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 610.32 610.32 0.00 0.00 0.00 0.0000 0.0000 290038.31 290038.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.38% 478.36 321 621 390.60 297 982 390.65 343 450 186847 186847 0.00%
crit 21.62% 131.97 76 196 781.96 594 1909 782.09 688 916 103191 103191 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Forgestorm Ignited (_damage) 1264 2.1% 28.8 7.59s 13143 0 Direct 28.8 10808 21616 13143 21.6% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.85 28.85 0.00 0.00 0.00 0.0000 0.0000 379168.77 379168.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.40% 22.62 2 65 10808.42 10705 11241 10799.72 10705 11169 244455 244455 0.00%
crit 21.60% 6.23 0 22 21616.40 21411 22481 21431.62 0 22481 134714 134714 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 7124 11.7% 42.8 6.95s 49883 43739 Direct 42.8 40899 82018 49882 21.8% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.82 42.82 0.00 0.00 0.00 1.1405 0.0000 2135875.26 2135875.26 0.00% 43739.25 43739.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.15% 33.46 17 50 40898.84 8620 120070 40964.98 32520 52245 1368621 1368621 0.00%
crit 21.85% 9.35 1 24 82018.03 17241 288169 82158.03 43386 138350 767254 767254 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.08

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [V]:42.56
  • if_expr:buff.hailstorm.up
    single
    [Y]:0.26

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownEnhancement Shaman1370417ADD6000.000
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.090
Spell Periodic AmountEnhancement Shaman13704115PCT-0.090
Spell Direct AmountFire and Ice3828861PCT0.030
Ice Strike 2404 3.9% 24.1 12.54s 29841 26175 Direct 24.1 24505 49054 29840 21.7% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.14 24.14 0.00 0.00 0.00 1.1400 0.0000 720349.39 720349.39 0.00% 26175.49 26175.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.26% 18.89 9 29 24505.14 18489 54077 24509.43 20727 30805 462971 462971 0.00%
crit 21.74% 5.25 0 16 49053.90 36979 104639 48934.56 0 84652 257378 257378 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [T]:24.14
  • if_expr:talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Lava Lash 12617 20.7% 73.7 4.04s 51272 45036 Direct 73.7 (73.7) 42173 84399 51273 21.5% (21.5%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 73.73 73.73 0.00 0.00 0.00 1.1385 0.0000 3780253.09 3780253.09 0.00% 45036.25 45036.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.45% 57.84 25 92 42173.25 21808 134650 42173.24 36095 51223 2439319 2439319 0.00%
crit 21.55% 15.89 4 34 84399.26 43617 226271 84388.41 63706 112313 1340934 1340934 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [M]:48.66
  • if_expr:buff.hot_hand.up
    single
    [U]:25.07
  • if_expr:talent.lashing_flames.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownMolten Assault3340331ADD-6000.000
Spell Direct AmountFire and Ice3828861PCT0.030
Lightning Bolt 6029 9.9% 28.6 10.38s 63122 53638 Direct 28.6 52004 104058 63122 21.4% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.63 28.63 0.00 0.00 0.00 1.1768 0.0000 1807069.73 1807069.73 0.00% 53638.16 53638.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.64% 22.51 11 38 52004.42 29581 131923 52049.28 42121 64888 1170861 1170861 0.00%
crit 21.36% 6.11 0 16 104057.50 59163 253107 104084.40 0 194573 636209 636209 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.91

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [P]:6.93
  • if_expr:buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [R]:12.52
  • if_expr:((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
    single
    [X]:9.18
  • if_expr:talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
main_hand 1809 3.0% 193.9 1.80s 2796 1605 Direct 193.9 2656 5318 2796 21.6% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.94 193.94 0.00 0.00 0.00 1.7420 0.0000 542353.68 774810.72 30.00% 1605.37 1605.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.05% 120.34 73 171 2656.43 2257 4253 2656.52 2443 2955 319685 456704 30.00%
crit 21.59% 41.87 17 71 5318.02 4513 8506 5318.11 4767 6012 222669 318107 30.00%
miss 16.36% 31.73 12 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 927 1.5% 198.2 1.76s 1402 806 Direct 198.2 1332 2666 1402 21.6% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 198.19 198.19 0.00 0.00 0.00 1.7386 0.0000 277798.16 396864.64 30.00% 806.21 806.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.95% 122.78 78 173 1331.52 1128 2151 1331.56 1223 1471 163489 233562 30.00%
crit 21.64% 42.88 20 73 2665.85 2257 4236 2666.31 2413 3080 114309 163303 30.00%
miss 16.41% 32.52 11 60 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 0 (4173) 0.0% (6.8%) 7.0 46.18s 179163 149908

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 0.00 0.00 0.00 0.00 1.1952 0.0000 0.00 0.00 0.00% 149907.65 149907.65

Action Details: Primordial Wave

  • id:375982
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:elemental
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=175}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:1.00
  • if_expr:!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
    single
    [S]:5.98
  • if_expr:raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
    Primordial Wave (_damage) 1100 1.8% 7.0 46.18s 47224 0 Direct 7.0 38895 77964 47223 21.3% 0.0%

Stats Details: Primordial Wave Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.97 6.97 0.00 0.00 0.00 0.0000 0.0000 329358.49 329358.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.68% 5.49 1 8 38894.79 31062 59519 38912.96 31062 50754 213439 213439 0.00%
crit 21.32% 1.49 0 6 77963.61 62125 119038 63000.60 0 119038 115919 115919 0.00%

Action Details: Primordial Wave Damage

  • id:375984
  • school:elemental
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:6.00

Spelldata

  • id:375984
  • name:Primordial Wave
  • school:elemental
  • tooltip:
  • description:{$@spelldesc375982=Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=175}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman13704121PCT5.000
    Lightning Bolt (_pw) 3073 5.0% 6.9 45.77s 132837 0 Direct 6.9 109189 217842 132838 21.8% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 0.00 0.0000 0.0000 920721.42 920721.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.24% 5.42 0 8 109188.74 69023 221468 109215.27 0 157422 592124 592124 0.00%
crit 21.76% 1.51 0 6 217842.22 138046 436028 178045.59 0 433910 328597 328597 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.91

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
Stormstrike 0 (1890) 0.0% (3.1%) 32.3 9.14s 17537 15340

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.33 0.00 0.00 0.00 0.00 1.1432 0.0000 0.00 0.00 0.00% 15339.98 15339.98

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [W]:32.33

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
    Stormstrike (_mh) 1260 2.1% 32.3 9.14s 11692 0 Direct 32.3 9618 19223 11692 21.6% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.33 32.33 0.00 0.00 0.00 0.0000 0.0000 378007.65 540024.69 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.40% 25.35 9 41 9617.86 8137 15311 9617.93 8618 11172 243780 348266 30.00%
crit 21.60% 6.98 0 19 19222.81 16274 30537 19209.69 0 27279 134228 191759 29.97%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
    Stormstrike Off-Hand 630 1.0% 32.3 9.14s 5844 0 Direct 32.3 4808 9619 5844 21.5% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.33 32.33 0.00 0.00 0.00 0.0000 0.0000 188942.76 269925.12 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.46% 25.36 9 45 4807.91 4069 7656 4807.90 4245 5573 121951 174220 30.00%
crit 21.54% 6.96 0 18 9618.83 8137 15268 9610.60 0 13343 66992 95705 29.99%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
Windfury Weapon 0 (902) 0.0% (1.5%) 1.0 0.00s 270354 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 902 1.5% 119.9 5.12s 2254 0 Direct 119.9 1852 3710 2254 21.6% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.92 119.92 0.00 0.00 0.00 0.0000 0.0000 270353.87 386229.66 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.36% 93.96 49 156 1852.50 1565 2999 1852.57 1666 2121 174065 248671 30.00%
crit 21.64% 25.96 7 52 3709.69 3130 5997 3709.22 3230 4468 96289 137559 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
pet - greater_earth_elemental 501 / 107
melee 501 0.2% 44.2 2.51s 720 508 Direct 44.2 592 1186 720 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.22 44.22 0.00 0.00 0.00 1.4178 0.0000 31856.84 45510.93 30.00% 508.12 508.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.38% 34.66 9 67 592.06 488 907 589.58 488 757 20522 29318 30.00%
crit 21.62% 9.56 0 27 1185.75 976 1813 1180.18 0 1582 11335 16193 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2458 / 957
melee 2458 1.6% 120.1 2.69s 2387 2140 Direct 120.1 1962 3929 2387 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.06 120.06 0.00 0.00 0.00 1.1157 0.0000 286624.53 409474.06 30.00% 2139.74 2139.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.38% 94.10 11 199 1962.10 1630 3124 1959.76 1630 2521 184640 263778 30.00%
crit 21.62% 25.96 1 66 3928.74 3260 6247 3922.73 3260 5077 101985 145696 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2465 / 964
melee 2465 1.6% 121.1 2.68s 2386 2140 Direct 121.1 1961 3930 2386 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 121.06 121.06 0.00 0.00 0.00 1.1151 0.0000 288805.48 412589.77 30.00% 2139.52 2139.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.43% 94.95 8 222 1961.21 1630 3160 1958.40 1630 2428 186218 266032 30.00%
crit 21.57% 26.11 2 62 3929.52 3260 6320 3923.75 3260 5090 102588 146557 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2458 / 957
melee 2458 1.6% 120.1 2.67s 2386 2136 Direct 120.1 1961 3927 2386 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.14 120.14 0.00 0.00 0.00 1.1168 0.0000 286647.42 409506.76 30.00% 2136.45 2136.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.38% 94.16 11 197 1960.78 1630 3160 1958.57 1630 2492 184631 263765 30.00%
crit 21.62% 25.98 2 64 3927.33 3260 6320 3922.28 3260 4938 102017 145742 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Ele
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.2 311.25s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.19 0.00 0.00 0.00 0.00 0.9252 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Z]:1.19
Feral Spirit 14.4 22.12s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.37 0.00 0.00 0.00 0.00 1.1339 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:14.37

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 303.53s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 3.0 116.98s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.05 0.00 0.00 0.00 0.00 0.5483 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Action Priority List

    single
    [N]:1.66
  • if_expr:!buff.windfury_totem.up
    single
    [b]:0.39
  • if_expr:buff.windfury_totem.remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 73.3 122.7 4.1s 1.5s 3.3s 80.01% 98.29% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 16.5s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.1s
  • uptime_min/max:71.09% / 86.99%

Stack Uptimes

  • ashen_catalyst_1:33.65%
  • ashen_catalyst_2:18.08%
  • ashen_catalyst_3:12.71%
  • ashen_catalyst_4:10.09%
  • ashen_catalyst_5:4.24%
  • ashen_catalyst_6:0.98%
  • ashen_catalyst_7:0.23%
  • ashen_catalyst_8:0.04%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.8s 58.4s 50.1s 80.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 339.0s
  • trigger_min/max:15.0s / 308.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.0s
  • uptime_min/max:48.44% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.13%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Crackling Surge 8.0 0.0 37.1s 36.7s 15.0s 38.94% 43.82% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.4s / 322.1s
  • trigger_min/max:11.4s / 322.1s
  • trigger_pct:84.62%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:0.00% / 70.38%

Stack Uptimes

  • crackling_surge_1:31.14%
  • crackling_surge_2:7.78%
  • crackling_surge_3:0.02%
  • crackling_surge_4:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases Nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4s 5.3s 17.8s 12.06% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.3s
  • trigger_min/max:0.0s / 165.8s
  • trigger_pct:100.00%
  • duration_min/max:15.1s / 20.0s
  • uptime_min/max:9.84% / 15.00%

Stack Uptimes

  • crumbling_power_1:0.43%
  • crumbling_power_2:0.63%
  • crumbling_power_3:0.65%
  • crumbling_power_4:0.64%
  • crumbling_power_5:0.63%
  • crumbling_power_6:0.62%
  • crumbling_power_7:0.62%
  • crumbling_power_8:0.60%
  • crumbling_power_9:0.59%
  • crumbling_power_10:0.60%
  • crumbling_power_11:0.62%
  • crumbling_power_12:0.64%
  • crumbling_power_13:0.66%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.68%
  • crumbling_power_16:0.69%
  • crumbling_power_17:0.69%
  • crumbling_power_18:0.69%
  • crumbling_power_19:0.69%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Elemental Blast: Critical Strike 8.2 0.0 35.3s 35.3s 9.8s 27.05% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 247.2s
  • trigger_min/max:10.0s / 247.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:4.15% / 54.06%

Stack Uptimes

  • elemental_blast_critical_strike_1:27.05%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 8.2 0.0 35.3s 35.3s 9.8s 26.98% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 325.8s
  • trigger_min/max:10.0s / 325.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.80% / 53.32%

Stack Uptimes

  • elemental_blast_haste_1:26.98%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 8.3 0.0 35.0s 35.0s 9.8s 27.26% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 272.0s
  • trigger_min/max:10.0s / 272.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:6.13% / 53.82%

Stack Uptimes

  • elemental_blast_mastery_1:27.26%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 301.9s 303.4s 27.5s 13.45% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 315.5s
  • trigger_min/max:300.0s / 315.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.97% / 18.17%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.45%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 13.8 0.6 22.6s 22.1s 15.3s 70.04% 0.00% 56.8 (56.8) 13.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 47.2s
  • trigger_min/max:13.5s / 34.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:63.69% / 75.87%

Stack Uptimes

  • feral_spirit_1:70.04%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 44.5 281.8 6.8s 0.9s 5.6s 83.32% 89.81% 281.8 (617.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 59.0s
  • trigger_min/max:0.0s / 16.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.6s
  • uptime_min/max:70.70% / 91.47%

Stack Uptimes

  • flurry_1:21.77%
  • flurry_2:36.67%
  • flurry_3:24.88%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.4s 46.2s 13.0s 19.49% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 203.0s
  • trigger_min/max:0.2s / 198.3s
  • trigger_pct:98.89%
  • duration_min/max:0.0s / 56.0s
  • uptime_min/max:3.87% / 47.89%

Stack Uptimes

  • forgestorm_ignited_1:19.49%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 43.1 10.4 7.0s 5.6s 3.6s 51.93% 99.39% 10.3 (78.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 34.0s
  • trigger_min/max:1.0s / 18.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.2s
  • uptime_min/max:37.42% / 66.93%

Stack Uptimes

  • hailstorm_5:4.17%
  • hailstorm_6:3.84%
  • hailstorm_7:3.49%
  • hailstorm_8:10.55%
  • hailstorm_9:7.74%
  • hailstorm_10:22.14%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.7 5.8 27.5s 17.3s 10.0s 35.43% 86.50% 5.8 (5.8) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 191.2s
  • trigger_min/max:0.0s / 191.2s
  • trigger_pct:5.02%
  • duration_min/max:0.0s / 50.3s
  • uptime_min/max:7.39% / 62.88%

Stack Uptimes

  • hot_hand_1:35.43%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.1 0.0 12.6s 12.5s 3.4s 27.68% 55.53% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 33.0s
  • trigger_min/max:7.7s / 33.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.1s
  • uptime_min/max:16.84% / 43.12%

Stack Uptimes

  • ice_strike_1:27.68%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 8.0 0.0 37.0s 36.7s 15.0s 39.08% 100.00% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.6s / 258.8s
  • trigger_min/max:10.6s / 258.8s
  • trigger_pct:84.40%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:5.38% / 70.46%

Stack Uptimes

  • icy_edge_1:31.15%
  • icy_edge_2:7.91%
  • icy_edge_3:0.03%
  • icy_edge_4:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases Frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 54.3 379.3 5.6s 0.7s 4.6s 84.00% 100.00% 28.4 (41.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 17.2s
  • trigger_min/max:0.0s / 6.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.8s
  • uptime_min/max:79.43% / 88.27%

Stack Uptimes

  • maelstrom_weapon_1:9.70%
  • maelstrom_weapon_2:9.97%
  • maelstrom_weapon_3:10.18%
  • maelstrom_weapon_4:10.13%
  • maelstrom_weapon_5:9.06%
  • maelstrom_weapon_6:8.15%
  • maelstrom_weapon_7:7.22%
  • maelstrom_weapon_8:6.33%
  • maelstrom_weapon_9:4.18%
  • maelstrom_weapon_10:9.09%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 8.0 0.0 37.2s 36.9s 15.0s 38.89% 100.00% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.3s / 271.2s
  • trigger_min/max:11.3s / 271.2s
  • trigger_pct:84.68%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:6.05% / 71.50%

Stack Uptimes

  • molten_weapon_1:31.10%
  • molten_weapon_2:7.76%
  • molten_weapon_3:0.02%
  • molten_weapon_4:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases Fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Wave 7.0 0.0 46.2s 46.2s 2.7s 6.32% 24.32% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 58.2s
  • trigger_min/max:45.0s / 58.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:3.17% / 15.01%

Stack Uptimes

  • primordial_wave_1:6.32%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=175}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.2 60.8s 45.5s 16.5s 23.67% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 215.7s
  • trigger_min/max:0.0s / 215.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.6s
  • uptime_min/max:5.03% / 54.64%

Stack Uptimes

  • sophic_devotion_1:23.67%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.5 1.9 76.6s 45.8s 32.2s 38.07% 0.00% 25.6 (25.6) 3.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 244.1s
  • trigger_min/max:0.0s / 206.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 230.9s
  • uptime_min/max:8.15% / 95.61%

Stack Uptimes

  • spiraling_winds_1:2.34%
  • spiraling_winds_2:2.31%
  • spiraling_winds_3:2.30%
  • spiraling_winds_4:2.27%
  • spiraling_winds_5:2.26%
  • spiraling_winds_6:2.24%
  • spiraling_winds_7:2.23%
  • spiraling_winds_8:2.21%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.72%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 6.9 0.0 45.8s 45.8s 11.8s 27.28% 31.09% 0.0 (0.0) 6.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:32.7s / 98.9s
  • trigger_min/max:32.7s / 98.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:23.86% / 29.88%

Stack Uptimes

  • splintered_elements_1:27.28%

Spelldata

  • id:382043
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc382042=Primordial Wave grants you {$s1=20}% Haste plus {$s2=4}% for each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave for {$382043d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 15.9 4.9 18.3s 13.8s 5.6s 29.35% 43.93% 4.9 (4.9) 1.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 178.3s
  • trigger_min/max:0.0s / 178.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.8s
  • uptime_min/max:6.06% / 60.10%

Stack Uptimes

  • stormbringer_1:29.35%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 26.8 8.0 53.0 10.9s 1.1s 130.4s
Windfury (Off Hand) 27.3 9.0 49.0 10.7s 1.1s 119.0s
Elemental Blast: Critical Strike 8.2 1.0 16.0 35.3s 10.0s 247.2s
Elemental Blast: Haste 8.2 1.0 16.0 35.3s 10.0s 325.8s
Elemental Blast: Mastery 8.3 2.0 17.0 35.0s 10.0s 272.0s
Maelstrom Weapon Swing Reset 6.9 5.0 8.0 45.8s 32.7s 98.9s
Flametongue: Windfury Attack 119.9 60.0 196.0 5.1s 0.0s 60.7s
Stormbringer: Windfury Attack 8.9 0.0 25.0 31.3s 0.0s 295.2s
Flametongue: main_hand 162.2 111.0 219.0 2.2s 1.1s 17.9s
Hot Hand: main_hand 8.2 0.0 20.0 32.8s 1.1s 303.2s
Windfury: main_hand 44.5 18.0 75.0 7.0s 1.1s 73.6s
Flametongue: offhand 165.7 113.0 223.0 2.2s 1.1s 17.3s
Hot Hand: offhand 8.3 0.0 20.0 32.3s 1.1s 281.1s
Flametongue: Lava Lash 73.7 39.0 111.0 4.0s 0.8s 16.3s
Stormbringer: Lava Lash 5.4 0.0 18.0 44.7s 0.8s 312.5s
Flametongue: Ice Strike 24.1 18.0 30.0 12.5s 7.7s 33.0s
Stormbringer: Ice Strike 1.8 0.0 8.0 81.5s 7.9s 333.7s
Windfury: Ice Strike 6.6 0.0 16.0 40.8s 7.8s 308.6s
Flametongue: Stormstrike 32.3 13.0 50.0 9.1s 0.8s 71.1s
Stormbringer: Stormstrike 2.4 0.0 10.0 69.3s 0.8s 343.3s
Windfury: Stormstrike 8.9 0.0 21.0 30.5s 0.8s 290.6s
Flametongue: Stormstrike Off-Hand 32.3 13.0 50.0 9.1s 0.8s 71.1s
Stormbringer: Stormstrike Off-Hand 2.4 0.0 9.0 69.5s 0.8s 339.6s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 42.53% 34.31% 49.35% 0.7s 0.0s 6.0s
Hot Hand 35.43% 7.39% 62.88% 10.0s 0.0s 50.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike
Stormstrike
3.8810.00052.811127.82360.767216.085
Primordial Wave1.1330.00013.2407.9401.05324.063
Feral Spirit0.7740.0001.50611.1484.11718.024
Lava Lash0.5720.0008.49942.29822.18467.963
Elemental Blast0.5020.00013.28912.5301.78641.962
Ice Strike1.2000.00020.25429.1238.79462.005
Frost Shock2.4290.00027.355105.00558.049157.521
Flame Shock23.7550.000302.024253.838176.704341.492
Earth Elemental19.0540.000289.14925.0706.149289.149

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack26.62.25.85%5.26%
main_hand35.53.47.81%8.16%
offhand36.53.38.04%7.87%
Primordial Wave50.119.611.03%46.87%
Feral Spirit76.66.416.86%15.28%
Lava Lash84.76.818.63%16.22%
Ice Strike54.00.111.89%0.16%
Frost Shock42.60.09.36%0.00%
Stormstrike32.30.17.10%0.16%
Stormstrike (_mh)7.80.01.71%0.00%
Stormstrike Off-Hand7.80.01.71%0.00%
Overflow Stacks0.041.90.00%8.43%
Actual Stacks454.50.091.57%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt234.352.02%
Elemental Blast216.147.98%
Total Spent450.4100.00%
Casts per Maelstrom Weapon Stack Consumed
Ability 0 1 2 3 4 5 6 7 8 9 10
Lightning Bolt          3.12 3.04 3.01 5.64 3.90 9.91
Elemental Blast          1.10 0.99 0.84 7.18 5.55 9.14
Total           4.22
(7.90%)
4.03
(7.55%)
3.84
(7.20%)
12.82
(24.00%)
9.45
(17.69%)
19.05
(35.67%)

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Ele
Mana RegenMana631.49157341.47100.00%249.16609666.1879.49%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 270980.0 0.00 875.12 0.0 8444.5 -472848.1 270980.0
Mana 250000.0 524.47 525.64 609666.2 249649.9 248350.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement_Ele
BloodlustMana 1.001000.000.63%1000.001000.000.00
Flame ShockMana 9.757315.724.64%750.0080.87263.30
Frost ShockMana 42.8221408.9513.58%500.00500.0099.77
Ice StrikeMana 24.1439830.3125.26%1650.001650.0018.09
Lava LashMana 73.7329491.3718.70%400.00400.00128.18
Lightning BoltMana 28.6314314.629.08%500.00500.02126.24
Primordial WaveMana 6.9810466.006.64%1500.001500.00119.44
StormstrikeMana 32.3332328.7620.50%1000.00999.9917.54
Windfury TotemMana 3.051535.800.97%503.91503.910.00

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Ele Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Ele Damage Per Second
Count 7499
Mean 60900.35
Minimum 53292.74
Maximum 71145.12
Spread ( max - min ) 17852.39
Range [ ( max - min ) / 2 * 100% ] 14.66%
Standard Deviation 2507.3068
5th Percentile 56990.81
95th Percentile 65221.81
( 95th Percentile - 5th Percentile ) 8231.00
Mean Distribution
Standard Deviation 28.9538
95.00% Confidence Interval ( 60843.61 - 60957.10 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 66
0.1% Error 6512
0.1 Scale Factor Error with Delta=300 53666
0.05 Scale Factor Error with Delta=300 214664
0.01 Scale Factor Error with Delta=300 5366593
Priority Target DPS
PR_Shaman_Enhancement_Ele Priority Target Damage Per Second
Count 7499
Mean 60900.35
Minimum 53292.74
Maximum 71145.12
Spread ( max - min ) 17852.39
Range [ ( max - min ) / 2 * 100% ] 14.66%
Standard Deviation 2507.3068
5th Percentile 56990.81
95th Percentile 65221.81
( 95th Percentile - 5th Percentile ) 8231.00
Mean Distribution
Standard Deviation 28.9538
95.00% Confidence Interval ( 60843.61 - 60957.10 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 66
0.1% Error 6512
0.1 Scale Factor Error with Delta=300 53666
0.05 Scale Factor Error with Delta=300 214664
0.01 Scale Factor Error with Delta=300 5366593
DPS(e)
PR_Shaman_Enhancement_Ele Damage Per Second (Effective)
Count 7499
Mean 60900.35
Minimum 53292.74
Maximum 71145.12
Spread ( max - min ) 17852.39
Range [ ( max - min ) / 2 * 100% ] 14.66%
Damage
PR_Shaman_Enhancement_Ele Damage
Count 7499
Mean 17357307.55
Minimum 12609038.37
Maximum 22893569.46
Spread ( max - min ) 10284531.08
Range [ ( max - min ) / 2 * 100% ] 29.63%
DTPS
PR_Shaman_Enhancement_Ele Damage Taken Per Second
Count 7499
Mean 875.19
Minimum 0.00
Maximum 2282.68
Spread ( max - min ) 2282.68
Range [ ( max - min ) / 2 * 100% ] 130.41%
HPS
PR_Shaman_Enhancement_Ele Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Ele Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Ele Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Ele Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Ele Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_EleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Ele Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
0.00 primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
G 14.37 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
0.00 doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
I 0.00 call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
J 0.00 call_action_list,name=funnel,if=active_enemies>1&rotation.funnel
actions.single
# count action,conditions
K 1.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
L 0.29 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
0.00 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
M 48.66 lava_lash,if=buff.hot_hand.up
N 1.66 windfury_totem,if=!buff.windfury_totem.up
O 6.32 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
P 6.93 lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
Q 18.18 elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
R 12.52 lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
S 5.98 primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
0.00 flame_shock,if=!ticking
T 24.14 ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
U 25.07 lava_lash,if=talent.lashing_flames.enabled
0.00 ice_strike,if=!buff.ice_strike.up
V 42.56 frost_shock,if=buff.hailstorm.up
0.00 lava_lash
0.00 ice_strike
0.00 windstrike
W 32.33 stormstrike
0.00 sundering,if=raid_event.adds.in>=action.sundering.cooldown
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
X 9.18 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 0.26 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Z 1.19 earth_elemental
a 9.75 flame_shock
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
b 0.39 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGKOTUVWPZUVWXTUVMOMGMVMQMTMRMVMWMMQMTMVMRGMVMMQMTMRMSMPMGVTQUVWRaVUMTMRMVWUOVGMTMQMVWXUVaTSPUVGOMVMTMQMVWXUVRTWVNURGVWOUTVWQaVUWSPTVGUWMQMVMTMQVWaMXMVMTMGQVWaUQVTEFWRUMSGMPMTUMQMVMWMQTVUWRVabUWGTQVWURVaWXTUSPVGWOUVTQWVUXaVWXTUVWRGMVMMOMTMVMQWVaSGPTUVWQaVUMQMTMRMVWCW

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 2 augmentation PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 3 windfury_weapon PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 4 flametongue_weapon PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 6 windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana flurry(3), corrupting_rage
0:00.000 default B bloodlust Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), corrupting_rage
0:00.000 default C potion Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage
0:00.000 default D auto_attack Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(2), maelstrom_weapon, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default F berserking PR_Shaman_Enhancement_Ele 249000.0/250000: 100% mana bloodlust, flurry(2), maelstrom_weapon, crumbling_power(20), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, berserking, flurry(2), maelstrom_weapon, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:00.893 single K primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, feral_spirit, crackling_surge(2), maelstrom_weapon(2), crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:01.787 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), primordial_wave, feral_spirit, crackling_surge(2), maelstrom_weapon(10), crumbling_power(18), corrupting_rage, elemental_potion_of_ultimate_power
0:02.681 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), elemental_blast_haste, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon, hailstorm(10), crumbling_power(17), corrupting_rage, elemental_potion_of_ultimate_power
0:03.549 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_haste, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(4), hailstorm(10), ice_strike, crumbling_power(16), corrupting_rage, elemental_potion_of_ultimate_power
0:04.417 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_haste, primordial_wave, feral_spirit, crackling_surge(2), stormbringer, maelstrom_weapon(5), hailstorm(10), ice_strike, crumbling_power(15), corrupting_rage, elemental_potion_of_ultimate_power
0:05.284 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), elemental_blast_haste, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, stormbringer, maelstrom_weapon(6), crumbling_power(14), corrupting_rage, elemental_potion_of_ultimate_power
0:06.152 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_haste, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(9), crumbling_power(13), corrupting_rage, elemental_potion_of_ultimate_power
0:07.020 single Z earth_elemental Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), hailstorm(9), crumbling_power(12), corrupting_rage, elemental_potion_of_ultimate_power
0:07.774 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(4), hailstorm(9), crumbling_power(11), corrupting_rage, elemental_potion_of_ultimate_power
0:08.665 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), maelstrom_weapon(2), hailstorm(9), crumbling_power(10), corrupting_rage, elemental_potion_of_ultimate_power
0:09.419 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(6), crumbling_power(9), corrupting_rage, elemental_potion_of_ultimate_power
0:10.173 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(7), crumbling_power(8), corrupting_rage, elemental_potion_of_ultimate_power
0:10.926 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), hailstorm(7), crumbling_power(7), corrupting_rage, elemental_potion_of_ultimate_power
0:11.680 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(3), hailstorm(7), ice_strike, crumbling_power(6), corrupting_rage, elemental_potion_of_ultimate_power
0:12.432 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), splintered_elements, feral_spirit, crackling_surge(2), maelstrom_weapon(5), hailstorm(7), ice_strike, crumbling_power(5), corrupting_rage, elemental_potion_of_ultimate_power
0:13.251 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), crumbling_power(4), corrupting_rage, elemental_potion_of_ultimate_power
0:14.068 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(9), crumbling_power(3), corrupting_rage, elemental_potion_of_ultimate_power
0:14.887 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, hailstorm(9), crumbling_power(2), corrupting_rage, elemental_potion_of_ultimate_power
0:15.683 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_haste, splintered_elements, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(9), crumbling_power, corrupting_rage, elemental_potion_of_ultimate_power
0:16.479 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(9), corrupting_rage, elemental_potion_of_ultimate_power
0:17.275 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(9), corrupting_rage, elemental_potion_of_ultimate_power
0:18.070 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), corrupting_rage, elemental_potion_of_ultimate_power
0:18.866 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(8), corrupting_rage, elemental_potion_of_ultimate_power
0:19.820 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, hailstorm(8), corrupting_rage, elemental_potion_of_ultimate_power
0:20.783 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(8), corrupting_rage, elemental_potion_of_ultimate_power
0:21.737 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(8), ice_strike, corrupting_rage, elemental_potion_of_ultimate_power
0:22.691 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(9), hailstorm(8), ice_strike, corrupting_rage, elemental_potion_of_ultimate_power
0:23.645 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, corrupting_rage, elemental_potion_of_ultimate_power
0:24.599 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, corrupting_rage, elemental_potion_of_ultimate_power
0:25.581 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), corrupting_rage, elemental_potion_of_ultimate_power
0:26.564 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(5), corrupting_rage, elemental_potion_of_ultimate_power
0:27.547 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), corrupting_rage, elemental_potion_of_ultimate_power
0:28.530 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), corrupting_rage, elemental_potion_of_ultimate_power
0:29.513 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), corrupting_rage, elemental_potion_of_ultimate_power
0:30.496 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, hailstorm(10), corrupting_rage
0:31.450 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), corrupting_rage
0:32.404 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, corrupting_rage
0:33.358 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), ice_strike, corrupting_rage
0:34.312 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), forgestorm_ignited, corrupting_rage
0:35.266 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), forgestorm_ignited, corrupting_rage
0:36.219 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst(2), hot_hand, stormbringer, hailstorm(9), forgestorm_ignited, corrupting_rage
0:37.172 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon, hailstorm(9), forgestorm_ignited, corrupting_rage
0:38.126 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, molten_weapon(2), hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(9), forgestorm_ignited, corrupting_rage
0:39.080 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), forgestorm_ignited, corrupting_rage
0:40.034 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), forgestorm_ignited, corrupting_rage
0:41.310 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), forgestorm_ignited, corrupting_rage
0:42.586 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(9), forgestorm_ignited, corrupting_rage
0:43.824 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(9), forgestorm_ignited, corrupting_rage
0:45.062 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(9), ice_strike, forgestorm_ignited, corrupting_rage
0:46.299 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(9), ice_strike, corrupting_rage
0:47.538 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, corrupting_rage
0:48.777 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, corrupting_rage
0:50.016 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(10), ice_strike, corrupting_rage
0:51.254 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, primordial_wave, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(10), ice_strike, corrupting_rage
0:52.493 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst(2), hot_hand, stormbringer, hailstorm(10), ice_strike, corrupting_rage
0:53.557 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, corrupting_rage
0:54.621 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, corrupting_rage
0:55.685 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), corrupting_rage
0:56.747 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(8), ice_strike, sophic_devotion, corrupting_rage
0:57.811 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon, hailstorm(8), ice_strike, sophic_devotion, corrupting_rage
0:58.846 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(4), hailstorm(8), ice_strike, sophic_devotion, corrupting_rage
0:59.879 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), sophic_devotion, corrupting_rage
1:00.911 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(8), sophic_devotion, corrupting_rage
1:01.943 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hailstorm(8), sophic_devotion, corrupting_rage
1:02.974 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon, hailstorm(8), sophic_devotion, corrupting_rage
1:04.007 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(2), sophic_devotion, corrupting_rage
1:05.245 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), sophic_devotion, corrupting_rage
1:06.483 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(6), sophic_devotion, corrupting_rage
1:07.803 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, sophic_devotion
1:09.079 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, sophic_devotion
1:10.355 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, sophic_devotion
1:11.630 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), hot_hand, maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds
1:12.906 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(3), spiraling_winds
1:14.182 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(2)
1:15.690 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(5), spiraling_winds(3)
1:16.966 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon, hailstorm(5), spiraling_winds(3)
1:18.205 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), spiraling_winds(4)
1:19.444 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), hot_hand, maelstrom_weapon(6), spiraling_winds(5)
1:20.683 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), spiraling_winds(5)
1:21.921 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(10), ice_strike, spiraling_winds(6)
1:23.160 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), hot_hand, maelstrom_weapon(10), ice_strike, spiraling_winds(7), forgestorm_ignited, corrupting_rage
1:24.398 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, spiraling_winds(7), forgestorm_ignited, corrupting_rage
1:25.635 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(3), hailstorm(10), ice_strike, spiraling_winds(8), forgestorm_ignited, corrupting_rage
1:26.874 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(8), forgestorm_ignited, corrupting_rage
1:28.150 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(6), spiraling_winds(9), forgestorm_ignited, corrupting_rage
1:29.426 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(3), hailstorm(6), spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:30.702 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(3), hailstorm(6), spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:32.000 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:33.276 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:34.552 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:35.828 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, ashen_catalyst(4), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), corrupting_rage
1:37.104 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst(5), stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, spiraling_winds(10), corrupting_rage
1:38.167 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:39.231 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, ashen_catalyst, stormbringer, maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:40.294 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:41.358 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, hailstorm(5), spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:42.391 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(5), spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:43.424 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:44.457 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:45.488 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(9), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:46.520 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(10), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:47.553 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:48.586 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:49.825 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5), spiraling_winds(10), corrupting_rage
1:51.064 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), spiraling_winds(10), corrupting_rage
1:52.339 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), hailstorm(6), spiraling_winds(10), corrupting_rage
1:53.615 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(6), hailstorm(6), spiraling_winds(10), corrupting_rage
1:54.901 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(8), spiraling_winds(10), corrupting_rage
1:56.177 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), stormbringer, maelstrom_weapon(2), hailstorm(8), spiraling_winds(10), corrupting_rage
1:57.592 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), hailstorm(8), ice_strike, spiraling_winds(10), corrupting_rage
1:58.868 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst(4), maelstrom_weapon(5), hailstorm(8), ice_strike, spiraling_winds(10), corrupting_rage
2:00.144 single N windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon(6), spiraling_winds(10), corrupting_rage
2:00.996 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst(5), maelstrom_weapon(6), spiraling_winds(10), corrupting_rage
2:02.272 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(8), spiraling_winds(10), corrupting_rage
2:03.548 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon, hailstorm(8), spiraling_winds(10), corrupting_rage
2:04.824 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(2), hailstorm(8), spiraling_winds(10), corrupting_rage
2:06.100 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
2:07.376 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(7), spiraling_winds(10), corrupting_rage
2:08.652 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(5), hailstorm(7), spiraling_winds(10), corrupting_rage
2:09.890 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), maelstrom_weapon(2), hailstorm(7), spiraling_winds(10), corrupting_rage
2:11.129 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(5), hailstorm(7), ice_strike, spiraling_winds(10), corrupting_rage
2:12.368 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(7), spiraling_winds(10), corrupting_rage
2:13.607 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(9), spiraling_winds(10), corrupting_rage
2:14.845 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(4), hailstorm(9), spiraling_winds(10), corrupting_rage
2:16.084 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon, hailstorm(9), spiraling_winds(10)
2:17.323 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(2), spiraling_winds(10)
2:18.562 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, molten_weapon(2), ashen_catalyst, maelstrom_weapon(5), spiraling_winds(10)
2:19.858 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(6), spiraling_winds(10)
2:21.134 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, primordial_wave, ashen_catalyst(2), maelstrom_weapon(10), spiraling_winds(10)
2:22.410 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst(3), hailstorm(10), spiraling_winds(10)
2:23.472 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst(4), maelstrom_weapon(2), hailstorm(10), ice_strike
2:24.534 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(5), maelstrom_weapon(5)
2:25.596 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_weapon(6)
2:26.660 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(7)
2:27.723 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(10)
2:28.787 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(10)
2:29.851 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10)
2:30.915 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), corrupting_rage
2:31.979 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), spiraling_winds, forgestorm_ignited, corrupting_rage
2:33.042 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(2), forgestorm_ignited, corrupting_rage
2:34.106 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(2), forgestorm_ignited, corrupting_rage
2:35.419 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(3), forgestorm_ignited, corrupting_rage
2:36.695 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, spiraling_winds(3), forgestorm_ignited, corrupting_rage
2:37.934 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(2), spiraling_winds(4), forgestorm_ignited, corrupting_rage
2:39.173 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(3), spiraling_winds(5), forgestorm_ignited, corrupting_rage
2:40.411 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), hot_hand, maelstrom_weapon(4), spiraling_winds(5), forgestorm_ignited, corrupting_rage
2:41.649 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(5), spiraling_winds(6), forgestorm_ignited, corrupting_rage
2:42.887 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(5), spiraling_winds(6), forgestorm_ignited, corrupting_rage
2:44.126 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, hot_hand, maelstrom_weapon(2), hailstorm(5), spiraling_winds(7), corrupting_rage
2:45.364 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(3), spiraling_winds(8), sophic_devotion, corrupting_rage
2:46.603 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst, hot_hand, maelstrom_weapon(6), spiraling_winds(8), sophic_devotion, corrupting_rage
2:47.879 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(9), sophic_devotion, corrupting_rage
2:49.155 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
2:50.431 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
2:51.707 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, hailstorm(10), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
2:52.983 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, corrupting_rage
2:54.258 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, corrupting_rage
2:55.534 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, corrupting_rage
2:56.809 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(8), sophic_devotion, corrupting_rage
2:58.084 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon, hailstorm(8), sophic_devotion, corrupting_rage
2:59.360 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), corrupting_rage
3:00.635 default E use_item_irideus_fragment Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(7), ice_strike, corrupting_rage
3:00.635 default F berserking PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(7), ice_strike, crumbling_power(20), corrupting_rage
3:00.635 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(7), ice_strike, crumbling_power(19), corrupting_rage
3:01.796 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(10), ice_strike, crumbling_power(19), sophic_devotion, corrupting_rage
3:02.957 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), hailstorm(10), ice_strike, crumbling_power(18), sophic_devotion, corrupting_rage
3:04.118 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(2), hailstorm(10), ice_strike, crumbling_power(17), sophic_devotion, corrupting_rage
3:05.277 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(10), ice_strike, crumbling_power(16), sophic_devotion, corrupting_rage
3:06.438 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, primordial_wave, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), hailstorm(10), ice_strike, crumbling_power(15), sophic_devotion, corrupting_rage
3:07.599 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst(3), hot_hand, maelstrom_weapon(10), hailstorm(10), ice_strike, crumbling_power(14), sophic_devotion, corrupting_rage
3:08.759 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, primordial_wave, feral_spirit, molten_weapon(2), hot_hand, maelstrom_weapon(10), hailstorm(10), ice_strike, crumbling_power(13), sophic_devotion, corrupting_rage
3:09.919 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, crumbling_power(12), sophic_devotion, corrupting_rage
3:10.886 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana berserking, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), ice_strike, crumbling_power(11), sophic_devotion, corrupting_rage
3:11.853 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(4), hailstorm(10), ice_strike, crumbling_power(10), sophic_devotion, corrupting_rage
3:13.054 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), hailstorm(10), ice_strike, crumbling_power(9), sophic_devotion, corrupting_rage
3:14.118 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(10), ice_strike, crumbling_power(8), sophic_devotion, corrupting_rage
3:15.182 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, hailstorm(10), ice_strike, crumbling_power(7), sophic_devotion, corrupting_rage
3:16.243 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, crumbling_power(6), sophic_devotion, corrupting_rage
3:17.306 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), crumbling_power(5), corrupting_rage
3:18.370 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), crumbling_power(4), corrupting_rage
3:19.434 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(8), crumbling_power(3), corrupting_rage
3:20.498 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(9), crumbling_power(2), corrupting_rage
3:21.562 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon, hailstorm(9)
3:22.801 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(3), hailstorm(9), ice_strike
3:24.040 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(4), sophic_devotion
3:25.279 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, maelstrom_weapon(6), sophic_devotion
3:26.517 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(8), sophic_devotion
3:27.755 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), hailstorm(8), sophic_devotion
3:28.994 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon, sophic_devotion
3:30.233 single b windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon, sophic_devotion
3:31.060 Waiting     0.186s 250000.0/250000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon(2), sophic_devotion
3:31.246 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon(2), sophic_devotion
3:32.745 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(3), sophic_devotion
3:34.021 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst, maelstrom_weapon(6), sophic_devotion
3:35.297 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(7), sophic_devotion
3:36.572 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(9), ice_strike, sophic_devotion, corrupting_rage
3:37.846 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(2), hailstorm(9), ice_strike, sophic_devotion, corrupting_rage
3:39.122 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(3), corrupting_rage
3:40.398 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(7), corrupting_rage
3:41.674 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(9), corrupting_rage
3:42.950 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), hailstorm(9), corrupting_rage
3:44.226 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(2), corrupting_rage
3:45.502 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(2), corrupting_rage
3:46.778 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(6), corrupting_rage
3:48.054 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge(2), ashen_catalyst(5), hailstorm(6), corrupting_rage
3:49.330 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst(5), maelstrom_weapon(5), hailstorm(6), ice_strike, corrupting_rage
3:50.606 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(6), hailstorm(6), ice_strike, corrupting_rage
3:51.881 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, ashen_catalyst(2), maelstrom_weapon(10), hailstorm(6), ice_strike, corrupting_rage
3:53.157 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst(3), hailstorm(10), ice_strike, corrupting_rage
3:54.221 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, ashen_catalyst(3), maelstrom_weapon, corrupting_rage
3:55.283 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), corrupting_rage
3:56.346 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(8), corrupting_rage
3:57.409 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), maelstrom_weapon, hailstorm(8), corrupting_rage
3:58.442 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, maelstrom_weapon(3), hailstorm(8), corrupting_rage
3:59.474 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(4), corrupting_rage
4:00.505 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(8), ice_strike, corrupting_rage
4:01.537 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hailstorm(8), ice_strike, corrupting_rage
4:02.569 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(8), ice_strike, corrupting_rage
4:03.601 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), corrupting_rage
4:04.679 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(5), corrupting_rage
4:05.918 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hailstorm(5), corrupting_rage
4:07.157 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon, hailstorm(5), corrupting_rage
4:08.552 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), corrupting_rage
4:09.827 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(4), maelstrom_weapon(5), corrupting_rage
4:11.103 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(5), maelstrom_weapon, hailstorm(5), corrupting_rage
4:12.379 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon(3), hailstorm(5), ice_strike, corrupting_rage
4:13.655 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(4), hailstorm(5), ice_strike, corrupting_rage
4:14.931 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(6), corrupting_rage
4:16.207 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(3), maelstrom_weapon(8), corrupting_rage
4:17.483 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(3), hot_hand, maelstrom_weapon, hailstorm(8), forgestorm_ignited, corrupting_rage
4:18.758 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), hot_hand, maelstrom_weapon(3), hailstorm(8), forgestorm_ignited, corrupting_rage
4:20.034 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(8), forgestorm_ignited, corrupting_rage
4:21.310 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(7), sophic_devotion, forgestorm_ignited, corrupting_rage
4:22.586 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(8), sophic_devotion, forgestorm_ignited, corrupting_rage
4:23.862 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(10), sophic_devotion, forgestorm_ignited, corrupting_rage
4:25.137 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(10), sophic_devotion, forgestorm_ignited, corrupting_rage
4:26.412 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), spiraling_winds, sophic_devotion, forgestorm_ignited, corrupting_rage
4:27.688 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(10), ice_strike, spiraling_winds(2), sophic_devotion, forgestorm_ignited, corrupting_rage
4:28.964 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(7), hailstorm(10), ice_strike, spiraling_winds(2), sophic_devotion, corrupting_rage
4:30.240 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(9), spiraling_winds(3), sophic_devotion, corrupting_rage
4:31.515 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(10), spiraling_winds(4), sophic_devotion, corrupting_rage
4:32.791 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(10), spiraling_winds(4), sophic_devotion, corrupting_rage
4:34.066 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(3), hailstorm(10), spiraling_winds(5), sophic_devotion, corrupting_rage
4:35.342 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(6), sophic_devotion, corrupting_rage
4:36.618 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(4), maelstrom_weapon(6), spiraling_winds(6), sophic_devotion, corrupting_rage
4:37.893 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, primordial_wave, ashen_catalyst(4), maelstrom_weapon(10), spiraling_winds(7), corrupting_rage
4:39.169 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_weapon(10), spiraling_winds(8), corrupting_rage
4:40.445 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(6), hailstorm(10), spiraling_winds(8), corrupting_rage
4:41.508 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(7), maelstrom_weapon(4), hailstorm(10), ice_strike, spiraling_winds(9), corrupting_rage
4:42.571 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(5), hailstorm(10), ice_strike, spiraling_winds(9), corrupting_rage
4:43.634 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(7), spiraling_winds(10), corrupting_rage
4:44.697 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(9), spiraling_winds(10), corrupting_rage
4:45.761 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hailstorm(9), spiraling_winds(10), corrupting_rage
4:46.825 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon(2), hailstorm(9), spiraling_winds(10), corrupting_rage
4:47.888 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon(5), spiraling_winds(10), corrupting_rage
4:49.058 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(7), spiraling_winds(10), corrupting_rage
4:50.122 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(9), spiraling_winds(10), corrupting_rage
4:51.186 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(2), hailstorm(9), spiraling_winds(10), corrupting_rage
4:52.424 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(4), hailstorm(9), spiraling_winds(10), corrupting_rage
4:53.661 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(8), hailstorm(9), ice_strike, spiraling_winds(10), corrupting_rage
4:54.900 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(9), ice_strike, spiraling_winds(10)
4:56.138 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), hot_hand, hailstorm(10), ice_strike, spiraling_winds(10)
4:57.377 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, maelstrom_weapon, hailstorm(10), ice_strike, spiraling_winds(10)
4:58.616 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, maelstrom_weapon(3), spiraling_winds(10)
4:59.855 default C potion Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), spiraling_winds(10)
5:00.000 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), spiraling_winds(10), elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 250000 250000 0
Spell Power 2280 6148 0
Crit 22.03% 15.82% 1047
Haste 17.84% 17.84% 3032
Versatility 3.93% 0.93% 191
Mana Regen 2560 2560 0
Attack Power 5440 5012 0
Mastery 58.69% 58.69% 3842
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +519 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Ele"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkESSSDlEAAAAAAAAAAAAAKRIJkQKiCJNAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
actions+=/primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
actions+=/call_action_list,name=funnel,if=active_enemies>1&rotation.funnel

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.funnel=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.funnel+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.funnel+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/windstrike,if=(talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1)|buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/stormstrike,if=buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&buff.crackling_thunder.up
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)|(talent.converging_storms.enabled&buff.converging_storms.stack<buff.converging_storms.max_stack)
actions.funnel+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.funnel+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.funnel+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.funnel+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.funnel+=/sundering
actions.funnel+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.funnel+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=3
actions.funnel+=/stormstrike,if=buff.crash_lightning.up&talent.deeply_rooted_elements.enabled
actions.funnel+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.funnel+=/windstrike
actions.funnel+=/stormstrike
actions.funnel+=/ice_strike
actions.funnel+=/lava_lash
actions.funnel+=/crash_lightning
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=2
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5
actions.funnel+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.funnel+=/flame_shock,if=!ticking
actions.funnel+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
actions.single+=/primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
actions.single+=/lava_lash,if=talent.lashing_flames.enabled
actions.single+=/ice_strike,if=!buff.ice_strike.up
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/ice_strike
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=action.sundering.cooldown
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1047
# gear_haste_rating=3032
# gear_mastery_rating=3842
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 245048019
Max Event Queue: 286
Sim Seconds: 2250297
CPU Seconds: 250.0631
Physical Seconds: 125.4804
Speed Up: 8999

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.96sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 182005 607 7.61 3636 7290 38.0 38.0 31.4% 0.0% 0.0% 0.0% 6.76sec 182005 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost antimagic_shell 48707 52077 174 0.65 16014 0 6.9 3.3 0.0% 0.0% 0.0% 0.0% 41.94sec 52077 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 130.31sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 799067 2664 38.44 3609 7226 192.2 192.2 31.5% 16.3% 0.0% 0.0% 1.82sec 1141553 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 388982 1297 37.57 1804 3613 187.8 187.8 31.4% 16.7% 0.0% 0.0% 1.82sec 555703 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost blood_draw 374606 30162 101 0.40 11494 23028 2.0 2.0 31.1% 0.0% 0.0% 0.0% 0.00sec 30162 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_damage 155166 3043445 10145 25.27 18329 36576 126.4 126.4 31.5% 0.0% 0.0% 0.0% 2.09sec 3043445 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 220464 735 0.56 60267 120576 3.0 2.8 31.8% 0.0% 0.0% 0.0% 119.97sec 220464 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay ticks -43265 4472 15 0.00 422 842 0.7 0.0 31.4% 0.0% 0.0% 0.0% 77.19sec 4472 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 306267 1021 1.38 33773 67524 6.9 6.9 31.4% 0.0% 0.0% 0.0% 47.24sec 437535 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 82.87sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 382154 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 784631 2615 19.74 6060 12092 59.1 98.7 31.3% 0.0% 0.0% 0.0% 5.04sec 784631 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 222026 812209 2707 9.26 13367 26657 46.3 46.3 31.4% 0.0% 0.0% 0.0% 4.73sec 812209 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 406058 1354 9.26 6685 13318 46.3 46.3 31.4% 0.0% 0.0% 0.0% 4.73sec 406058 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 4.2 0.0 0.0% 0.0% 0.0% 0.0% 72.98sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 2048559 6829 11.83 26382 52704 59.1 59.1 31.4% 0.0% 0.0% 0.0% 5.04sec 2048559 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 405198 1351 11.82 5218 10422 59.1 59.1 31.4% 0.0% 0.0% 0.0% 5.04sec 405198 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 405596 1352 9.00 6845 13776 45.0 45.0 31.3% 0.0% 0.0% 0.0% 6.50sec 579437 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 203424 678 9.00 3422 6928 45.0 45.0 31.4% 0.0% 0.0% 0.0% 6.50sec 290613 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1917181 6391 11.49 8851 33383 57.4 57.4 100.0% 0.0% 0.0% 0.0% 5.15sec 1917181 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 958501 3195 11.49 4425 16690 57.4 57.4 100.0% 0.0% 0.0% 0.0% 5.15sec 958501 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost overwhelming_rage ticks -374037 263344 878 3.94 13370 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 60.24sec 325749 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 35.87sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 305.12sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.62sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul auto_attack 0 278080 1713 35.10 2227 4459 95.0 95.0 31.4% 0.0% 0.0% 0.0% 2.90sec 397267 162.35sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 135868 837 19.30 1977 3964 52.2 52.2 31.4% 0.0% 0.0% 0.0% 5.37sec 194103 162.35sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 254 2 1.07 66 133 2.9 2.9 31.7% 0.0% 0.0% 0.0% 121.63sec 363 162.35sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.3 0.0 0.0% 0.0% 0.0% 0.0% 20.33sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1835795 6119 48.55 5761 11498 242.7 242.7 31.4% 0.0% 0.0% 0.0% 1.24sec 1835795 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 61840 206 4.06 2323 4645 20.3 20.3 31.3% 0.0% 0.0% 0.0% 14.35sec 88346 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 61907 206 4.06 2323 4646 20.3 20.3 31.3% 0.0% 0.0% 0.0% 14.36sec 88440 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.2 0.0 0.0% 0.0% 0.0% 0.0% 14.35sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy algethar_puzzle_box_channel 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.56sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy antimagic_shell 48707 49056 164 0.62 15824 0 6.9 3.1 0.0% 0.0% 0.0% 0.0% 45.41sec 49056 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 71815 239 1.36 8766 17588 6.8 6.8 20.4% 0.0% 0.0% 0.0% 46.29sec 71815 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 1247383 9475 117.38 4027 8052 257.6 257.6 20.3% 0.0% 0.0% 0.0% 4.33sec 1782022 131.66sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 297345 2258 85.96 1311 2621 188.6 188.6 20.3% 0.0% 0.0% 0.0% 5.98sec 424789 131.66sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_magus frostbolt 317792 194600 1478 8.99 8189 16368 19.7 19.7 20.4% 0.0% 0.0% 0.0% 14.92sec 194600 131.66sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_magus shadow_bolt 317791 619164 4703 28.42 8253 16499 62.4 62.4 20.3% 0.0% 0.0% 0.0% 4.53sec 619164 131.66sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1143496 18660 326.07 2852 5694 333.0 333.0 20.5% 0.0% 0.0% 0.0% 0.85sec 1633607 61.28sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 218813 3571 199.71 891 1776 204.0 204.0 20.5% 0.0% 0.0% 0.0% 1.48sec 312598 61.28sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_magus frostbolt 317792 82109 1368 8.00 8514 16913 8.0 8.0 20.8% 0.0% 0.0% 0.0% 30.89sec 82109 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_magus shadow_bolt 317791 383609 6393 35.55 8968 17916 35.6 35.6 20.4% 0.0% 0.0% 0.0% 6.32sec 383609 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 811452 2705 29.38 4591 9176 146.9 146.9 20.3% 0.0% 0.0% 0.0% 2.46sec 1159247 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.98sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy blood_draw 374606 28507 95 0.40 11772 23519 2.0 2.0 21.1% 0.0% 0.0% 0.0% 179.88sec 28507 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy clawing_shadows 207311 2365246 7884 14.09 27890 55699 70.5 70.5 20.4% 0.0% 0.0% 0.0% 4.12sec 2365246 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 46.21sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation_damage 344955 62691 209 1.38 7530 15047 0.0 6.9 20.3% 0.0% 0.0% 0.0% 0.00sec 62691 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_and_decay ticks -43265 80779 269 0.00 733 1466 8.4 0.0 20.3% 0.0% 0.0% 0.0% 36.51sec 80779 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 2189231 7297 19.16 18992 37985 95.8 95.8 20.3% 0.0% 0.0% 0.0% 3.09sec 2189231 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 644958 2150 27.25 4734 0 0.0 136.2 0.0% 0.0% 0.0% 0.0% 0.00sec 644958 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 277620 925 1.36 33985 67974 6.8 6.8 20.3% 0.0% 0.0% 0.0% 46.62sec 396610 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 168.68sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 463557 1545 4.49 17177 34271 22.5 22.5 20.3% 0.0% 0.0% 0.0% 13.33sec 662242 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 751531 2505 19.53 6394 12791 97.7 97.7 20.4% 0.0% 0.0% 0.0% 3.79sec 751531 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound_application 197147 0 0 0.00 0 0 101.5 0.0 0.0% 0.0% 0.0% 0.0% 5.28sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 382154 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 25924 86 2.32 1853 3698 11.6 11.6 20.4% 0.0% 0.0% 0.0% 27.03sec 25924 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak_aoe 196780 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 27.03sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy overwhelming_rage ticks -374037 262771 876 3.94 13334 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.66sec 323121 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.74sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul auto_attack 0 1640416 5468 37.20 7332 14646 186.0 186.0 20.3% 0.0% 0.0% 0.0% 1.61sec 2343512 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 595242 1984 12.52 7891 15790 62.6 62.6 20.4% 0.0% 0.0% 0.0% 4.67sec 595242 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 132133 440 8.00 2745 5482 40.0 40.0 20.5% 0.0% 0.0% 0.0% 7.60sec 188766 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 412 1 0.75 91 182 3.7 3.7 20.8% 0.0% 0.0% 0.0% 90.08sec 588 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 219930 733 3.08 11875 23766 15.4 15.4 20.4% 0.0% 0.0% 0.0% 6.97sec 219930 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 1019199 3397 3.08 55013 110025 15.4 15.4 20.4% 0.0% 0.0% 0.0% 6.97sec 1019199 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.35sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 904530 18091 32.56 27686 55298 27.1 27.1 20.5% 0.0% 0.0% 0.0% 7.85sec 904530 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 117756 393 0.73 26876 53939 3.6 3.6 20.5% 0.0% 0.0% 0.0% 91.81sec 117756 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 20.7 0.0 0.0% 0.0% 0.0% 0.0% 14.14sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 380444 1268 19.90 3177 6353 11.6 99.5 20.4% 0.0% 0.0% 0.0% 27.03sec 380444 300.00sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 595930 1986 4.20 25038 50198 21.0 21.0 13.3% 0.0% 0.0% 0.0% 14.24sec 1318654 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 722724 2409 13.02 9795 19640 21.0 65.1 13.2% 0.0% 0.0% 0.0% 14.24sec 1318654 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 86.1 0.0 0.0% 0.0% 0.0% 0.0% 3.40sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 807452 2692 7.19 19803 39694 36.0 36.0 13.3% 0.0% 0.0% 0.0% 8.41sec 807452 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 2029727 6766 35.85 9991 20029 179.3 179.3 13.3% 0.0% 0.0% 0.0% 1.66sec 2029727 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 17964 60 6.60 544 0 33.0 33.0 0.0% 0.0% 0.0% 0.0% 6.42sec 17964 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 181329 604 0.83 38225 76950 4.1 4.1 14.3% 0.0% 0.0% 0.0% 15.00sec 181329 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage 32409 86445 288 0.82 21197 0 4.1 4.1 0.0% 0.0% 0.0% 0.0% 15.00sec 89167 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowfiend 34433 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 309869 1033 15.83 3916 0 7.0 79.1 0.0% 0.0% 0.0% 0.0% 38.35sec 309869 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 602353 2008 25.56 4159 8333 13.5 127.8 13.3% 0.0% 0.0% 0.0% 21.06sec 602353 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 127.8 0.0 0.0% 0.0% 0.0% 0.0% 2.33sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_shadowfiend melee 0 146684 4191 56.57 3935 7868 33.0 33.0 13.0% 0.0% 0.0% 0.0% 6.42sec 146684 35.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement doom_winds 384352 30113 100 0.75 6664 13387 3.7 3.7 20.9% 0.0% 0.0% 0.0% 90.41sec 43020 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 308.84sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 15.5 0.0 0.0% 0.0% 0.0% 0.0% 20.39sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 107415 358 5.91 3012 6033 29.5 29.5 20.7% 0.0% 0.0% 0.0% 10.03sec 503615 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 396200 1321 36.85 1783 3567 29.5 184.2 20.6% 0.0% 0.0% 0.0% 10.03sec 503615 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 410202 1367 198.36 343 686 991.8 991.8 20.6% 0.0% 0.0% 0.0% 0.68sec 410202 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 369958 1233 5.68 10806 21617 28.4 28.4 20.6% 0.0% 0.0% 0.0% 7.66sec 369958 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 318273 1061 2.85 18561 37103 14.2 14.2 20.4% 0.0% 0.0% 0.0% 19.51sec 318273 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 563806 1879 4.31 21688 43412 21.5 21.5 20.6% 0.0% 0.0% 0.0% 13.79sec 563806 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 529125 1764 4.01 21871 43768 20.0 20.0 20.7% 0.0% 0.0% 0.0% 14.70sec 529125 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 4133391 13778 13.63 50224 100715 68.1 68.1 20.7% 0.0% 0.0% 0.0% 4.37sec 4133391 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 1 535981 1787 38.66 2661 5323 193.3 193.3 20.6% 16.4% 0.0% 0.0% 1.81sec 765707 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 2 268803 896 38.69 1332 2667 193.4 193.4 20.7% 16.4% 0.0% 0.0% 1.80sec 384013 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement overwhelming_rage ticks -374037 262128 874 3.95 13283 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 58.91sec 267385 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.03sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 90.9 0.0 0.0% 0.0% 0.0% 0.0% 3.29sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 1580347 5268 24.22 10820 21658 121.1 121.1 20.6% 0.0% 0.0% 0.0% 2.46sec 2257696 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_mh 390287 364242 1214 10.54 6912 0 52.7 52.7 0.0% 0.0% 0.0% 0.0% 5.62sec 364242 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 790541 2635 24.22 5409 10833 121.1 121.1 20.6% 0.0% 0.0% 0.0% 2.46sec 1129372 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_offhand 390287 182177 607 10.54 3457 0 52.7 52.7 0.0% 0.0% 0.0% 0.0% 5.62sec 182177 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 291712 972 1.20 40228 80354 6.0 6.0 20.5% 0.0% 0.0% 0.0% 50.59sec 291712 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement tempest_strikes 428078 1134000 3780 32.53 5778 11577 162.6 162.6 20.6% 0.0% 0.0% 0.0% 1.84sec 1134000 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_totem 8512 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 114.03sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 2063390 6878 74.99 4556 9134 374.9 374.9 20.7% 0.0% 0.0% 0.0% 2.50sec 2947776 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 26537 431 37.94 566 1131 38.9 38.9 20.6% 0.0% 0.0% 0.0% 2.23sec 37910 61.53sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_spirit_wolf melee 0 907131 7940 201.29 1961 3927 383.3 383.3 20.6% 0.0% 0.0% 0.0% 1.56sec 1295934 114.25sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 311.25sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele elemental_blast 117014 3410779 11369 4.96 113451 227672 24.8 24.8 21.2% 0.0% 0.0% 0.0% 12.22sec 3410779 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele feral_spirit 51533 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 22.12sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock 188389 844774 2816 18.09 7675 15366 90.5 90.5 21.6% 0.0% 0.0% 0.0% 3.32sec 1926238 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock ticks -188389 1081463 3605 39.20 4534 9081 90.5 196.0 21.6% 0.0% 0.0% 0.0% 3.32sec 1926238 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_attack 10444 290038 967 122.06 391 782 610.3 610.3 21.6% 0.0% 0.0% 0.0% 0.74sec 290038 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele forgestorm_ignited_damage 381700 379169 1264 5.77 10808 21616 28.8 28.8 21.6% 0.0% 0.0% 0.0% 7.59sec 379169 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele frost_shock 196840 2135875 7120 8.56 40899 82018 42.8 42.8 21.8% 0.0% 0.0% 0.0% 6.95sec 2135875 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele ice_strike 342240 720349 2401 4.83 24505 49054 24.1 24.1 21.7% 0.0% 0.0% 0.0% 12.54sec 720349 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lava_lash 60103 3780253 12601 14.75 42173 84399 73.7 73.7 21.5% 0.0% 0.0% 0.0% 4.04sec 3780253 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt 188196 1807070 6024 5.73 52004 104058 28.6 28.6 21.4% 0.0% 0.0% 0.0% 10.38sec 1807070 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele main_hand 1 542354 1808 38.79 2656 5318 193.9 193.9 21.6% 16.4% 0.0% 0.0% 1.80sec 774811 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele offhand 2 277798 926 39.64 1332 2666 198.2 198.2 21.6% 16.4% 0.0% 0.0% 1.76sec 396865 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele overwhelming_rage ticks -374037 262535 875 3.95 13283 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 59.17sec 267800 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 303.53sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave 375982 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 46.18sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave_damage 375984 329358 1098 1.39 38895 77964 7.0 7.0 21.3% 0.0% 0.0% 0.0% 46.18sec 329358 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt_pw 188196 920721 3069 1.39 109189 217842 6.9 6.9 21.8% 0.0% 0.0% 0.0% 45.77sec 920721 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike 17364 0 0 0.00 0 0 32.3 0.0 0.0% 0.0% 0.0% 0.0% 9.14sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_mh 32175 378008 1260 6.47 9618 19223 32.3 32.3 21.6% 0.0% 0.0% 0.0% 9.14sec 540025 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_offhand 32176 188943 630 6.47 4808 9619 32.3 32.3 21.5% 0.0% 0.0% 0.0% 9.14sec 269925 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_totem 8512 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 116.98sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_attack 25504 270354 901 23.98 1852 3710 119.9 119.9 21.6% 0.0% 0.0% 0.0% 5.12sec 386230 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_greater_earth_elemental melee 0 31857 501 41.74 592 1186 44.2 44.2 21.6% 0.0% 0.0% 0.0% 2.51sec 45511 63.56sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_fiery_wolf melee 0 286625 8543 214.72 1962 3929 120.1 120.1 21.6% 0.0% 0.0% 0.0% 2.69sec 409474 33.55sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_frost_wolf melee 0 288805 7974 200.55 1961 3930 121.1 121.1 21.6% 0.0% 0.0% 0.0% 2.68sec 412590 36.22sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_lightning_wolf melee 0 286647 8173 205.52 1961 3927 120.1 120.1 21.6% 0.0% 0.0% 0.0% 2.67sec 409507 35.07sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
233191.8 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.6 2.2 22.4s 18.8s 5.5s 22.92% 0.00% 2.2 (2.2) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.1s / 198.0s
  • trigger_min/max:0.1s / 198.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.0s
  • uptime_min/max:4.07% / 43.43%

Stack Uptimes

  • brittle_1:22.92%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.3s 18.8s 5.5s 23.25% 0.00% 2.2 (2.2) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 207.0s
  • trigger_min/max:3.0s / 207.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s
  • uptime_min/max:2.86% / 45.70%

Stack Uptimes

  • brittle_1:23.25%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 114.3 171.5s 2.6s 292.2s 98.18% 0.00% 105.3 (105.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.4s / 326.4s
  • trigger_min/max:0.0s / 16.4s
  • trigger_pct:100.00%
  • duration_min/max:4.2s / 354.6s
  • uptime_min/max:95.18% / 98.52%

Stack Uptimes

  • death_rot_1:0.24%
  • death_rot_2:0.33%
  • death_rot_3:0.67%
  • death_rot_4:0.50%
  • death_rot_5:1.09%
  • death_rot_6:0.68%
  • death_rot_7:0.46%
  • death_rot_8:0.55%
  • death_rot_9:0.60%
  • death_rot_10:93.08%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% from you for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 5.0 237.7 64.4s 1.2s 59.3s 99.03% 0.00% 193.5 (193.5) 4.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 343.6s
  • trigger_min/max:0.0s / 15.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 345.3s
  • uptime_min/max:95.79% / 100.00%

Stack Uptimes

  • everfrost_1:1.67%
  • everfrost_2:1.66%
  • everfrost_3:1.66%
  • everfrost_4:1.65%
  • everfrost_5:1.64%
  • everfrost_6:1.64%
  • everfrost_7:1.63%
  • everfrost_8:1.63%
  • everfrost_9:1.62%
  • everfrost_10:84.22%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 23.1 33.8 13.0s 5.3s 10.6s 81.28% 0.00% 1.9 (2.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 105.7s
  • trigger_min/max:0.0s / 33.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 104.7s
  • uptime_min/max:67.31% / 91.70%

Stack Uptimes

  • festering_wound_1:23.42%
  • festering_wound_2:25.87%
  • festering_wound_3:17.89%
  • festering_wound_4:7.73%
  • festering_wound_5:3.57%
  • festering_wound_6:2.79%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 72.7 3.6s 4.0s 296.7s 98.89% 99.05% 72.7 (72.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.6s / 3.6s
  • trigger_min/max:0.8s / 16.3s
  • trigger_pct:100.00%
  • duration_min/max:236.5s / 358.1s
  • uptime_min/max:98.19% / 99.50%

Stack Uptimes

  • lashing_flames_1:98.89%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.1 58.0 184.3s 5.0s 275.0s 99.08% 0.00% 53.8 (53.8) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 353.3s
  • trigger_min/max:0.9s / 60.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 357.9s
  • uptime_min/max:85.67% / 99.43%

Stack Uptimes

  • razorice_1:1.12%
  • razorice_2:0.89%
  • razorice_3:0.82%
  • razorice_4:0.93%
  • razorice_5:95.32%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Rotten Touch 11.8 7.7 25.2s 15.0s 13.6s 53.53% 0.00% 7.7 (7.7) 11.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rotten_touch
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.4s / 99.3s
  • trigger_min/max:0.8s / 54.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 83.3s
  • uptime_min/max:31.75% / 81.00%

Stack Uptimes

  • rotten_touch_1:53.53%

Spelldata

  • id:390276
  • name:Rotten Touch
  • tooltip:Scourge Strike damage taken from {$@=}auracaster is increased by {$s1=50}%.
  • description:{$@spelldesc390275=Sudden Doom causes your next Death Coil to also increase your {$?s207311=true}[Clawing Shadows][Scourge Strike] damage against the target by {$390276s1=50}% for {$390276d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 236815.88
Minimum 218704.25
Maximum 257164.48
Spread ( max - min ) 38460.23
Range [ ( max - min ) / 2 * 100% ] 8.12%
Standard Deviation 5461.2407
5th Percentile 228157.04
95th Percentile 246007.48
( 95th Percentile - 5th Percentile ) 17850.45
Mean Distribution
Standard Deviation 63.0652
95.00% Confidence Interval ( 236692.28 - 236939.49 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2043
0.1 Scale Factor Error with Delta=300 254605
0.05 Scale Factor Error with Delta=300 1018419
0.01 Scale Factor Error with Delta=300 25460464
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3799
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 83073327 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.