SimulationCraft 1025-01

for World of Warcraft 10.2.5.53584 Live (hotfix 2024-03-05/53584, git build b5077e6890)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust rip spell level requirement
Rip spell_level 11.00 21.00
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 51758 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
51757.8 51757.8 56.3 / 0.109% 9639.8 / 18.6% 4050.1
APS APS Error APS Range APR
168.0 3.8 / 2.281% 434.5 / 258.6% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.4 12.7 Runic Power 2.36% 54.3 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 51758
Abomination Limb 0 (617) 0.0% (1.2%) 3.0 120.94s 61618 49912

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 1.2348 0.0000 0.00 0.00 0.00% 49911.57 49911.57

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [f]:0.12
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
    cooldowns
    [g]:2.85
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
    Abomination Limb (_damage) 617 1.2% 38.0 6.76s 4821 0 Direct 38.0 3660 7344 4820 31.5% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.04 38.04 0.00 0.00 0.00 0.0000 0.0000 183375.11 183375.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.50% 26.06 11 36 3659.77 2382 7080 3662.01 3043 4570 95359 95359 0.00%
crit 31.50% 11.98 1 23 7344.24 4685 13991 7350.25 5167 9552 88016 88016 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
auto_attack_mh 2693 5.2% 193.8 1.80s 4166 2322 Direct 193.8 3623 7251 4166 31.3% 16.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.77 193.77 0.00 0.00 0.00 1.7944 0.0000 807197.86 1153169.20 30.00% 2321.56 2321.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.24% 101.23 62 150 3623.01 2407 7436 3623.58 3368 3906 366757 523953 30.00%
crit 31.35% 60.74 27 95 7250.78 4894 14872 7249.97 6533 8005 440440 629217 30.00%
miss 16.41% 31.80 14 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1313 2.5% 189.3 1.80s 2078 1158 Direct 189.3 1811 3627 2078 31.4% 16.8%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 189.31 189.31 0.00 0.00 0.00 1.7941 0.0000 393387.73 561996.80 30.00% 1158.24 1158.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.82% 98.10 55 141 1810.66 1223 3718 1810.86 1667 1980 177632 253767 30.00%
crit 31.42% 59.48 30 90 3627.04 2407 7354 3626.81 3269 4033 215755 308230 30.00%
miss 16.76% 31.72 12 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 102 0.2% 2.0 0.00s 15077 0 Direct 2.0 11516 23083 15079 30.8% 0.0%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 30154.60 30154.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.21% 1.38 0 2 11515.69 10393 18634 10415.51 0 17931 15940 15940 0.00%
crit 30.79% 0.62 0 2 23082.73 20786 36922 12015.38 0 36922 14215 14215 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Breath of Sindragosa 0 (10751) 0.0% (20.7%) 2.9 120.60s 1089741 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [j]:2.95
  • if_expr:!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
    Breath of Sindragosa (_damage) 10751 20.7% 134.4 2.00s 23914 0 Direct 134.4 18221 36373 23914 31.4% 0.0%

Stats Details: Breath Of Sindragosa Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 134.36 134.36 0.00 0.00 0.00 0.0000 0.0000 3213130.81 3213130.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.64% 92.22 39 147 18220.82 9602 41486 18257.50 16378 21813 1680422 1680422 0.00%
crit 31.36% 42.14 13 81 36372.91 19204 82972 36440.08 31634 44140 1532709 1532709 0.00%

Action Details: Breath Of Sindragosa Damage

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Burnout Wave 736 1.4% 3.0 119.66s 74699 0 Direct 2.8 60343 120648 79379 31.6% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.96 2.78 0.00 0.00 0.00 0.0000 0.0000 220759.13 220759.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.43% 1.90 0 3 60342.62 22015 69346 57499.54 0 69346 114834 114834 0.00%
crit 31.57% 0.88 0 3 120648.12 46231 138692 78146.38 0 138692 105926 105926 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 120 0.2% 5.2 48.67s 6831 5993 Periodic 56.8 480 962 631 31.3% 0.0% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.24 0.00 0.00 56.79 0.00 1.1398 0.0000 35826.35 35826.35 0.00% 5993.03 5993.03
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.71% 39.02 7 81 479.91 312 974 483.77 390 685 18725 18725 0.00%
crit 31.29% 17.77 2 45 962.35 624 1926 970.21 777 1358 17101 17101 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    breath
    [X]:5.24
  • if_expr:variable.st_planning&talent.unholy_ground&!death_and_decay.ticking&runic_power.deficit>=10|runic_power<36&rune.time_to_2>runic_power%18

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Dragon Games Equipment 1232 2.4% 8.3 29.32s 44369 0 Direct 8.3 33767 67542 44403 31.5% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.33 8.32 0.00 0.00 0.00 0.0000 0.0000 369577.07 527980.71 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.51% 5.70 0 9 33767.44 33171 34829 33781.72 0 34829 192550 275078 30.00%
crit 31.49% 2.62 0 8 67541.52 66341 69658 64392.01 0 69658 177027 252903 28.59%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 2622 5.1% 60.3 4.95s 13038 0 Periodic 98.7 6074 12124 7971 31.4% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.34 0.00 98.69 98.69 59.33 0.0000 2.9998 786734.74 786734.74 0.00% 2657.34 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.63% 67.74 41 97 6073.54 119 15137 6073.56 5556 6668 411392 411392 0.00%
crit 31.37% 30.96 13 53 12123.73 14 30613 12123.71 10529 14128 375343 375343 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.33
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountFrost Death Knight1370065PCT0.280
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Frost Strike 2537 (3808) 4.9% (7.4%) 43.7 4.93s 26241 19661 Direct 43.7 (87.5) 13332 26574 17488 31.4% (31.4%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.73 43.73 0.00 0.00 0.00 1.3347 0.0000 764699.11 764699.11 0.00% 19661.13 19661.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.61% 30.00 13 61 13331.59 8140 24695 13310.63 11294 14997 399975 399975 0.00%
crit 31.39% 13.72 2 30 26574.02 16280 46982 26519.08 21554 33739 364724 364724 0.00%

Action Details: Frost Strike

  • id:222026
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}

Action Priority List

    high_prio_actions
    [m]:2.46
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [o]:29.74
  • if_expr:buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
    single_target
    [r]:4.00
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [v]:7.53
  • if_expr:!variable.pooling_runic_power

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountImproved Frost Strike3168031PCT0.200
    Frost Strike Off-Hand 1270 2.5% 43.7 4.93s 8753 0 Direct 43.7 6665 13292 8753 31.5% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.73 43.73 0.00 0.00 0.00 0.0000 0.0000 382724.54 382724.54 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.50% 29.95 12 54 6664.70 4070 12347 6654.69 5852 7584 199613 199613 0.00%
crit 31.50% 13.78 3 31 13291.95 8140 23491 13264.87 10860 16238 183112 183112 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Frost Strike3168031PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Howling Blast 6946 (8320) 13.4% (16.1%) 60.3 4.95s 41264 34438 Direct 60.3 (120.4) 26221 52325 34450 31.5% (31.6%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.34 60.34 0.00 0.00 0.00 1.1982 0.0000 2078846.94 2078846.94 0.00% 34437.84 34437.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.48% 41.32 20 64 26221.01 2675 62654 26227.49 22817 30413 1083473 1083473 0.00%
crit 31.52% 19.02 4 34 52325.23 5349 125307 52333.75 40928 63050 995374 995374 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [T]:37.87
  • if_expr:variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
    breath
    [Y]:0.61
  • if_expr:runic_power<36&rune.time_to_2>runic_power%18
    breath
    [a]:0.17
  • if_expr:buff.rime.react
    single_target
    [q]:21.70
  • if_expr:buff.rime.react&talent.icebreaker.rank=2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Rime5905223.000Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Percent Cost Rime590521-1.000Spell Data
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
    Avalanche 1374 2.7% 60.1 4.97s 6842 0 Direct 60.1 5205 10383 6842 31.6% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.09 60.09 0.00 0.00 0.00 0.0000 0.0000 411146.56 411146.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.38% 41.09 21 63 5204.74 2842 12417 5205.92 4672 5979 213867 213867 0.00%
crit 31.62% 19.00 5 37 10382.70 5684 24047 10382.30 8706 12748 197280 197280 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Obliterate 1388 (11670) 2.7% (22.6%) 47.0 6.28s 74409 27620 Direct 47.0 (208.9) 6734 13489 8844 31.2% (69.0%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 47.01 47.01 0.00 0.00 0.00 2.6940 0.0000 415727.31 593911.30 30.00% 27620.41 27620.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.77% 32.33 13 54 6733.72 4476 13967 6741.39 5825 7815 217671 310966 30.00%
crit 31.23% 14.68 0 29 13489.46 8953 27933 13492.34 0 18184 198056 282945 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]

Action Priority List

    breath
    [V]:24.78
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [W]:29.83
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Z]:5.08
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [p]:26.99
  • if_expr:buff.killing_machine.react
    single_target
    [s]:17.78
  • if_expr:!variable.pooling_runes

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
    Obliterate Off-Hand 694 1.3% 47.0 6.28s 4419 0 Direct 47.0 3367 6744 4419 31.1% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 47.01 47.01 0.00 0.00 0.00 0.0000 0.0000 207725.41 296758.15 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.85% 32.37 12 55 3366.99 2238 6983 3370.98 2914 3933 108974 155681 30.00%
crit 31.15% 14.64 3 31 6744.18 4476 13967 6745.67 5411 8549 98752 141077 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
    Obliterate (_km) 6393 12.4% 57.5 5.15s 33353 0 Direct 57.5 0 33354 33354 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.45 57.45 0.00 0.00 0.00 0.0000 0.0000 1916208.64 1916208.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 57.45 32 87 33353.61 18677 81607 33331.89 29796 37113 1916209 1916209 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
    Obliterate Off-Hand (_km) 3196 6.2% 57.5 5.15s 16677 0 Direct 57.5 0 16677 16677 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.45 57.45 0.00 0.00 0.00 0.0000 0.0000 958104.32 958104.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 57.45 32 87 16676.80 9339 40804 16665.94 14898 18556 958104 958104 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Raise Dead 0 (1405) 0.0% (2.7%) 3.0 121.50s 142348 0

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [k]:2.96
    auto_attack 1747  / 945 1.8% 96.6 2.85s 2931 1929 Direct 96.6 2227 4467 2931 31.4% 0.0%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.64 96.64 0.00 0.00 0.00 1.5189 0.0000 283202.12 404584.77 30.00% 1929.37 1929.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.59% 66.28 38 94 2227.04 1426 4400 2230.17 1986 2572 147617 210887 30.00%
crit 31.41% 30.35 10 52 4466.87 2852 8800 4473.40 3846 5284 135585 193698 30.00%

Action Details: Auto Attack

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:2.92
    Claw 850  / 459 0.9% 52.8 5.30s 2609 2609 Direct 52.8 1983 3972 2609 31.5% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.76 52.76 0.00 0.00 0.00 1.0000 0.0000 137665.18 196669.55 30.00% 2609.47 2609.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.50% 36.14 17 53 1982.67 1283 3960 1985.03 1769 2309 71651 102362 30.00%
crit 31.50% 16.62 4 31 3972.50 2527 8009 3976.59 3192 5196 66014 94308 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.76
  • if_expr:energy>70
    Gnaw 2  / 1 0.0% 2.9 121.51s 88 88 Direct 2.9 67 134 88 31.2% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.90 2.90 0.00 0.00 0.00 1.0000 0.0000 254.19 363.14 30.00% 87.59 87.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.80% 2.00 0 3 66.72 45 111 64.52 0 111 133 190 28.95%
crit 31.20% 0.91 0 3 133.50 91 223 88.04 0 223 121 173 19.77%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.90
Remorseless Winter 0 (5952) 0.0% (11.5%) 15.2 20.38s 117102 93651

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.23 0.00 0.00 0.00 0.00 1.2505 0.0000 0.00 0.00 0.00% 93651.08 93651.08

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    high_prio_actions
    [n]:15.23
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5952 11.5% 239.4 1.25s 7449 0 Direct 239.4 5672 11329 7449 31.4% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 239.41 239.41 0.00 0.00 0.00 0.0000 0.0000 1783397.56 1783397.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.59% 164.20 109 218 5672.31 1254 17728 5673.28 4803 6531 931382 931382 0.00%
crit 31.41% 75.21 41 112 11328.71 2508 35457 11329.68 8997 13640 852015 852015 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Periodic AmountBiting Cold3770562PCT0.350
Spell Direct AmountBiting Cold3770563PCT0.350

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Gathering Storm21180510.100Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Everfrost37697410.060
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Strike Twice 208 0.4% 20.4 14.27s 3055 0 Direct 20.4 2323 4647 3055 31.5% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.42 20.42 0.00 0.00 0.00 0.0000 0.0000 62392.22 89134.02 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.50% 13.99 3 30 2323.29 2296 2411 2323.22 2296 2392 32500 46430 30.00%
crit 31.50% 6.43 0 17 4646.55 4593 4822 4641.42 0 4822 29892 42704 29.97%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 209 0.4% 20.5 14.16s 3057 0 Direct 20.5 2323 4646 3057 31.6% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.51 20.51 0.00 0.00 0.00 0.0000 0.0000 62706.34 89582.76 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.42% 14.04 4 30 2323.15 2296 2411 2323.11 2296 2382 32609 46586 30.00%
crit 31.58% 6.48 0 17 4646.36 4593 4822 4641.89 0 4822 30097 42997 29.97%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Frost 0
Anti-Magic Shell 170 101.1% 6.8 42.73s 7547 0 Direct 3.2 16014 0 16014 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.76 3.19 0.00 0.00 0.00 0.0000 0.0000 51056.08 51056.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.19 0 13 16013.62 16014 16014 13807.71 0 16014 51056 51056 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [l]:6.77
  • if_expr:runic_power.deficit>40&death_knight.first_ams_cast<time

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownAnti-Magic Barrier2057271ADD-20000.000
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Arcane Torrent 1.9 145.20s

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.93 0.00 0.00 0.00 0.00 1.2568 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [b]:0.88
  • if_expr:runic_power<60
    single_target
    [u]:1.05
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 4.0 83.39s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [d]:0.31
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
    cooldowns
    [e]:3.65
  • if_expr:buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929621SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929631SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382154
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 3.9 76.50s

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.89 0.00 0.00 0.00 0.00 1.1719 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [U]:3.01
  • if_expr:rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
    single_target
    [t]:0.88
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Pillar of Frost 8.7 35.91s

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.70 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [h]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [i]:8.38
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Elemental Potion of Ultimate Power 1.5 304.81s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [c]:1.45
  • if_expr:(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
Unholy Strength 20.5 14.19s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.51 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.9s 120.9s 11.8s 11.80% 0.00% 32.2 (32.2) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 123.8s
  • trigger_min/max:120.0s / 123.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:9.80% / 14.21%

Stack Uptimes

  • abomination_limb_1:11.80%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Anti-Magic Shell 6.8 0.0 42.7s 42.7s 6.9s 15.59% 18.69% 0.0 (0.0) 6.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.40
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 82.6s
  • trigger_min/max:40.0s / 82.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:11.04% / 18.11%

Stack Uptimes

  • antimagic_shell_1:15.59%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 10.6 37.2 29.1s 6.2s 18.8s 66.22% 0.00% 0.0 (0.0) 3.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 77.4s
  • trigger_min/max:0.9s / 48.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.6s
  • uptime_min/max:48.33% / 82.69%

Stack Uptimes

  • bonegrinder_crit_1:17.23%
  • bonegrinder_crit_2:14.86%
  • bonegrinder_crit_3:12.93%
  • bonegrinder_crit_4:11.27%
  • bonegrinder_crit_5:9.93%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 6.0 0.0 48.7s 48.7s 9.8s 19.56% 16.55% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:17.2s / 239.7s
  • trigger_min/max:17.2s / 239.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.84% / 31.51%

Stack Uptimes

  • bonegrinder_frost_1:19.56%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 3.0 14.7 120.5s 15.1s 19.4s 19.24% 0.00% 2.0 (2.0) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 125.9s
  • trigger_min/max:0.0s / 116.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:16.09% / 22.71%

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.86%
  • bound_by_fire_and_blaze_2:4.31%
  • bound_by_fire_and_blaze_3:4.23%
  • bound_by_fire_and_blaze_4:3.69%
  • bound_by_fire_and_blaze_5:2.77%
  • bound_by_fire_and_blaze_6:3.37%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.6s 120.6s 45.5s 44.88% 0.00% 134.0 (134.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 125.1s
  • trigger_min/max:120.0s / 125.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 104.0s
  • uptime_min/max:22.79% / 66.08%

Stack Uptimes

  • breath_of_sindragosa_1:44.88%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.2s 58.5s 50.1s 80.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 341.0s
  • trigger_min/max:15.0s / 340.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.4s
  • uptime_min/max:41.30% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.16%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dragon Games Equipment 2.8 0.0 120.5s 120.5s 0.8s 0.76% 0.00% 8.3 (8.3) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.82
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 126.0s
  • trigger_min/max:120.0s / 126.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s
  • uptime_min/max:0.61% / 0.93%

Stack Uptimes

  • dragon_games_equipment_1:0.76%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 304.8s 304.8s 27.1s 12.87% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.5s
  • trigger_min/max:300.0s / 328.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.74% / 17.90%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.87%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 83.7s 83.3s 19.6s 25.87% 0.00% 11.6 (11.6) 3.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 295.7s
  • trigger_min/max:0.0s / 295.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.5s
  • uptime_min/max:16.94% / 30.22%

Stack Uptimes

  • empower_rune_weapon_1:25.87%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 8.4 0.0 35.9s 35.9s 12.7s 35.39% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.0s / 51.1s
  • trigger_min/max:26.0s / 51.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 26.0s
  • uptime_min/max:25.26% / 47.43%

Stack Uptimes

  • enduring_strength_1:35.39%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 8.6 21.0 36.2s 9.8s 10.0s 28.66% 98.97% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.4s / 116.1s
  • trigger_min/max:0.9s / 109.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:18.00% / 35.80%

Stack Uptimes

  • enduring_strength_builder_1:10.28%
  • enduring_strength_builder_2:8.82%
  • enduring_strength_builder_3:5.54%
  • enduring_strength_builder_4:2.57%
  • enduring_strength_builder_5:1.03%
  • enduring_strength_builder_6:0.33%
  • enduring_strength_builder_7:0.07%
  • enduring_strength_builder_8:0.01%
  • enduring_strength_builder_9:0.00%
  • enduring_strength_builder_10:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storm 12.8 123.5 24.4s 2.2s 15.5s 66.16% 85.81% 70.8 (110.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.2s / 104.2s
  • trigger_min/max:0.9s / 32.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 94.1s
  • uptime_min/max:52.46% / 77.44%

Stack Uptimes

  • gathering_storm_1:2.45%
  • gathering_storm_2:5.50%
  • gathering_storm_3:4.77%
  • gathering_storm_4:3.99%
  • gathering_storm_5:5.11%
  • gathering_storm_6:3.69%
  • gathering_storm_7:3.65%
  • gathering_storm_8:2.80%
  • gathering_storm_9:2.21%
  • gathering_storm_10:31.97%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 1.0 176.7 160.3s 1.7s 291.5s 97.94% 0.00% 174.7 (174.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:106.9s / 303.9s
  • trigger_min/max:1.0s / 13.5s
  • trigger_pct:100.00%
  • duration_min/max:3.3s / 354.8s
  • uptime_min/max:96.74% / 98.58%

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.26%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 45.3 14.4 6.6s 5.0s 2.4s 35.65% 55.00% 1.8 (1.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 51.9s
  • trigger_min/max:0.0s / 42.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 50.8s
  • uptime_min/max:19.03% / 55.41%

Stack Uptimes

  • killing_machine_1:30.06%
  • killing_machine_2:5.59%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 8.7 0.0 35.9s 35.9s 11.8s 34.16% 36.12% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.0s / 51.1s
  • trigger_min/max:26.0s / 51.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:29.72% / 39.52%

Stack Uptimes

  • pillar_of_frost_1:34.16%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 8.7 57.9 36.0s 4.3s 11.4s 33.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:25.4s / 52.2s
  • trigger_min/max:0.9s / 41.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:28.62% / 38.42%

Stack Uptimes

  • pillar_of_frost_bonus_1:1.92%
  • pillar_of_frost_bonus_2:3.27%
  • pillar_of_frost_bonus_3:3.47%
  • pillar_of_frost_bonus_4:2.86%
  • pillar_of_frost_bonus_5:3.41%
  • pillar_of_frost_bonus_6:3.22%
  • pillar_of_frost_bonus_7:2.94%
  • pillar_of_frost_bonus_8:2.71%
  • pillar_of_frost_bonus_9:1.94%
  • pillar_of_frost_bonus_10:1.37%
  • pillar_of_frost_bonus_11:1.15%
  • pillar_of_frost_bonus_12:1.00%
  • pillar_of_frost_bonus_13:0.93%
  • pillar_of_frost_bonus_14:0.83%
  • pillar_of_frost_bonus_15:0.64%
  • pillar_of_frost_bonus_16:0.46%
  • pillar_of_frost_bonus_17:0.31%
  • pillar_of_frost_bonus_18:0.21%
  • pillar_of_frost_bonus_19:0.18%
  • pillar_of_frost_bonus_20:0.14%
  • pillar_of_frost_bonus_21:0.07%
  • pillar_of_frost_bonus_22:0.02%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 12.9 2.4 24.3s 20.4s 17.4s 74.85% 0.00% 220.1 (220.1) 12.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 102.2s
  • trigger_min/max:20.0s / 27.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 96.2s
  • uptime_min/max:64.16% / 83.33%

Stack Uptimes

  • remorseless_winter_1:74.85%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 60.5 10.9 5.0s 4.2s 2.0s 39.79% 99.58% 10.9 (10.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 44.4s
  • trigger_min/max:0.0s / 41.5s
  • trigger_pct:63.13%
  • duration_min/max:0.0s / 33.7s
  • uptime_min/max:24.87% / 54.10%

Stack Uptimes

  • rime_1:39.79%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.5 14.3 22.3s 10.5s 11.8s 52.99% 0.00% 14.3 (14.3) 13.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 141.1s
  • trigger_min/max:0.9s / 141.1s
  • trigger_pct:15.02%
  • duration_min/max:0.0s / 97.2s
  • uptime_min/max:19.93% / 79.45%

Stack Uptimes

  • rune_mastery_1:52.99%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.9 7.6 23.1s 14.2s 10.1s 43.55% 42.39% 7.6 (7.6) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 80.0s
  • trigger_min/max:0.0s / 62.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.5s
  • uptime_min/max:23.93% / 66.06%

Stack Uptimes

  • rune_of_hysteria_1:43.55%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Ground 5.1 0.1 50.4s 48.7s 10.0s 17.02% 0.00% 0.1 (0.1) 4.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 269.0s
  • trigger_min/max:1.2s / 269.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.8s
  • uptime_min/max:3.08% / 33.72%

Stack Uptimes

  • unholy_ground_1:17.02%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 12.1 36.1s 14.2s 23.7s 66.68% 0.00% 12.1 (12.1) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 197.2s
  • trigger_min/max:0.0s / 60.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 173.4s
  • uptime_min/max:38.93% / 92.71%

Stack Uptimes

  • unholy_strength_1:66.68%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 1.0 176.7 160.3s 1.7s 291.5s 97.94% 0.00% 174.7 (174.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:106.9s / 303.9s
  • trigger_min/max:1.0s / 13.5s
  • trigger_pct:100.00%
  • duration_min/max:3.3s / 354.8s
  • uptime_min/max:96.74% / 98.58%

Stack Uptimes

  • unleashed_frenzy_1:0.34%
  • unleashed_frenzy_2:0.34%
  • unleashed_frenzy_3:97.26%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=10 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (sizzling_seafood_medley)

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_sizzling_seafood_medley
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382154
  • name:Well Fed
  • tooltip:Haste and mastery increased by {$=}w1.
  • description:Increases Haste and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 27.0 9.0 51.0 10.8s 1.2s 129.0s
Windfury (Off Hand) 22.6 6.0 43.0 12.9s 1.2s 141.0s
Killing Machine spent on Obliterate 57.5 32.0 87.0 5.2s 0.9s 42.0s
Killing Machine: Critical auto attacks 57.9 32.0 87.0 5.5s 1.2s 42.2s
Killing Machine wasted: Critical auto attacks 1.8 0.0 12.0 61.1s 1.2s 327.6s
Rune ready 225.9 164.0 288.0 1.4s 0.0s 12.9s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.58% 0.00% 9.15% 0.7s 0.0s 7.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Horn of Winter29.1930.000264.446135.53960.088300.736
Remorseless Winter0.3470.0007.5175.2930.53916.221
Death and Decay20.1300.000236.262151.39830.879299.520
Empower Rune Weapon1.3640.00083.1805.3914.11888.332
Abomination Limb0.9620.0003.7622.8681.0296.826
Pillar of Frost1.3630.0008.10111.8715.01422.849
Breath of Sindragosa2.1140.0006.1866.2374.12111.102
Raise Dead1.6870.0004.3294.9992.3698.210
Anti-Magic Shell6.9130.00058.19147.33521.77396.589

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=453806)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0711.399 / 1.1643.81324.585
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
16.78946.42384.639 / 82.365131.021202.572

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Anti-Magic ShellRunic Power3.1915.520.41%4.870.422.62%
Breath of SindragosaRune11.1210.764.76%0.970.363.21%
Empower Rune WeaponRunic Power19.1789.502.35%4.676.346.62%
Empower Rune WeaponRune19.1718.988.40%0.990.191.00%
Frost FeverRunic Power32.66156.054.09%4.787.254.44%
Horn of WinterRunic Power3.8997.242.55%25.000.000.00%
Horn of WinterRune7.787.783.44%1.000.000.00%
Murderous EfficiencyRune28.7228.7212.71%1.000.000.00%
Rage of the Frozen ChampionRunic Power60.09472.8812.41%7.877.861.63%
Rune RegenerationRune85.8485.8438.00%1.000.000.00%
Rune of HysteriaRunic Power159.83327.738.60%2.0525.807.30%
Runic AttenuationRunic Power72.15349.489.17%4.8411.283.13%
Runic EmpowermentRune74.4873.8432.68%0.990.640.86%
Arcane TorrentRunic Power1.9338.601.01%20.000.000.00%
Death and DecayRunic Power5.2452.451.38%10.000.000.00%
Howling BlastRunic Power60.342.520.07%0.040.000.00%
ObliterateRunic Power104.462061.9554.10%19.7427.251.30%
Remorseless WinterRunic Power15.23147.253.86%9.675.043.31%
pet - ghoul
Energy RegenEnergy1091.461953.65100.00%1.79167.007.87%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_damage)Runic Power 134.032412.5464.78%18.0017.961331.84
Death and DecayRune 5.245.242.28%1.001.006830.70
Frost StrikeRunic Power 43.731311.7835.22%30.0030.00874.71
Howling BlastRune 60.340.250.11%0.000.009882244.05
ObliterateRune 104.46208.9290.97%2.004.4416742.18
Remorseless WinterRune 15.2315.236.63%1.001.00117102.01
pet - ghoul
ClawEnergy 52.762110.29100.00%40.0040.0065.24
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 330760.0 760.48 884.26 260376.8 293625.6 -73694.5 330760.0
Runic Power 0.0 12.70 12.41 91.2 86.9 0.3 124.0
Rune 6.0 0.75 0.77 0.0 2.3 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 51757.78
Minimum 44014.91
Maximum 60356.12
Spread ( max - min ) 16341.21
Range [ ( max - min ) / 2 * 100% ] 15.79%
Standard Deviation 2485.6101
5th Percentile 47818.04
95th Percentile 55938.58
( 95th Percentile - 5th Percentile ) 8120.54
Mean Distribution
Standard Deviation 28.7033
95.00% Confidence Interval ( 51701.52 - 51814.04 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 89
0.1% Error 8860
0.1 Scale Factor Error with Delta=300 52742
0.05 Scale Factor Error with Delta=300 210965
0.01 Scale Factor Error with Delta=300 5274117
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 51757.78
Minimum 44014.91
Maximum 60356.12
Spread ( max - min ) 16341.21
Range [ ( max - min ) / 2 * 100% ] 15.79%
Standard Deviation 2485.6101
5th Percentile 47818.04
95th Percentile 55938.58
( 95th Percentile - 5th Percentile ) 8120.54
Mean Distribution
Standard Deviation 28.7033
95.00% Confidence Interval ( 51701.52 - 51814.04 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 89
0.1% Error 8860
0.1 Scale Factor Error with Delta=300 52742
0.05 Scale Factor Error with Delta=300 210965
0.01 Scale Factor Error with Delta=300 5274117
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 51757.78
Minimum 44014.91
Maximum 60356.12
Spread ( max - min ) 16341.21
Range [ ( max - min ) / 2 * 100% ] 15.79%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 15083822.33
Minimum 10599121.21
Maximum 19612756.76
Spread ( max - min ) 9013635.55
Range [ ( max - min ) / 2 * 100% ] 29.88%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 883.62
Minimum 0.00
Maximum 2655.29
Spread ( max - min ) 2655.29
Range [ ( max - min ) / 2 * 100% ] 150.25%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 758.50
Minimum 0.00
Maximum 1840.92
Spread ( max - min ) 1840.92
Range [ ( max - min ) / 2 * 100% ] 121.35%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
B 0.00 variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
E 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
F 0.00 variable,name=2h_check,value=main_hand.2h
G 0.00 variable,name=erw_pooling_time,op=setif,value=30,value_else=45,condition=death_knight.ams_absorb_percent>0.59
Protects Breath from starving itself on ERW charges depending on anticipated resource gains. More resources enable more aggressive use.
Default action list Executed every time the actor is available.
# count action,conditions
H 1.00 auto_attack
I 0.00 call_action_list,name=variables
Choose Action list to run
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=high_prio_actions
L 0.00 call_action_list,name=cooldowns
M 0.00 call_action_list,name=racials
N 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
O 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
P 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
Q 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
R 0.00 call_action_list,name=aoe,if=active_enemies>=2
S 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
T 37.87 howling_blast,if=variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
Breath Active Rotation
U 3.01 horn_of_winter,if=rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
V 24.78 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&(buff.killing_machine.react|runic_power>45)
W 29.83 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up
0.00 remorseless_winter,if=runic_power<36&rune.time_to_2>runic_power%18
X 5.24 death_and_decay,if=variable.st_planning&talent.unholy_ground&!death_and_decay.ticking&runic_power.deficit>=10|runic_power<36&rune.time_to_2>runic_power%18
Y 0.61 howling_blast,if=runic_power<36&rune.time_to_2>runic_power%18
Z 5.08 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
a 0.17 howling_blast,if=buff.rime.react
b 0.88 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
c 1.45 potion,if=(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
Cooldowns
d 0.31 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
e 3.65 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
f 0.12 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
g 2.85 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=set_bonus.tier31_2pc&buff.chilling_rage.remains<3
0.00 chill_streak,if=!set_bonus.tier31_2pc&active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
h 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
i 8.38 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
j 2.95 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
k 2.96 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react&rune>2|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>50|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.high_prio_actions
# count action,conditions
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
l 6.77 antimagic_shell,if=runic_power.deficit>40&death_knight.first_ams_cast<time
0.00 antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.ready|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up))
0.00 antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&((!talent.obliteration|talent.obliteration&(!cooldown.pillar_of_frost.ready|buff.pillar_of_frost.up&!buff.killing_machine.react))|(equipped.fyralath_the_dreamrender&!dot.mark_of_fyralath.ticking))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
m 2.46 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
n 15.23 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target
# count action,conditions
o 29.74 frost_strike,if=buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
Single Target Rotation
0.00 howling_blast,if=buff.rime.react&set_bonus.tier30_2pc&buff.killing_machine.stack<2
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
p 26.99 obliterate,if=buff.killing_machine.react
q 21.70 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)&talent.obliteration&talent.breath_of_sindragosa
r 4.00 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
s 17.78 obliterate,if=!variable.pooling_runes
t 0.88 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
u 1.05 arcane_torrent,if=runic_power.deficit>20
v 7.53 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.pillar_of_frost.up&!buff.empower_rune_weapon.up&!death_and_decay.ticking&(active_enemies<2|dot.frost_fever.ticking)
Trinkets
0.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
w 2.96 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&((variable.damage_trinket_priority=1|trinket.2.cooldown.remains)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
x 2.78 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&((variable.damage_trinket_priority=2|trinket.1.cooldown.remains)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGHngkqspjweicTWTTVWWTWTUVTVTXnVTZTxZlWTXeVVTVZTiVVnbVVVWXVYstnsmsrlvpqvpipopoqnpoqovvppqsmvvsnqsmqpoolipqopopqngkojwTVWTVeTWTTVTWVnWTWxTVUTiWlTWVWWTXnpqsuovvsqpqmsqpnmiqopqolsqosoopsnoqpopopovsvsiqvnsvpsqolvssqosovngjwkTVTVTVWWWiTeWTUVnTxVTVTVXlWTZTWZTVTnVWTVTWTWhVTV

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 4 trinket_1_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 5 trinket_2_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 6 trinket_1_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 7 trinket_2_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat A trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat B damage_trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat E rw_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat F 2h_check PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat G erw_pooling_time PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
0:00.000 default H auto_attack Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
0:00.000 high_prio_actions n remorseless_winter Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune		 bloodlust, corrupting_rage
0:01.031 cooldowns g abomination_limb Fluffy_Pillow 10.0/124: 8% runic_power
5.0/6: 83% rune		 bloodlust, remorseless_winter, corrupting_rage
0:02.062 cooldowns k raise_dead PR_Death_Knight_Frost 10.0/124: 8% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, abomination_limb, remorseless_winter, rime, corrupting_rage
0:02.062 single_target q howling_blast Fluffy_Pillow 10.0/124: 8% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, abomination_limb, remorseless_winter, rime, corrupting_rage
0:03.093 single_target s obliterate Fluffy_Pillow 18.0/124: 15% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, abomination_limb, gathering_storm, remorseless_winter, corrupting_rage
0:04.124 single_target p obliterate Fluffy_Pillow 38.0/124: 31% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, gathering_storm(3), killing_machine, remorseless_winter, rime, corrupting_rage
0:05.155 cooldowns j breath_of_sindragosa Fluffy_Pillow 69.0/124: 56% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, corrupting_rage
0:05.155 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 69.0/124: 56% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, corrupting_rage
0:05.155 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 69.0/124: 56% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, corrupting_rage
0:05.155 cooldowns i pillar_of_frost PR_Death_Knight_Frost 75.2/124: 61% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, corrupting_rage
0:05.155 cooldowns c potion Fluffy_Pillow 75.2/124: 61% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, corrupting_rage
0:05.155 breath T howling_blast Fluffy_Pillow 75.2/124: 61% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, corrupting_rage, elemental_potion_of_ultimate_power
0:06.051 breath W obliterate Fluffy_Pillow 91.3/124: 74% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit, bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:06.948 breath T howling_blast Fluffy_Pillow 104.3/124: 84% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, icy_talons, breath_of_sindragosa, gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy, bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:07.845 breath T howling_blast Fluffy_Pillow 96.2/124: 78% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, icy_talons(2), breath_of_sindragosa, gathering_storm(9), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(2), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:08.742 breath V obliterate Fluffy_Pillow 94.4/124: 76% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:09.639 breath W obliterate Fluffy_Pillow 107.4/124: 87% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:10.536 breath W obliterate Fluffy_Pillow 106.0/124: 85% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:11.432 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:12.328 breath W obliterate Fluffy_Pillow 104.1/124: 84% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:13.224 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
0.0/6: 0% rune		 bloodlust, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:14.121 Waiting     1.063s 122.1/124: 98% runic_power
0.0/6: 0% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:15.184 breath U horn_of_winter PR_Death_Knight_Frost 92.3/124: 74% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage, elemental_potion_of_ultimate_power
0:16.081 breath V obliterate Fluffy_Pillow 123.3/124: 99% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage, elemental_potion_of_ultimate_power
0:16.978 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(17), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage, elemental_potion_of_ultimate_power
0:17.874 breath V obliterate Fluffy_Pillow 104.1/124: 84% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:18.771 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:19.668 breath X death_and_decay Fluffy_Pillow 97.9/124: 79% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:20.565 high_prio_actions n remorseless_winter Fluffy_Pillow 98.5/124: 79% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:21.420 breath V obliterate Fluffy_Pillow 99.1/124: 80% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:22.275 breath T howling_blast Fluffy_Pillow 105.9/124: 85% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:23.130 Waiting     0.098s 115.8/124: 93% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_potion_of_ultimate_power
0:23.228 breath Z obliterate Fluffy_Pillow 97.8/124: 79% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_potion_of_ultimate_power
0:24.083 breath T howling_blast Fluffy_Pillow 117.8/124: 95% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_potion_of_ultimate_power
0:24.938 Waiting     0.287s 106.0/124: 85% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_potion_of_ultimate_power
0:25.225 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 93.0/124: 75% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:25.225 breath Z obliterate Fluffy_Pillow 93.0/124: 75% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), dragon_games_equipment, elemental_potion_of_ultimate_power
0:26.206 Waiting     0.977s 100.0/124: 81% runic_power
0.0/6: 0% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:27.183 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 82.0/124: 66% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:27.183 Waiting     0.280s 82.0/124: 66% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:27.463 breath W obliterate Fluffy_Pillow 82.0/124: 66% runic_power
3.0/6: 50% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:28.444 breath T howling_blast Fluffy_Pillow 89.0/124: 72% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:29.426 Waiting     0.272s 89.0/124: 72% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:29.698 breath X death_and_decay Fluffy_Pillow 89.0/124: 72% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:30.729 Waiting     0.458s 81.0/124: 65% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:31.187 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 68.0/124: 55% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:31.187 breath V obliterate Fluffy_Pillow 73.0/124: 59% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:32.042 Waiting     0.174s 98.0/124: 79% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:32.216 breath V obliterate Fluffy_Pillow 80.0/124: 65% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:33.071 breath T howling_blast Fluffy_Pillow 100.0/124: 81% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:33.925 breath V obliterate Fluffy_Pillow 95.0/124: 77% runic_power
3.0/6: 50% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:34.780 breath Z obliterate Fluffy_Pillow 97.0/124: 78% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:35.635 breath T howling_blast Fluffy_Pillow 99.0/124: 80% runic_power
0.0/6: 0% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3)
0:36.490 Waiting     0.461s 95.2/124: 77% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3)
0:36.951 cooldowns i pillar_of_frost PR_Death_Knight_Frost 95.2/124: 77% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3)
0:37.155 Waiting     1.263s 83.4/124: 67% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3)
0:38.418 breath V obliterate Fluffy_Pillow 71.6/124: 58% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
0:39.273 breath V obliterate Fluffy_Pillow 78.4/124: 63% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
0:40.128 Waiting     1.116s 109.4/124: 88% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:41.244 high_prio_actions n remorseless_winter Fluffy_Pillow 85.8/124: 69% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:42.408 Waiting     1.798s 80.2/124: 65% runic_power
1.0/6: 17% rune		 rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:44.206 breath b arcane_torrent PR_Death_Knight_Frost 44.2/124: 36% runic_power
1.0/6: 17% rune		 rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:45.371 breath V obliterate Fluffy_Pillow 57.2/124: 46% runic_power
2.0/6: 33% rune		 empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:46.535 breath V obliterate Fluffy_Pillow 69.2/124: 56% runic_power
2.0/6: 33% rune		 empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:47.699 breath V obliterate Fluffy_Pillow 71.2/124: 57% runic_power
4.0/6: 67% rune		 empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
0:48.864 breath W obliterate Fluffy_Pillow 78.2/124: 63% runic_power
2.0/6: 33% rune		 empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(5), unleashed_frenzy(3), corrupting_rage
0:50.029 Waiting     1.221s 80.2/124: 65% runic_power
0.0/6: 0% rune		 empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:51.250 breath X death_and_decay Fluffy_Pillow 54.2/124: 44% runic_power
1.0/6: 17% rune		 icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:52.590 Waiting     2.251s 51.2/124: 41% runic_power
0.0/6: 0% rune		 unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:54.841 breath V obliterate Fluffy_Pillow 20.2/124: 16% runic_power
2.0/6: 33% rune		 unholy_ground, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:56.117 breath Y howling_blast Fluffy_Pillow 32.2/124: 26% runic_power
1.0/6: 17% rune		 unholy_ground, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:57.393 single_target s obliterate Fluffy_Pillow 4.2/124: 3% runic_power
3.0/6: 50% rune		 unholy_ground, rune_of_hysteria, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:58.669 Waiting     1.346s 29.0/124: 23% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_ground, rune_of_hysteria, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:00.015 single_target t horn_of_winter PR_Death_Knight_Frost 29.0/124: 23% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_ground, rune_of_hysteria, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:01.460 high_prio_actions n remorseless_winter Fluffy_Pillow 60.0/124: 48% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:02.799 single_target s obliterate Fluffy_Pillow 84.8/124: 68% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:04.139 high_prio_actions m frost_strike Fluffy_Pillow 109.6/124: 88% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:05.478 single_target s obliterate Fluffy_Pillow 79.6/124: 64% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:06.818 single_target r frost_strike Fluffy_Pillow 99.6/124: 80% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(4), killing_machine(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:08.158 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 69.6/124: 56% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(4), killing_machine(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:08.158 single_target v frost_strike Fluffy_Pillow 69.6/124: 56% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(4), killing_machine(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:09.498 single_target p obliterate Fluffy_Pillow 45.8/124: 37% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(4), killing_machine(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:10.837 single_target q howling_blast Fluffy_Pillow 70.6/124: 57% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(6), killing_machine(2), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:12.177 single_target v frost_strike Fluffy_Pillow 80.5/124: 65% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(7), killing_machine(2), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:13.516 single_target p obliterate Fluffy_Pillow 56.7/124: 46% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:14.855 cooldowns i pillar_of_frost PR_Death_Knight_Frost 81.5/124: 66% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:14.855 single_target p obliterate Fluffy_Pillow 81.5/124: 66% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), pillar_of_frost, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:16.195 single_target o frost_strike Fluffy_Pillow 106.3/124: 86% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:17.535 single_target p obliterate Fluffy_Pillow 82.5/124: 67% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:18.874 single_target o frost_strike Fluffy_Pillow 113.5/124: 92% runic_power
0.0/6: 0% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:20.214 single_target q howling_blast Fluffy_Pillow 89.7/124: 72% runic_power
0.0/6: 0% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:21.554 high_prio_actions n remorseless_winter Fluffy_Pillow 99.6/124: 80% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:22.894 single_target p obliterate Fluffy_Pillow 112.0/124: 90% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:24.234 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
1:25.574 single_target q howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
1.0/6: 17% rune		 rune_of_hysteria, icy_talons(3), gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
1:26.914 single_target o frost_strike Fluffy_Pillow 116.3/124: 94% runic_power
1.0/6: 17% rune		 rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:28.254 single_target v frost_strike Fluffy_Pillow 86.3/124: 70% runic_power
1.0/6: 17% rune		 rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:29.593 single_target v frost_strike Fluffy_Pillow 62.5/124: 50% runic_power
1.0/6: 17% rune		 rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:30.933 single_target p obliterate Fluffy_Pillow 32.5/124: 26% runic_power
4.0/6: 67% rune		 icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:32.273 single_target p obliterate Fluffy_Pillow 58.7/124: 47% runic_power
4.0/6: 67% rune		 rune_of_hysteria, icy_talons(3), killing_machine, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:33.613 single_target q howling_blast Fluffy_Pillow 83.5/124: 67% runic_power
2.0/6: 33% rune		 rune_of_hysteria, icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:34.953 single_target s obliterate Fluffy_Pillow 93.4/124: 75% runic_power
2.0/6: 33% rune		 rune_of_hysteria, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:36.293 high_prio_actions m frost_strike Fluffy_Pillow 118.2/124: 95% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:37.631 single_target v frost_strike Fluffy_Pillow 88.2/124: 71% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:38.971 single_target v frost_strike Fluffy_Pillow 70.6/124: 57% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
1:40.310 single_target s obliterate Fluffy_Pillow 40.6/124: 33% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
1:41.650 high_prio_actions n remorseless_winter Fluffy_Pillow 60.6/124: 49% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), rime, unleashed_frenzy(3), corrupting_rage
1:42.990 single_target q howling_blast Fluffy_Pillow 75.6/124: 61% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
1:44.330 single_target s obliterate Fluffy_Pillow 88.6/124: 71% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm, remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:45.670 high_prio_actions m frost_strike Fluffy_Pillow 108.6/124: 88% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(3), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
1:47.009 single_target q howling_blast Fluffy_Pillow 84.8/124: 68% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
1:48.349 single_target p obliterate Fluffy_Pillow 107.2/124: 86% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(4), killing_machine(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:49.689 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(6), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:51.029 single_target o frost_strike Fluffy_Pillow 106.4/124: 86% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(6), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:52.369 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 76.4/124: 62% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(6), killing_machine(2), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:52.369 cooldowns i pillar_of_frost PR_Death_Knight_Frost 76.4/124: 62% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(6), killing_machine(2), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:52.369 single_target p obliterate Fluffy_Pillow 76.4/124: 62% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(6), killing_machine(2), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:53.709 single_target q howling_blast Fluffy_Pillow 101.2/124: 82% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:55.049 single_target o frost_strike Fluffy_Pillow 109.2/124: 88% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:56.389 single_target p obliterate Fluffy_Pillow 84.2/124: 68% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:57.729 single_target o frost_strike Fluffy_Pillow 104.2/124: 84% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:59.069 single_target p obliterate Fluffy_Pillow 74.2/124: 60% runic_power
5.0/6: 83% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3)
2:00.408 single_target q howling_blast Fluffy_Pillow 99.2/124: 80% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3)
2:01.747 high_prio_actions n remorseless_winter Fluffy_Pillow 107.2/124: 86% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3)
2:03.086 cooldowns g abomination_limb Fluffy_Pillow 117.2/124: 95% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3)
2:04.426 cooldowns k raise_dead PR_Death_Knight_Frost 117.2/124: 95% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
2:04.426 single_target o frost_strike Fluffy_Pillow 117.2/124: 95% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
2:05.766 cooldowns j breath_of_sindragosa Fluffy_Pillow 87.2/124: 70% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
2:05.766 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 87.2/124: 70% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
2:05.766 breath T howling_blast Fluffy_Pillow 87.2/124: 70% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze
2:07.105 breath V obliterate Fluffy_Pillow 77.2/124: 62% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2)
2:08.444 breath W obliterate Fluffy_Pillow 79.2/124: 64% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2)
2:09.784 breath T howling_blast Fluffy_Pillow 68.2/124: 55% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2)
2:11.123 breath V obliterate Fluffy_Pillow 58.2/124: 47% runic_power
3.0/6: 50% rune		 abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2)
2:11.771 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 65.2/124: 53% runic_power
1.0/6: 17% rune		 abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2)
2:12.463 breath T howling_blast Fluffy_Pillow 70.2/124: 57% runic_power
2.0/6: 33% rune		 abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2)
2:13.628 breath W obliterate Fluffy_Pillow 66.4/124: 54% runic_power
2.0/6: 33% rune		 rune_of_hysteria, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:14.793 breath T howling_blast Fluffy_Pillow 61.4/124: 50% runic_power
2.0/6: 33% rune		 rune_of_hysteria, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:15.957 breath T howling_blast Fluffy_Pillow 53.3/124: 43% runic_power
4.0/6: 67% rune		 rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
2:17.122 breath V obliterate Fluffy_Pillow 51.4/124: 41% runic_power
6.0/6: 100% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:18.287 breath T howling_blast Fluffy_Pillow 64.4/124: 52% runic_power
5.0/6: 83% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:19.452 breath W obliterate Fluffy_Pillow 56.4/124: 45% runic_power
5.0/6: 83% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:20.617 breath V obliterate Fluffy_Pillow 63.2/124: 51% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:21.781 high_prio_actions n remorseless_winter Fluffy_Pillow 62.0/124: 50% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:22.945 breath W obliterate Fluffy_Pillow 54.0/124: 44% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:24.109 breath T howling_blast Fluffy_Pillow 56.0/124: 45% runic_power
2.0/6: 33% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, rime, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:25.273 breath W obliterate Fluffy_Pillow 51.0/124: 41% runic_power
2.0/6: 33% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:25.800 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 53.0/124: 43% runic_power
0.0/6: 0% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
2:26.437 breath T howling_blast Fluffy_Pillow 53.0/124: 43% runic_power
0.0/6: 0% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, unleashed_frenzy(3), dragon_games_equipment, corrupting_rage
2:27.602 breath V obliterate Fluffy_Pillow 53.0/124: 43% runic_power
3.0/6: 50% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, unleashed_frenzy(3), corrupting_rage
2:28.767 breath U horn_of_winter PR_Death_Knight_Frost 37.0/124: 30% runic_power
1.0/6: 17% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:29.932 breath T howling_blast Fluffy_Pillow 44.0/124: 35% runic_power
5.0/6: 83% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:31.095 cooldowns i pillar_of_frost PR_Death_Knight_Frost 39.0/124: 31% runic_power
6.0/6: 100% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:31.095 breath W obliterate Fluffy_Pillow 39.0/124: 31% runic_power
6.0/6: 100% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:32.260 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 56.0/124: 45% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:32.369 breath T howling_blast Fluffy_Pillow 56.0/124: 45% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:33.709 breath W obliterate Fluffy_Pillow 46.0/124: 37% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:35.048 breath V obliterate Fluffy_Pillow 36.2/124: 29% runic_power
5.0/6: 83% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
2:36.386 breath W obliterate Fluffy_Pillow 43.0/124: 35% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
2:37.726 breath W obliterate Fluffy_Pillow 49.8/124: 40% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
2:39.064 breath T howling_blast Fluffy_Pillow 44.8/124: 36% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:40.404 breath X death_and_decay Fluffy_Pillow 36.7/124: 30% runic_power
1.0/6: 17% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:41.743 high_prio_actions n remorseless_winter Fluffy_Pillow 37.3/124: 30% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:43.057 single_target p obliterate Fluffy_Pillow 13.7/124: 11% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_ground, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:44.333 single_target q howling_blast Fluffy_Pillow 44.7/124: 36% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, rune_of_hysteria, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:45.609 single_target s obliterate Fluffy_Pillow 54.6/124: 44% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, rune_of_hysteria, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:46.885 single_target u arcane_torrent PR_Death_Knight_Frost 79.4/124: 64% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_ground, rune_of_hysteria, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:48.161 single_target o frost_strike Fluffy_Pillow 104.2/124: 84% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_ground, rune_of_hysteria, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:49.437 single_target v frost_strike Fluffy_Pillow 74.2/124: 60% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_ground, rune_of_hysteria, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:50.712 single_target v frost_strike Fluffy_Pillow 49.2/124: 40% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:52.052 single_target s obliterate Fluffy_Pillow 19.2/124: 15% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:53.392 single_target q howling_blast Fluffy_Pillow 44.2/124: 36% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), killing_machine, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:54.731 single_target p obliterate Fluffy_Pillow 52.2/124: 42% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:56.071 single_target q howling_blast Fluffy_Pillow 72.2/124: 58% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:57.410 high_prio_actions m frost_strike Fluffy_Pillow 80.2/124: 65% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
2:58.750 single_target s obliterate Fluffy_Pillow 50.2/124: 40% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
3:00.090 single_target q howling_blast Fluffy_Pillow 75.2/124: 61% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), killing_machine, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
3:01.430 single_target p obliterate Fluffy_Pillow 83.2/124: 67% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
3:02.770 high_prio_actions n remorseless_winter Fluffy_Pillow 108.2/124: 87% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:04.110 high_prio_actions m frost_strike Fluffy_Pillow 118.2/124: 95% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:05.449 cooldowns i pillar_of_frost PR_Death_Knight_Frost 98.2/124: 79% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:05.449 single_target q howling_blast Fluffy_Pillow 98.2/124: 79% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:06.789 single_target o frost_strike Fluffy_Pillow 106.2/124: 86% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm, killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:08.128 single_target p obliterate Fluffy_Pillow 81.2/124: 65% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm, killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:09.468 single_target q howling_blast Fluffy_Pillow 101.2/124: 82% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:10.808 single_target o frost_strike Fluffy_Pillow 109.2/124: 88% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:12.146 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 79.2/124: 64% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:12.369 single_target s obliterate Fluffy_Pillow 79.2/124: 64% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:13.709 single_target q howling_blast Fluffy_Pillow 99.2/124: 80% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:15.049 single_target o frost_strike Fluffy_Pillow 121.5/124: 98% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:16.388 single_target s obliterate Fluffy_Pillow 91.5/124: 74% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:17.727 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:19.067 single_target o frost_strike Fluffy_Pillow 100.2/124: 81% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:20.407 single_target p obliterate Fluffy_Pillow 75.2/124: 61% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:21.747 single_target s obliterate Fluffy_Pillow 95.2/124: 77% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:23.086 high_prio_actions n remorseless_winter Fluffy_Pillow 115.2/124: 93% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), killing_machine, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:24.425 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:25.765 single_target q howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:27.104 single_target p obliterate Fluffy_Pillow 102.0/124: 82% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm, killing_machine(2), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:28.444 single_target o frost_strike Fluffy_Pillow 122.0/124: 98% runic_power
2.0/6: 33% rune		 icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:29.784 single_target p obliterate Fluffy_Pillow 92.0/124: 74% runic_power
4.0/6: 67% rune		 icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:31.124 single_target o frost_strike Fluffy_Pillow 117.0/124: 94% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:32.462 single_target p obliterate Fluffy_Pillow 92.0/124: 74% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:33.801 single_target o frost_strike Fluffy_Pillow 112.0/124: 90% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:35.141 single_target v frost_strike Fluffy_Pillow 82.0/124: 66% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:36.481 single_target s obliterate Fluffy_Pillow 52.0/124: 42% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:37.820 single_target v frost_strike Fluffy_Pillow 72.0/124: 58% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:39.160 single_target s obliterate Fluffy_Pillow 47.0/124: 38% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:40.500 cooldowns i pillar_of_frost PR_Death_Knight_Frost 72.0/124: 58% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:40.500 single_target q howling_blast Fluffy_Pillow 72.0/124: 58% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), pillar_of_frost, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:41.840 single_target v frost_strike Fluffy_Pillow 80.0/124: 65% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:43.179 high_prio_actions n remorseless_winter Fluffy_Pillow 50.0/124: 40% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, unleashed_frenzy(3), corrupting_rage
3:44.518 single_target s obliterate Fluffy_Pillow 65.0/124: 52% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
3:45.858 single_target v frost_strike Fluffy_Pillow 85.0/124: 69% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, unleashed_frenzy(3), corrupting_rage
3:47.198 single_target p obliterate Fluffy_Pillow 55.0/124: 44% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, unleashed_frenzy(3), corrupting_rage
3:48.538 single_target s obliterate Fluffy_Pillow 80.0/124: 65% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:49.878 single_target q howling_blast Fluffy_Pillow 100.0/124: 81% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:51.217 single_target o frost_strike Fluffy_Pillow 113.0/124: 91% runic_power
0.0/6: 0% rune		 icy_talons(3), gathering_storm(7), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:52.556 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 83.0/124: 67% runic_power
1.0/6: 17% rune		 icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:52.556 single_target v frost_strike Fluffy_Pillow 83.0/124: 67% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:53.896 single_target s obliterate Fluffy_Pillow 58.0/124: 47% runic_power
3.0/6: 50% rune		 antimagic_shell, icy_talons(3), gathering_storm(7), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:55.236 single_target s obliterate Fluffy_Pillow 78.0/124: 63% runic_power
3.0/6: 50% rune		 antimagic_shell, icy_talons(3), gathering_storm(9), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:56.575 single_target q howling_blast Fluffy_Pillow 98.0/124: 79% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, rune_of_hysteria, icy_talons(3), gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:57.915 single_target o frost_strike Fluffy_Pillow 107.9/124: 87% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, rune_of_hysteria, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:59.255 single_target s obliterate Fluffy_Pillow 84.1/124: 68% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, rune_of_hysteria, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:00.595 single_target o frost_strike Fluffy_Pillow 115.1/124: 93% runic_power
0.0/6: 0% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:01.935 single_target v frost_strike Fluffy_Pillow 91.3/124: 74% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:03.274 high_prio_actions n remorseless_winter Fluffy_Pillow 61.3/124: 49% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
4:04.613 cooldowns g abomination_limb Fluffy_Pillow 76.3/124: 62% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), killing_machine(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
4:05.953 cooldowns j breath_of_sindragosa Fluffy_Pillow 81.3/124: 66% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, icy_talons(3), killing_machine(2), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
4:05.953 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 81.3/124: 66% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine(2), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
4:05.953 cooldowns k raise_dead PR_Death_Knight_Frost 81.3/124: 66% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine(2), remorseless_winter, rime, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
4:05.953 breath T howling_blast Fluffy_Pillow 81.3/124: 66% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine(2), remorseless_winter, rime, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
4:07.293 breath V obliterate Fluffy_Pillow 71.3/124: 58% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine(2), remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:08.633 breath T howling_blast Fluffy_Pillow 73.3/124: 59% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:09.973 breath V obliterate Fluffy_Pillow 50.3/124: 41% runic_power
6.0/6: 100% rune		 unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine(2), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
4:11.313 breath T howling_blast Fluffy_Pillow 63.3/124: 51% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
4:12.653 breath V obliterate Fluffy_Pillow 61.4/124: 50% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(7), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:13.992 breath W obliterate Fluffy_Pillow 56.4/124: 46% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:15.332 breath W obliterate Fluffy_Pillow 69.4/124: 56% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:16.671 breath W obliterate Fluffy_Pillow 76.2/124: 61% runic_power
3.0/6: 50% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:18.010 cooldowns i pillar_of_frost PR_Death_Knight_Frost 71.2/124: 57% runic_power
2.0/6: 33% rune		 icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:18.010 breath T howling_blast Fluffy_Pillow 71.2/124: 57% runic_power
2.0/6: 33% rune		 icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:19.032 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 61.2/124: 49% runic_power
2.0/6: 33% rune		 icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:19.350 breath W obliterate Fluffy_Pillow 71.2/124: 57% runic_power
3.0/6: 50% rune		 rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:20.515 breath T howling_blast Fluffy_Pillow 84.2/124: 68% runic_power
1.0/6: 17% rune		 rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:21.680 breath U horn_of_winter PR_Death_Knight_Frost 76.2/124: 61% runic_power
1.0/6: 17% rune		 rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:22.845 breath V obliterate Fluffy_Pillow 95.4/124: 77% runic_power
4.0/6: 67% rune		 rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(4), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:24.009 high_prio_actions n remorseless_winter Fluffy_Pillow 84.2/124: 68% runic_power
5.0/6: 83% rune		 rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:25.173 breath T howling_blast Fluffy_Pillow 84.8/124: 68% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:26.020 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 76.7/124: 62% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
4:26.337 breath V obliterate Fluffy_Pillow 76.7/124: 62% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), dragon_games_equipment, corrupting_rage
4:27.502 breath T howling_blast Fluffy_Pillow 83.5/124: 67% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
4:28.667 breath V obliterate Fluffy_Pillow 78.5/124: 63% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
4:29.831 breath T howling_blast Fluffy_Pillow 95.5/124: 77% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
4:30.996 breath V obliterate Fluffy_Pillow 69.4/124: 56% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(7), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:32.160 breath X death_and_decay Fluffy_Pillow 88.6/124: 71% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:33.324 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 83.0/124: 67% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:33.324 breath W obliterate Fluffy_Pillow 83.0/124: 67% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:34.434 breath T howling_blast Fluffy_Pillow 96.0/124: 77% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:35.544 breath Z obliterate Fluffy_Pillow 94.1/124: 76% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:36.654 breath T howling_blast Fluffy_Pillow 100.9/124: 81% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:37.764 Waiting     0.274s 99.0/124: 80% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:38.038 breath W obliterate Fluffy_Pillow 81.0/124: 65% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:39.147 breath Z obliterate Fluffy_Pillow 94.0/124: 76% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:40.422 breath T howling_blast Fluffy_Pillow 100.8/124: 81% runic_power
2.0/6: 33% rune		 unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:41.698 breath V obliterate Fluffy_Pillow 99.0/124: 80% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:42.973 breath T howling_blast Fluffy_Pillow 87.8/124: 71% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:44.313 high_prio_actions n remorseless_winter Fluffy_Pillow 79.7/124: 64% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:45.652 breath V obliterate Fluffy_Pillow 74.1/124: 60% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:46.991 breath W obliterate Fluffy_Pillow 62.9/124: 51% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
4:48.331 breath T howling_blast Fluffy_Pillow 82.1/124: 66% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
4:49.671 breath V obliterate Fluffy_Pillow 72.1/124: 58% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
4:51.010 breath T howling_blast Fluffy_Pillow 67.1/124: 54% runic_power
4.0/6: 67% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(7), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:52.350 breath W obliterate Fluffy_Pillow 59.0/124: 48% runic_power
4.0/6: 67% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:53.690 breath T howling_blast Fluffy_Pillow 65.8/124: 53% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:55.030 breath W obliterate Fluffy_Pillow 39.7/124: 32% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:56.368 cooldowns h pillar_of_frost PR_Death_Knight_Frost 46.5/124: 38% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:56.368 breath V obliterate Fluffy_Pillow 46.5/124: 38% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:57.707 breath T howling_blast Fluffy_Pillow 59.5/124: 48% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
4:59.046 breath V obliterate Fluffy_Pillow 39.6/124: 32% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5690 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3848 0 16538 15751 9278
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 330760 315020 0
Runic Power 124 124 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 30.85% 24.64% 2995
Haste 12.25% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 5974 5598 0
Mastery 46.03% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +923 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +111 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +519 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Talents

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowFrost Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=sizzling_seafood_medley
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
actions.precombat+=/variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h
# Protects Breath from starving itself on ERW charges depending on anticipated resource gains. More resources enable more aggressive use.
actions.precombat+=/variable,name=erw_pooling_time,op=setif,value=30,value_else=45,condition=death_knight.ams_absorb_percent>0.59

# Executed every time the actor is available.
actions=auto_attack
# Choose Action list to run
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/frostscythe,if=!death_and_decay.ticking&equipped.fyralath_the_dreamrender&(cooldown.rage_of_fyralath_417131.remains<3|!dot.mark_of_fyralath.ticking)
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=howling_blast,if=variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&(buff.killing_machine.react|runic_power>45)
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up
actions.breath+=/remorseless_winter,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/death_and_decay,if=variable.st_planning&talent.unholy_ground&!death_and_decay.ticking&runic_power.deficit>=10|runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/howling_blast,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=set_bonus.tier31_2pc&buff.chilling_rage.remains<3
actions.cooldowns+=/chill_streak,if=!set_bonus.tier31_2pc&active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react&rune>2|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>50|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
actions.high_prio_actions=invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions.high_prio_actions+=/mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40&death_knight.first_ams_cast<time
actions.high_prio_actions+=/antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.ready|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up))
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions.high_prio_actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&((!talent.obliteration|talent.obliteration&(!cooldown.pillar_of_frost.ready|buff.pillar_of_frost.up&!buff.killing_machine.react))|(equipped.fyralath_the_dreamrender&!dot.mark_of_fyralath.ticking))
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/remorseless_winter,if=variable.rw_buffs|variable.adds_remain

# Obliteration Active Rotation
actions.obliteration=howling_blast,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&buff.rime.react
actions.obliteration+=/frost_strike,if=(active_enemies<=1|!talent.glacial_advance)&buff.killing_machine.react<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/glacial_advance,if=buff.killing_machine.react<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&(variable.frostscythe_priority|active_enemies>3&!death_and_decay.ticking&equipped.fyralath_the_dreamrender&(cooldown.rage_of_fyralath_417131.remains<3|!dot.mark_of_fyralath.ticking))
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&(!dot.frost_fever.ticking|buff.rime.react&set_bonus.tier30_2pc&!variable.rp_buffs)
actions.obliteration+=/glacial_advance,if=!buff.killing_machine.react&(!death_knight.runeforge.razorice&(!talent.avalanche|debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)|((variable.rp_buffs|rune<2)&active_enemies>1))
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(rune<2|variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<30
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<30
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=frost_strike,if=buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
actions.single_target+=/howling_blast,if=buff.rime.react&set_bonus.tier30_2pc&buff.killing_machine.stack<2
actions.single_target+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets
actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.pillar_of_frost.up&!buff.empower_rune_weapon.up&!death_and_decay.ticking&(active_enemies<2|dot.frost_fever.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&((variable.damage_trinket_priority=1|trinket.2.cooldown.remains)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&((variable.damage_trinket_priority=2|trinket.1.cooldown.remains)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions.variables+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions.variables+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions.variables+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
actions.variables+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains>10|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up
actions.variables+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>8|!death_and_decay.ticking&active_enemies>4))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions.variables+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions.variables+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions.variables+=/variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions.variables+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=9278
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 56759 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
56758.9 56758.9 44.7 / 0.079% 7623.0 / 13.4% 4106.4
APS APS Error APS Range APR
160.9 3.8 / 2.388% 423.9 / 263.5% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.7 7.8 Runic Power 1.40% 52.9 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 56759
Apocalypse 242 (8135) 0.4% (14.3%) 6.8 46.26s 357157 291543 Direct 6.8 (537.8) 8828 17667 10622 20.3% (20.4%)

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.82 6.82 0.00 0.00 0.00 1.2251 0.0000 72456.18 72456.18 0.00% 291543.35 291543.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.70% 5.44 1 8 8828.49 6282 13296 8822.47 6910 11933 47995 47995 0.00%
crit 20.30% 1.38 0 6 17667.13 13820 26844 13835.69 0 26844 24462 24462 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for {$?a134735=false}[every {$s3=2} Festering {$=}LWound:Wounds;][each Festering Wound] you burst. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [U]:5.82
  • if_expr:variable.st_planning&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [Y]:1.00
  • if_expr:debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell CooldownArmy of the Damned2768373ADD-45000.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
    main_hand 9475  / 4173 7.4% 258.6 4.33s 4831 3209 Direct 258.6 4012 8027 4831 20.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 258.64 258.64 0.00 0.00 0.00 1.5054 0.0000 1249536.69 1785097.92 30.00% 3209.21 3209.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.61% 205.89 139 273 4012.45 1930 6631 4017.85 3633 4470 826138 1180227 30.00%
crit 20.39% 52.75 23 87 8027.04 3859 13262 8037.42 6927 9607 423399 604871 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 2261  / 996 1.8% 189.9 5.97s 1572 1572 Direct 189.9 1306 2611 1571 20.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 189.88 189.88 0.00 0.00 0.00 1.0000 0.0000 298399.34 426295.64 30.00% 1571.52 1571.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.69% 151.31 102 205 1306.45 645 2186 1307.78 1181 1425 197679 282406 30.00%
crit 20.31% 38.57 13 73 2611.20 1290 4372 2614.26 2231 3053 100720 143890 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:47.47
    default
    [ ]:47.47
    default
    [ ]:47.47
    default
    [ ]:47.47
    Frostbolt 1477  / 650 1.1% 19.8 14.91s 9837 6229 Direct 19.8 8174 16336 9841 20.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.83 19.82 0.00 0.00 0.00 1.5792 0.0000 195027.02 195027.02 0.00% 6229.30 6229.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.58% 15.77 8 24 8174.19 4610 14050 8181.41 7124 9314 128912 128912 0.00%
crit 20.42% 4.05 0 12 16335.63 9220 27712 16111.72 0 27712 66115 66115 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:19.93
    Shadow Bolt 4709  / 2074 3.7% 62.6 4.53s 9909 6594 Direct 62.6 8231 16463 9914 20.4%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.64 62.61 0.00 0.00 0.00 1.5028 0.0000 620716.98 620716.98 0.00% 6593.83 6593.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.56% 49.81 30 69 8231.44 4271 13580 8239.80 7360 9213 410026 410026 0.00%
crit 20.44% 12.80 0 28 16463.08 8798 27159 16476.24 0 21300 210691 210691 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:69.35
Army of the Dead 0 (6285) 0.0% (11.0%) 2.0 0.00s 931060 1413911

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6587 0.4688 0.00 0.00 0.00% 211196.57 1413910.52

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    high_prio_actions
    [h]:1.00
  • if_expr:talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
    main_hand 17406  / 3928 6.9% 340.3 0.74s 3420 2633 Direct 340.3 2841 5673 3420 20.5%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 340.26 340.26 0.00 0.00 0.00 1.2990 0.0000 1163796.02 1662608.14 30.00% 2633.03 2633.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.54% 270.63 225 303 2840.69 1230 4229 2839.60 2282 3098 768782 1098288 30.00%
crit 20.46% 69.63 41 101 5673.46 2461 8459 5670.15 4359 6399 395014 564320 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 3335  / 752 1.3% 207.3 1.33s 1076 1076 Direct 207.3 894 1782 1076 20.5%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 207.31 207.31 0.00 0.00 0.00 1.0000 0.0000 222970.47 318537.36 30.00% 1075.54 1075.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.55% 164.91 137 191 893.85 411 1413 893.59 731 998 147405 210583 30.00%
crit 20.45% 42.40 19 69 1782.21 822 2827 1781.33 1351 2115 75566 107954 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:27.03
    default
    [ ]:27.17
    default
    [ ]:24.80
    default
    [ ]:27.15
    default
    [ ]:26.70
    default
    [ ]:24.30
    default
    [ ]:24.96
    default
    [ ]:25.21
    Frostbolt 1413  / 286 0.5% 8.0 31.09s 10601 7428 Direct 8.0 8814 17491 10601 20.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.00 1.4272 0.0000 84805.00 84805.00 0.00% 7427.96 7427.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.41% 6.35 2 8 8813.95 4203 14050 8812.98 5557 12062 55992 55992 0.00%
crit 20.59% 1.65 0 6 17490.57 8406 28100 14737.06 0 27712 28813 28813 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:8.00
    Shadow Bolt 6509  / 1318 2.3% 35.8 6.33s 10923 8285 Direct 35.8 9082 18079 10923 20.5%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.76 35.76 0.00 0.00 0.00 1.3183 0.0000 390548.66 390548.66 0.00% 8285.39 8285.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.54% 28.44 20 37 9081.86 3953 13580 9077.89 7047 10340 258284 258284 0.00%
crit 20.46% 7.32 0 16 18079.17 7905 27159 18074.85 0 25692 132265 132265 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:37.76
auto_attack_mh 2709 4.8% 147.0 2.46s 5527 2264 Direct 147.0 4589 9178 5527 20.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 147.00 147.00 0.00 0.00 0.00 2.4415 0.0000 812424.79 1160636.43 30.00% 2263.66 2263.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.57% 116.97 79 156 4589.25 3685 6722 4588.66 4388 4815 536805 766884 30.00%
crit 20.43% 30.03 10 54 9177.83 7371 13444 9177.02 8318 10028 275620 393752 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 97 0.2% 2.0 0.00s 14315 0 Direct 2.0 11787 23544 14314 21.5%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 28631.84 28631.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.50% 1.57 0 3 11787.03 10402 14824 11214.63 0 14824 18507 18507 0.00%
crit 21.50% 0.43 0 2 23543.95 20804 29648 8976.49 0 29648 10125 10125 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Clawing Shadows 7896 13.9% 71.0 4.10s 33306 28009 Direct 71.0 27699 55316 33306 20.3%

Stats Details: Clawing Shadows

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 71.02 71.02 0.00 0.00 0.00 1.1891 0.0000 2365271.25 2365271.25 0.00% 28009.28 28009.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.70% 56.60 35 78 27699.15 13786 53478 27724.21 23326 32484 1567737 1567737 0.00%
crit 20.30% 14.42 1 30 55316.28 27825 104888 55391.71 38116 82065 797534 797534 0.00%

Action Details: Clawing Shadows

  • id:207311
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207311
  • name:Clawing Shadows
  • school:shadow
  • tooltip:
  • description:Deals {$s2=0} Shadow damage and causes 1 Festering Wound to burst.

Action Priority List

    st
    [n]:70.77
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    st
    [q]:0.25
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Rotten Touch39027610.500
Crit Damage on Debuff Lingering Chill41087910.400
Dark Transformation 0 (211) 0.0% (0.4%) 6.9 46.16s 9093 7205

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.94 0.00 0.00 0.00 0.00 1.2621 0.0000 0.00 0.00 0.00% 7205.20 7205.20

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [T]:5.94
  • if_expr:cooldown.apocalypse.remains<5
    garg_setup
    [d]:1.00
  • if_expr:talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownUnholy Command3169411ADD-15000.000
    Dark Transformation (_damage) 211 0.4% 0.0 0.00s 0 0 Direct 6.9 7561 15150 9093 20.2%

Stats Details: Dark Transformation Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 6.94 0.00 0.00 0.00 0.0000 0.0000 63124.78 63124.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.80% 5.54 1 8 7560.53 6182 11251 7556.16 6182 8725 41884 41884 0.00%
crit 20.20% 1.40 0 6 15149.71 12363 21455 11861.17 0 21455 21241 21241 0.00%

Action Details: Dark Transformation Damage

  • id:344955
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344955
  • name:Dark Transformation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc63560=Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Death and Decay 272 0.5% 8.5 36.35s 9589 8061 Periodic 92.4 733 1465 882 20.4% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.50 0.00 0.00 92.40 0.00 1.1896 0.0000 81530.15 81530.15 0.00% 8061.12 8061.12
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.63% 73.58 43 114 733.22 492 1234 733.98 658 820 53947 53947 0.00%
crit 20.37% 18.82 3 44 1465.28 915 2467 1466.27 1152 1853 27583 27583 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    garg_setup
    [Z]:1.00
  • if_expr:!death_and_decay.ticking&debuff.festering_wound.stack>1
    st
    [m]:7.50
  • if_expr:!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Death Coil 7331 (9492) 12.9% (16.8%) 96.4 3.08s 29511 24441 Direct 96.3 (233.3) 18945 37891 22803 20.4% (20.4%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.37 96.33 0.00 0.00 0.00 1.2074 0.0000 2196651.91 2196651.91 0.00% 24441.47 24441.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.64% 76.71 49 105 18945.33 11451 32277 18956.22 17282 20423 1453373 1453373 0.00%
crit 20.36% 19.62 4 37 37890.71 24870 65155 37906.95 31651 46434 743279 743279 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Details: Death Coil Damage

  • id:47632
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47632
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fire a blast of unholy energy, causing Shadow damage to an enemy target or healing a friendly Undead target.

Action Priority List

    high_prio_actions
    [i]:6.95
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
    st
    [l]:81.37
  • if_expr:!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
    st
    [p]:8.05

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Death Coil3775801PCT0.300
Spell TargetsImproved Death Coil3775802ADD1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Percent Cost Sudden Doom813401-1.000Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
    Coil of Devastation 2161 3.8% 0.0 0.00s 0 0 Periodic 136.9 4728 0 4728 0.0% 91.3%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 136.93 136.93 81.81 0.0000 2.0000 647358.04 647358.04 0.00% 2363.91 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 136.93 105 170 4727.79 1718 21732 4735.09 4067 5955 647358 647358 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 743 1.3% 5.5 46.67s 40806 0 Direct 5.5 33982 67979 40838 20.2%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.47 5.47 0.00 0.00 0.00 0.0000 0.0000 223236.03 318916.74 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.84% 4.36 0 6 33982.05 33373 35042 33998.71 0 35042 148304 211868 30.00%
crit 20.16% 1.10 0 5 67979.13 66746 70083 47495.87 0 70083 74932 107049 20.96%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1564 2.8% 22.7 13.23s 20664 17036 Direct 22.7 17166 34297 20664 20.4%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.71 22.71 0.00 0.00 0.00 1.2130 0.0000 469244.84 670366.87 30.00% 17035.57 17035.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.58% 18.07 8 28 17166.37 12163 30699 17153.27 14518 19439 310227 443193 30.00%
crit 20.42% 4.64 0 13 34296.99 24325 59513 33955.69 0 55676 159018 227174 29.74%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [e]:1.00
  • if_expr:debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
    st
    [o]:21.71
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack<4
  • target_if_expr:debuff.festering_wound.stack

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Festering Strike3168671PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Crit Damage on Debuff Lingering Chill41087910.400
Festering Wound 2520 4.4% 98.3 3.77s 7684 0 Direct 98.3 6382 12766 7685 20.4%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 98.30 98.30 0.00 0.00 0.00 0.0000 0.0000 755383.61 755383.61 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.59% 78.24 51 105 6381.66 4229 11685 6383.14 5896 6868 499317 499317 0.00%
crit 20.41% 20.06 5 38 12766.31 8458 23369 12769.81 10520 15537 256067 256067 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Festering Strike3168671PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Outbreak 87 0.2% 11.6 27.01s 2250 1855 Direct 11.6 1867 3734 2250 20.5%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.2129 0.0000 26156.49 26156.49 0.00% 1855.20 1855.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.49% 9.24 2 14 1867.21 1319 3281 1867.51 1490 2213 17254 17254 0.00%
crit 20.51% 2.38 0 9 3733.65 2638 6563 3458.48 0 6563 8902 8902 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    high_prio_actions
    [j]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Raise Dead 0 (7920) 0.0% (14.0%) 1.0 0.00s 2371250 0

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
    auto_attack 5488  / 5488 9.7% 186.0 1.61s 8833 5492 Direct 186.0 7336 14703 8833 20.3%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 186.00 186.00 0.00 0.00 0.00 1.6084 0.0000 1642906.58 2347069.24 30.00% 5491.60 5491.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.69% 148.21 106 189 7336.25 2482 18960 7346.19 6547 8317 1087334 1553374 30.00%
crit 20.31% 37.79 12 69 14702.81 4964 37920 14723.96 9798 21179 555572 793695 30.00%

Action Details: Auto Attack

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:1.00
    Sweeping Claws 1999  / 1999 3.5% 62.9 4.66s 9503 9469 Direct 62.9 7893 15786 9503 20.4%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.94 62.94 0.00 0.00 0.00 1.0036 0.0000 598187.61 598187.61 0.00% 9469.19 9469.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.60% 50.10 30 69 7893.13 5505 14017 7896.37 7191 8558 395475 395475 0.00%
crit 20.40% 12.84 3 27 15786.42 11010 27657 15791.70 12673 20725 202713 202713 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:62.94
    Claw 432  / 432 0.8% 39.3 7.74s 3300 3288 Direct 39.3 2742 5480 3300 20.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.31 39.31 0.00 0.00 0.00 1.0036 0.0000 129734.47 185339.69 30.00% 3288.25 3288.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.62% 31.30 17 45 2742.01 2234 11252 2740.21 2487 2992 85822 122606 30.00%
crit 20.38% 8.01 0 19 5480.34 4468 8763 5474.86 0 7317 43912 62734 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:39.31
  • if_expr:energy>70
    Gnaw 1  / 1 0.0% 3.7 90.13s 113 113 Direct 3.7 94 188 113 20.3%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0036 0.0000 421.62 602.32 30.00% 112.64 112.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.66% 2.97 0 4 93.96 79 120 93.63 0 113 279 399 29.89%
crit 20.34% 0.76 0 4 187.82 158 240 106.49 0 233 142 204 17.02%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:3.73
Soul Reaper 730 (4115) 1.3% (7.3%) 15.4 6.95s 80285 63498 Direct 15.4 (30.8) 11856 23734 14252 20.2% (20.1%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.40 15.40 0.00 0.00 0.00 1.2644 0.0000 219512.11 219512.11 0.00% 63498.33 63498.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.83% 12.30 4 19 11856.26 7068 18448 11865.76 9978 13584 145777 145777 0.00%
crit 20.17% 3.11 0 11 23733.55 14265 36555 22845.17 0 35849 73735 73735 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [X]:15.40
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370075PCT0.150
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
    Soul Reaper (_execute) 3384 6.0% 15.4 6.95s 66034 0 Direct 15.4 54970 109957 66033 20.1%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.40 15.40 0.00 0.00 0.00 0.0000 0.0000 1017054.39 1017054.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.88% 12.30 4 19 54969.85 41770 84643 55049.45 48158 63062 676288 676288 0.00%
crit 20.12% 3.10 0 11 109956.52 85087 166884 106746.99 0 165201 340767 340767 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370075PCT0.150
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Summon Gargoyle 0 (3048) 0.0% (5.3%) 2.0 185.21s 451578 0

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [S]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead
    garg_setup
    [a]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
    Gargoyle Strike 18063  / 3048 5.3% 27.1 7.85s 33304 21231 Direct 27.1 27705 55270 33304 20.3%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.12 27.12 0.00 0.00 0.00 1.5686 0.0000 903156.95 903156.95 0.00% 21231.27 21231.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.69% 21.61 12 28 27704.93 8288 64059 27702.57 22338 35416 598713 598713 0.00%
crit 20.31% 5.51 0 15 55269.84 18988 121491 55095.02 0 109825 304444 304444 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.
Unholy Assault 392 0.7% 3.6 91.71s 32273 28323 Direct 3.6 26719 53645 32274 20.6%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.64 3.64 0.00 0.00 0.00 1.1395 0.0000 117455.25 117455.25 0.00% 28322.94 28322.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.37% 2.89 0 4 26719.19 20595 36264 26634.00 0 35921 77185 77185 0.00%
crit 20.63% 0.75 0 4 53645.31 41781 72527 30520.12 0 72527 40270 40270 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Damage increased by {$s4=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing all damage done by {$s4=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [W]:3.33
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [c]:0.31
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Virulent Plague 1272 2.2% 11.6 27.01s 32831 0 Periodic 99.5 3182 6371 3836 20.5% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.50 99.50 10.62 0.0000 3.0000 381659.58 381659.58 0.00% 1278.63 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.50% 79.10 53 105 3182.24 2189 6069 3182.62 2983 3357 251725 251725 0.00%
crit 20.50% 20.39 5 41 6371.19 4707 12139 6370.69 5538 7480 129935 129935 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.172500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Tick Time Plaguebringer3901781-0.500Spell Data
Damage on Debuff War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Crit Damage on Debuff Lingering Chill41087910.400
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 0
Anti-Magic Shell 161 99.9% 7.0 45.42s 6931 0 Direct 3.1 15824 0 15824 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.97 3.05 0.00 0.00 0.00 0.0000 0.0000 48277.76 48277.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.05 0 14 15823.90 15824 15824 13363.48 0 15824 48278 48278 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [f]:6.97
  • if_expr:runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownAnti-Magic Barrier2057271ADD-20000.000
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Algeth'ar Puzzle (_box_channel) 2.0 0.00s

Stats Details: Algethar Puzzle Box Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 2.00 0.00 0.00 1.5530 1.5530 0.00 0.00 0.00% 0.00 0.00

Action Details: Algethar Puzzle Box Channel

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 185.60s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [k]:2.00
  • if_expr:(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
Empower Rune Weapon 2.4 168.46s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.39 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [V]:2.08
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
    garg_setup
    [b]:0.31
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929621SET1.000
Festering Wound (_application) 102.0 5.28s

Stats Details: Festering Wound Application

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 102.01 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Festering Wound Application

  • id:197147
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:197147
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:Festering Strike applies a pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$195757s1=3} Runic Power. Stacks up to {$194310u=6} times on any target.
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382154
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Outbreak (_aoe) 11.6 27.01s

Stats Details: Outbreak Aoe

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Outbreak Aoe

  • id:196780
  • school:shadow
  • range:200.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196780
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:{$@spelldesc77575=Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}}
Elemental Potion of Ultimate Power 1.5 303.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    high_prio_actions
    [g]:1.46
  • if_expr:(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Unholy Strength 20.7 14.15s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 181.8s 181.8s 30.0s 20.27% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1411.05

Trigger Details

  • interval_min/max:181.8s / 183.9s
  • trigger_min/max:181.8s / 183.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s
  • uptime_min/max:16.67% / 25.00%

Stack Uptimes

  • algethar_puzzle_1:20.27%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Anti-Magic Shell 7.0 0.0 45.4s 45.4s 6.9s 16.12% 18.18% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.40
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 118.2s
  • trigger_min/max:40.0s / 118.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:11.40% / 17.83%

Stack Uptimes

  • antimagic_shell_1:16.12%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Berserking 2.0 0.0 185.6s 185.6s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.4s / 192.7s
  • trigger_min/max:181.4s / 192.7s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Commander of the Dead 6.9 0.0 46.2s 46.2s 28.6s 66.12% 87.65% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 59.4s
  • trigger_min/max:45.0s / 59.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:62.39% / 69.21%

Stack Uptimes

  • commander_of_the_dead_1:66.12%

Spelldata

  • id:390260
  • name:Commander of the Dead
  • tooltip:Your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead ghouls deal {$390264s1=35}% increased damage.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.2s 58.7s 50.2s 80.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 338.0s
  • trigger_min/max:15.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.6s
  • uptime_min/max:50.57% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.19%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Transformation 6.9 0.0 46.2s 46.2s 21.9s 50.64% 55.03% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 59.4s
  • trigger_min/max:45.0s / 59.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.0s
  • uptime_min/max:45.41% / 58.24%

Stack Uptimes

  • dark_transformation_1:50.64%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Dragon Games Equipment 2.7 0.0 120.0s 120.0s 0.7s 0.65% 0.00% 5.5 (5.5) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.70
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.2s
  • trigger_min/max:120.0s / 120.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.7s
  • uptime_min/max:0.52% / 0.79%

Stack Uptimes

  • dragon_games_equipment_1:0.65%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.9s 302.9s 27.4s 13.09% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 326.8s
  • trigger_min/max:300.0s / 326.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s
  • uptime_min/max:9.82% / 17.94%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.09%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 168.5s 168.5s 19.3s 15.31% 0.00% 6.9 (6.9) 2.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 194.3s
  • trigger_min/max:120.0s / 194.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:12.58% / 18.19%

Stack Uptimes

  • empower_rune_weapon_1:15.31%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Festermight 13.1 64.8 23.4s 3.8s 19.2s 83.79% 0.00% 0.0 (0.0) 12.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 40.7s
  • trigger_min/max:0.8s / 27.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:73.73% / 90.82%

Stack Uptimes

  • festermight_1:8.00%
  • festermight_2:8.11%
  • festermight_3:8.41%
  • festermight_4:16.03%
  • festermight_5:11.36%
  • festermight_6:9.94%
  • festermight_7:8.06%
  • festermight_8:5.70%
  • festermight_9:3.72%
  • festermight_10:1.90%
  • festermight_11:0.84%
  • festermight_12:0.62%
  • festermight_13:0.58%
  • festermight_14:0.39%
  • festermight_15:0.11%
  • festermight_16:0.01%
  • festermight_17:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 95.4 174.2s 3.1s 293.1s 98.53% 0.00% 93.3 (93.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:48.2s / 289.4s
  • trigger_min/max:0.8s / 14.9s
  • trigger_pct:100.00%
  • duration_min/max:2.1s / 355.6s
  • uptime_min/max:96.71% / 98.80%

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.86%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 11.9 7.8 24.9s 14.8s 10.5s 41.92% 0.00% 7.8 (7.8) 11.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 170.7s
  • trigger_min/max:0.8s / 169.4s
  • trigger_pct:15.00%
  • duration_min/max:0.0s / 63.4s
  • uptime_min/max:13.08% / 67.16%

Stack Uptimes

  • rune_mastery_1:41.92%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 39.6 6.6 7.5s 6.4s 2.8s 36.90% 0.00% 6.6 (6.6) 39.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 73.3s
  • trigger_min/max:0.8s / 73.3s
  • trigger_pct:47.94%
  • duration_min/max:0.0s / 26.2s
  • uptime_min/max:22.20% / 55.13%

Stack Uptimes

  • runic_corruption_1:36.90%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 19.6 0.6 15.0s 14.5s 1.4s 9.27% 0.00% 0.6 (0.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.6s / 59.1s
  • trigger_min/max:1.6s / 59.1s
  • trigger_pct:14.14%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:1.78% / 20.82%

Stack Uptimes

  • sudden_doom_1:9.27%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.6 0.0 91.7s 91.7s 19.5s 23.70% 29.01% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 99.0s
  • trigger_min/max:90.0s / 99.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.93% / 26.77%

Stack Uptimes

  • unholy_assault_1:23.70%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Damage increased by {$s4=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing all damage done by {$s4=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Ground 8.5 0.0 36.4s 36.4s 9.9s 28.00% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 132.9s
  • trigger_min/max:10.0s / 132.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.0s
  • uptime_min/max:18.35% / 37.36%

Stack Uptimes

  • unholy_ground_1:28.00%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 12.2 35.8s 14.1s 23.8s 67.62% 0.00% 12.2 (12.2) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 189.2s
  • trigger_min/max:0.0s / 59.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 175.6s
  • uptime_min/max:43.58% / 90.52%

Stack Uptimes

  • unholy_strength_1:67.62%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 184.3s 184.3s 24.5s 98.06% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.2s / 194.2s
  • trigger_min/max:181.2s / 194.2s
  • trigger_pct:100.00%
  • duration_min/max:21.2s / 25.0s
  • uptime_min/max:90.48% / 98.07%

Stack Uptimes

  • dark_empowerment_1:98.06%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (sizzling_seafood_medley)

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sizzling_seafood_medley
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382154
  • name:Well Fed
  • tooltip:Haste and mastery increased by {$=}w1.
  • description:Increases Haste and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 24.5 7.0 48.0 12.0s 1.6s 130.9s
Rune ready 151.1 115.0 190.0 2.1s 0.0s 13.3s
Runic Corruption from Runic Power Spent 46.2 24.0 73.0 6.4s 0.8s 73.3s
Festering Wound from Festering Strike 56.8 37.0 77.0 13.2s 1.1s 81.0s
Festering Wound from Infected Claws 30.7 14.0 54.0 9.7s 1.0s 126.6s
Festering Wound from Unholy Assault 14.6 12.0 16.0 91.7s 90.0s 99.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.00% 0.00% 8.13% 1.5s 0.0s 11.9s
ghoul - Energy Cap 0.31% 0.04% 1.35% 0.1s 0.0s 1.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Raise Dead0.0000.0000.000300.000240.008359.984
Army of the Dead6.0030.000138.96212.0080.000138.962
Summon Gargoyle4.3072.17515.2148.6155.51418.600
Apocalypse2.2410.00014.56615.4488.46431.266
Unholy Assault3.5240.0009.19612.8287.25620.965
Dark Transformation1.4810.00014.35910.3084.65924.029
Empower Rune Weapon31.6910.00074.26775.80968.155100.114
Death and Decay6.4860.000102.88859.0611.354147.387
Soul Reaper13.3240.000232.032207.666157.891259.704
Anti-Magic Shell5.6050.00078.22339.68526.265118.288

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=340479)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1272.037 / 1.3216.29025.308
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
32.69460.33392.444 / 90.929130.473181.045

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
Anti-Magic ShellRunic Power3.0515.120.65%4.950.140.90%
ApocalypseRune13.6412.398.19%0.911.269.21%
Empower Rune WeaponRunic Power11.4656.112.41%4.891.212.11%
Empower Rune WeaponRune11.4610.546.97%0.920.938.09%
Festering WoundRunic Power98.30292.7112.55%2.982.190.74%
Rune RegenerationRune128.22128.2284.83%1.000.000.00%
Runic AttenuationRunic Power71.64350.8515.05%4.907.342.05%
Army of the DeadRunic Power2.0019.750.85%9.880.251.25%
Clawing ShadowsRunic Power71.02710.1630.46%10.000.000.00%
Death and DecayRunic Power8.5085.033.65%10.000.000.00%
Festering StrikeRunic Power22.71454.1619.48%20.000.000.00%
OutbreakRunic Power11.62112.384.82%9.673.873.33%
Soul ReaperRunic Power15.40147.806.34%9.606.224.04%
Summon GargoyleRunic Power2.0087.503.75%43.7512.5012.50%
pet - ghoul
Dark TransformationEnergy6.94311.867.75%44.92382.3355.08%
Energy RegenEnergy1346.083710.3892.25%2.7619.880.53%
pet - army_ghoul
Energy RegenEnergy849.806946.67100.00%8.17411.575.59%
pet - apoc_ghoul
Energy RegenEnergy674.265249.82100.00%7.791551.5722.81%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.30%1.001.00931060.08
Clawing ShadowsRune 71.0271.0246.13%1.001.0033306.05
Death and DecayRune 8.508.505.52%1.001.009588.70
Death CoilRunic Power 96.372305.86100.00%23.9323.931233.38
Festering StrikeRune 22.7145.4229.50%2.002.0010332.07
OutbreakRune 11.6211.627.55%1.001.002250.02
Soul ReaperRune 15.4015.4010.00%1.001.0080285.68
pet - ghoul
ClawEnergy 39.311572.4638.44%40.0040.0082.50
Sweeping ClawsEnergy 62.942517.7861.56%40.0040.00237.59
pet - army_ghoul
ClawEnergy 207.318292.36100.00%40.0040.0026.89
pet - apoc_ghoul
ClawEnergy 189.887595.34100.00%40.0040.0039.29
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 327940.0 758.41 877.98 260593.2 292068.9 1936.0 327940.0
Runic Power 8.0 7.77 7.69 33.7 23.7 0.0 74.0
Rune 5.0 0.50 0.51 0.0 3.2 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 56758.88
Minimum 51132.73
Maximum 64902.04
Spread ( max - min ) 13769.32
Range [ ( max - min ) / 2 * 100% ] 12.13%
Standard Deviation 1976.6814
5th Percentile 53772.21
95th Percentile 60302.88
( 95th Percentile - 5th Percentile ) 6530.67
Mean Distribution
Standard Deviation 22.8263
95.00% Confidence Interval ( 56714.14 - 56803.62 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4660
0.1 Scale Factor Error with Delta=300 33355
0.05 Scale Factor Error with Delta=300 133419
0.01 Scale Factor Error with Delta=300 3335470
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 56758.88
Minimum 51132.73
Maximum 64902.04
Spread ( max - min ) 13769.32
Range [ ( max - min ) / 2 * 100% ] 12.13%
Standard Deviation 1976.6814
5th Percentile 53772.21
95th Percentile 60302.88
( 95th Percentile - 5th Percentile ) 6530.67
Mean Distribution
Standard Deviation 22.8263
95.00% Confidence Interval ( 56714.14 - 56803.62 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4660
0.1 Scale Factor Error with Delta=300 33355
0.05 Scale Factor Error with Delta=300 133419
0.01 Scale Factor Error with Delta=300 3335470
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 56758.88
Minimum 51132.73
Maximum 64902.04
Spread ( max - min ) 13769.32
Range [ ( max - min ) / 2 * 100% ] 12.13%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 9477151.24
Minimum 7168033.29
Maximum 12025996.51
Spread ( max - min ) 4857963.22
Range [ ( max - min ) / 2 * 100% ] 25.63%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 878.42
Minimum 0.00
Maximum 2321.22
Spread ( max - min ) 2321.22
Range [ ( max - min ) / 2 * 100% ] 132.12%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 757.32
Minimum 0.00
Maximum 1842.46
Spread ( max - min ) 1842.46
Range [ ( max - min ) / 2 * 100% ] 121.64%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2,if=!equipped.fyralath_the_dreamrender|raid_event.adds.exists
6 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
7 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
A 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
B 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
E 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
F 0.00 variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
Default action list Executed every time the actor is available.
# count action,conditions
G 1.00 auto_attack
H 0.00 call_action_list,name=variables
Call Action Lists
I 0.00 call_action_list,name=high_prio_actions
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=racials
L 0.00 run_action_list,name=garg_setup,if=variable.garg_setup_complete=0
M 0.00 call_action_list,name=cooldowns,if=variable.st_planning
N 0.00 call_action_list,name=aoe_cooldowns,if=variable.adds_remain
O 0.00 call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
P 0.00 call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
Q 0.00 call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
R 0.00 call_action_list,name=st,if=active_enemies<=3
actions.cooldowns
# count action,conditions
S 1.00 summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
ST/Cleave Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
T 5.94 dark_transformation,if=cooldown.apocalypse.remains<5
U 5.82 apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
V 2.08 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 abomination_limb,if=rune<3&variable.st_planning
W 3.33 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
X 15.40 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.garg_setup
# count action,conditions
Y 1.00 apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)
Garg Setup
0.00 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
Z 1.00 any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>1
a 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
b 0.31 empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=23
c 0.31 unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=23
d 1.00 dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
e 1.00 festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
0.00 death_coil,if=rune<=1
actions.high_prio_actions
# count action,conditions
0.00 mind_freeze,if=target.debuff.casting.react
Priority Actions
f 6.97 antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
0.00 antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle))
0.00 antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
0.00 invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=22|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.army_ghoul.remains<=18|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+10>cooldown.invoke_external_buff_power_infusion.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
g 1.46 potion,if=(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
h 1.00 army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
i 6.95 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|cooldown.unholy_assault.ready|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains|!talent.summon_gargoyle)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
j 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd&time>15|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration+3
k 2.00 berserking,if=(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(18>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=18|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|active_enemies>=2&death_and_decay.ticking)|fight_remains<=18
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration+3
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.st
# count action,conditions
l 81.37 death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
Single Target
0.00 epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
m 7.50 any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)
n 70.77 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
o 21.71 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4
p 8.05 death_coil
q 0.25 wound_spender,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack>=4
actions.trinkets
# count action,conditions
0.00 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&(active_enemies<5|active_enemies>21|fight_remains<4)&(debuff.festering_wound.stack>=2|time>15)
Trinkets
r 2.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<16|!talent.summon_gargoyle&pet.army_ghoul.active&pet.army_ghoul.remains<16)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(variable.damage_trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
s 2.74 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(variable.damage_trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGjrZedagiifiiYVWnnmnklnnlnllljnonlnnlnolnllsnlnnlnnllnnonpfjTlloUlmnnllonlnnllljolnlnlnonpfpnnloTlolUjWllmnnnnnilnnlonlllnfjnlnllonpTompUnnlnsoljllnlnnlonllnnnponplnrhjTSiifiVXWUlmnkXllnloXlmljlXlnnlXnlnlXlnloXflomTjXUilnXlnlnXllolXlnnnjXlnllfXslnlopXTmWUXiljlXllnnln

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 4 raise_dead PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 5 army_of_the_dead PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 6 trinket_1_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat 7 trinket_2_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat A trinket_1_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat B trinket_2_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat E trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat F damage_trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
0:00.000 default G auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
0:00.000 high_prio_actions j outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 bloodlust, corrupting_rage
0:00.000 trinkets r use_item_algethar_puzzle_box Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, corrupting_rage
0:01.353 garg_setup Z death_and_decay Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, algethar_puzzle, corrupting_rage
0:02.370 garg_setup e festering_strike Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_ground, algethar_puzzle, corrupting_rage
0:03.338 garg_setup d dark_transformation PR_Death_Knight_Unholy 48.0/100: 48% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_ground, algethar_puzzle, corrupting_rage
0:03.338 garg_setup a summon_gargoyle PR_Death_Knight_Unholy 48.0/100: 48% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:04.306 high_prio_actions g potion Fluffy_Pillow 98.0/100: 98% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:04.306 high_prio_actions i death_coil Fluffy_Pillow 98.0/100: 98% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:05.274 high_prio_actions i death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_ground, icy_talons, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.242 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 38.0/100: 38% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_ground, icy_talons(2), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.242 high_prio_actions i death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_ground, icy_talons(2), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.209 high_prio_actions i death_coil Fluffy_Pillow 13.0/100: 13% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:08.177 garg_setup Y apocalypse Fluffy_Pillow 13.0/100: 13% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.145 cooldowns V empower_rune_weapon PR_Death_Knight_Unholy 25.0/100: 25% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.145 cooldowns W unholy_assault Fluffy_Pillow 30.0/100: 30% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.988 st n clawing_shadows Fluffy_Pillow 30.0/100: 30% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:10.830 st n clawing_shadows Fluffy_Pillow 48.0/100: 48% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:11.673 st m death_and_decay Fluffy_Pillow 61.0/100: 61% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:12.558 st n clawing_shadows Fluffy_Pillow 71.0/100: 71% runic_power
3.0/6: 50% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.401 racials k berserking PR_Death_Knight_Unholy 84.0/100: 84% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.401 st l death_coil Fluffy_Pillow 84.0/100: 84% runic_power
2.0/6: 33% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:14.167 st n clawing_shadows Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:14.931 st n clawing_shadows Fluffy_Pillow 77.0/100: 77% runic_power
2.0/6: 33% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:15.697 st l death_coil Fluffy_Pillow 90.0/100: 90% runic_power
2.0/6: 33% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:16.463 st n clawing_shadows Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:17.229 st l death_coil Fluffy_Pillow 78.0/100: 78% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:17.994 st l death_coil Fluffy_Pillow 48.0/100: 48% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:18.760 st l death_coil Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:19.526 high_prio_actions j outbreak Fluffy_Pillow 23.0/100: 23% runic_power
5.0/6: 83% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:20.292 st n clawing_shadows Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:21.058 st o festering_strike Fluffy_Pillow 51.0/100: 51% runic_power
4.0/6: 67% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:21.824 st n clawing_shadows Fluffy_Pillow 71.0/100: 71% runic_power
2.0/6: 33% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:22.628 st l death_coil Fluffy_Pillow 84.0/100: 84% runic_power
1.0/6: 17% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:23.432 st n clawing_shadows Fluffy_Pillow 54.0/100: 54% runic_power
1.0/6: 17% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:24.236 st n clawing_shadows Fluffy_Pillow 72.0/100: 72% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:25.039 st l death_coil Fluffy_Pillow 90.0/100: 90% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:25.842 st n clawing_shadows Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:26.727 st o festering_strike Fluffy_Pillow 73.0/100: 73% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(15), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:27.612 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(15), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:28.497 st n clawing_shadows Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:29.381 st l death_coil Fluffy_Pillow 81.0/100: 81% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:30.398 st l death_coil Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:31.415 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 26.0/100: 26% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, corrupting_rage, elemental_potion_of_ultimate_power
0:31.415 st n clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, dragon_games_equipment, corrupting_rage, elemental_potion_of_ultimate_power
0:32.431 st l death_coil Fluffy_Pillow 44.0/100: 44% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2), commander_of_the_dead, corrupting_rage, elemental_potion_of_ultimate_power
0:33.447 st n clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage, elemental_potion_of_ultimate_power
0:34.464 st n clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
0:35.480 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
0:36.497 st n clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
0:37.513 st n clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
0:38.530 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
0:39.546 st l death_coil Fluffy_Pillow 16.0/100: 16% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(6), corrupting_rage
0:40.563 st n clawing_shadows Fluffy_Pillow 16.0/100: 16% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
0:41.884 st n clawing_shadows Fluffy_Pillow 29.0/100: 29% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(7), corrupting_rage
0:43.204 st o festering_strike Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(8), corrupting_rage
0:44.525 st n clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(8), corrupting_rage
0:45.846 st p death_coil Fluffy_Pillow 80.0/100: 80% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(9), corrupting_rage
0:47.166 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 55.0/100: 55% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(9), corrupting_rage
0:47.166 high_prio_actions j outbreak Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(9), corrupting_rage
0:48.487 cooldowns T dark_transformation PR_Death_Knight_Unholy 65.0/100: 65% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(9), corrupting_rage
0:49.807 st l death_coil Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:51.127 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, corrupting_rage
0:52.448 st o festering_strike Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:53.769 cooldowns U apocalypse Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:55.089 st l death_coil Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(4), commander_of_the_dead, corrupting_rage
0:56.409 st m death_and_decay Fluffy_Pillow 42.0/100: 42% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
0:57.730 st n clawing_shadows Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(4), commander_of_the_dead, corrupting_rage
0:58.988 st n clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(5), commander_of_the_dead, corrupting_rage
1:00.246 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, corrupting_rage
1:01.504 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:02.762 st o festering_strike Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:04.020 st n clawing_shadows Fluffy_Pillow 78.0/100: 78% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:05.278 st l death_coil Fluffy_Pillow 96.0/100: 96% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
1:06.536 st n clawing_shadows Fluffy_Pillow 66.0/100: 66% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
1:07.857 st n clawing_shadows Fluffy_Pillow 79.0/100: 79% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, corrupting_rage
1:09.178 st l death_coil Fluffy_Pillow 92.0/100: 92% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, corrupting_rage
1:10.499 st l death_coil Fluffy_Pillow 67.0/100: 67% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(9), commander_of_the_dead, corrupting_rage
1:11.820 st l death_coil Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead, corrupting_rage
1:13.141 high_prio_actions j outbreak Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(9), commander_of_the_dead, corrupting_rage
1:14.461 st o festering_strike Fluffy_Pillow 22.0/100: 22% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
1:15.781 st l death_coil Fluffy_Pillow 47.0/100: 47% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
1:17.101 st n clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
2.0/6: 33% rune		 icy_talons(3), commander_of_the_dead, corrupting_rage
1:18.422 st l death_coil Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune		 icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
1:19.742 st n clawing_shadows Fluffy_Pillow 5.0/100: 5% runic_power
2.0/6: 33% rune		 icy_talons(3), runic_corruption, festermight, corrupting_rage
1:21.062 st l death_coil Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune		 icy_talons(3), sudden_doom, festermight(2), corrupting_rage
1:22.382 st n clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune		 icy_talons(3), festermight(2), corrupting_rage
1:23.702 st o festering_strike Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune		 icy_talons(3), festermight(3), corrupting_rage
1:25.023 st n clawing_shadows Fluffy_Pillow 61.0/100: 61% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(3), corrupting_rage
1:26.344 st p death_coil Fluffy_Pillow 79.0/100: 79% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(4), corrupting_rage
1:27.665 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 49.0/100: 49% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(4), corrupting_rage
1:27.665 st p death_coil Fluffy_Pillow 49.0/100: 49% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
1:28.986 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
1:30.307 st n clawing_shadows Fluffy_Pillow 32.0/100: 32% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
1:31.628 st l death_coil Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
1:32.949 st o festering_strike Fluffy_Pillow 15.0/100: 15% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(6), corrupting_rage
1:34.269 cooldowns T dark_transformation PR_Death_Knight_Unholy 40.0/100: 40% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
1:35.590 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:36.911 st o festering_strike Fluffy_Pillow 15.0/100: 15% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
1:38.232 st l death_coil Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
1:39.553 cooldowns U apocalypse Fluffy_Pillow 5.0/100: 5% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, corrupting_rage
1:40.874 high_prio_actions j outbreak Fluffy_Pillow 17.0/100: 17% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
1:42.195 cooldowns W unholy_assault Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
1:43.515 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:44.835 st l death_coil Fluffy_Pillow 2.0/100: 2% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:46.154 st m death_and_decay Fluffy_Pillow 2.0/100: 2% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:47.475 st n clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
5.0/6: 83% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:48.733 st n clawing_shadows Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead
1:49.991 st n clawing_shadows Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead
1:51.249 st n clawing_shadows Fluffy_Pillow 56.0/100: 56% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead
1:52.507 st n clawing_shadows Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(8), commander_of_the_dead
1:53.765 high_prio_actions i death_coil Fluffy_Pillow 82.0/100: 82% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), sudden_doom, unholy_assault, festermight(9), commander_of_the_dead
1:55.023 st l death_coil Fluffy_Pillow 87.0/100: 87% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), runic_corruption, unholy_assault, festermight(9), commander_of_the_dead
1:56.281 st n clawing_shadows Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, unholy_assault, festermight(9), commander_of_the_dead
1:57.601 st n clawing_shadows Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, unholy_assault, festermight(10), commander_of_the_dead
1:58.922 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(11), commander_of_the_dead
2:00.242 st o festering_strike Fluffy_Pillow 58.0/100: 58% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), runic_corruption, unholy_assault, commander_of_the_dead
2:01.563 st n clawing_shadows Fluffy_Pillow 78.0/100: 78% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), unholy_assault, commander_of_the_dead
2:02.884 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead
2:04.203 st l death_coil Fluffy_Pillow 61.0/100: 61% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
2:05.524 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, corrupting_rage
2:06.844 st n clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight, corrupting_rage
2:08.165 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 19.0/100: 19% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
2:08.165 high_prio_actions j outbreak Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
2:09.485 st n clawing_shadows Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
2:10.806 st l death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
2:12.127 st n clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
2:13.448 st l death_coil Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:14.769 st l death_coil Fluffy_Pillow 0.0/100: 0% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(4), corrupting_rage
2:16.089 st o festering_strike Fluffy_Pillow 0.0/100: 0% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
2:17.410 st n clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:18.731 st p death_coil Fluffy_Pillow 33.0/100: 33% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(5), corrupting_rage
2:20.051 cooldowns T dark_transformation PR_Death_Knight_Unholy 8.0/100: 8% runic_power
2.0/6: 33% rune		 icy_talons(3), runic_corruption, festermight(5), corrupting_rage
2:21.372 st o festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:22.693 st m death_and_decay Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, corrupting_rage
2:24.013 st p death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune		 unholy_ground, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, corrupting_rage
2:25.271 cooldowns U apocalypse Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune		 unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
2:26.529 st n clawing_shadows Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune		 unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
2:27.787 st n clawing_shadows Fluffy_Pillow 73.0/100: 73% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:29.045 st l death_coil Fluffy_Pillow 86.0/100: 86% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:30.303 st n clawing_shadows Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:31.415 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 69.0/100: 69% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
2:31.561 st o festering_strike Fluffy_Pillow 69.0/100: 69% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, dragon_games_equipment, corrupting_rage
2:32.819 st l death_coil Fluffy_Pillow 94.0/100: 94% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
2:34.139 high_prio_actions j outbreak Fluffy_Pillow 64.0/100: 64% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead, corrupting_rage
2:35.458 st l death_coil Fluffy_Pillow 79.0/100: 79% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
2:36.779 st l death_coil Fluffy_Pillow 49.0/100: 49% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
2:38.100 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
2:39.420 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, corrupting_rage
2:40.741 st n clawing_shadows Fluffy_Pillow 2.0/100: 2% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(8), commander_of_the_dead, corrupting_rage
2:42.060 st n clawing_shadows Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead, corrupting_rage
2:43.381 st l death_coil Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(10), commander_of_the_dead, corrupting_rage
2:44.702 st o festering_strike Fluffy_Pillow 3.0/100: 3% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(10), commander_of_the_dead, corrupting_rage
2:46.023 st n clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
2:47.344 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
2:48.665 st l death_coil Fluffy_Pillow 6.0/100: 6% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight, commander_of_the_dead, corrupting_rage
2:49.986 st n clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
2:51.307 st n clawing_shadows Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
2:52.627 st n clawing_shadows Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
2:53.948 st p death_coil Fluffy_Pillow 50.0/100: 50% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:55.268 st o festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
2:56.589 st n clawing_shadows Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(4)
2:57.909 st p death_coil Fluffy_Pillow 58.0/100: 58% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(5)
2:59.230 st l death_coil Fluffy_Pillow 28.0/100: 28% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(5)
3:00.550 st n clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(5)
3:01.372 trinkets r use_item_algethar_puzzle_box Fluffy_Pillow 46.0/100: 46% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(6)
3:03.131 high_prio_actions h army_of_the_dead PR_Death_Knight_Unholy 46.0/100: 46% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(6), algethar_puzzle
3:04.452 high_prio_actions j outbreak Fluffy_Pillow 61.0/100: 61% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(6), algethar_puzzle
3:05.773 cooldowns T dark_transformation PR_Death_Knight_Unholy 71.0/100: 71% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(6), algethar_puzzle
3:07.093 cooldowns S summon_gargoyle PR_Death_Knight_Unholy 71.0/100: 71% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:07.093 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:08.414 high_prio_actions i death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:09.735 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 40.0/100: 40% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:09.735 high_prio_actions i death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:11.056 cooldowns V empower_rune_weapon PR_Death_Knight_Unholy 15.0/100: 15% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:11.056 cooldowns X soul_reaper Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:12.204 cooldowns W unholy_assault Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:13.353 cooldowns U apocalypse Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:14.502 st l death_coil Fluffy_Pillow 52.0/100: 52% runic_power
5.0/6: 83% rune		 antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:15.651 st m death_and_decay Fluffy_Pillow 52.0/100: 52% runic_power
5.0/6: 83% rune		 antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:16.800 st n clawing_shadows Fluffy_Pillow 72.0/100: 72% runic_power
6.0/6: 100% rune		 unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:17.894 racials k berserking PR_Death_Knight_Unholy 85.0/100: 85% runic_power
5.0/6: 83% rune		 unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:17.894 cooldowns X soul_reaper Fluffy_Pillow 85.0/100: 85% runic_power
5.0/6: 83% rune		 berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:18.889 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:19.883 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:20.877 st n clawing_shadows Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune		 berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:21.872 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
4.0/6: 67% rune		 berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:22.867 st o festering_strike Fluffy_Pillow 68.0/100: 68% runic_power
5.0/6: 83% rune		 berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:23.861 cooldowns X soul_reaper Fluffy_Pillow 88.0/100: 88% runic_power
3.0/6: 50% rune		 berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:24.889 st l death_coil Fluffy_Pillow 98.0/100: 98% runic_power
2.0/6: 33% rune		 berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:25.883 st m death_and_decay Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune		 berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:26.926 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:27.921 high_prio_actions j outbreak Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:28.915 st l death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune		 berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:29.909 cooldowns X soul_reaper Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:31.003 st l death_coil Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), sudden_doom, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:32.096 st n clawing_shadows Fluffy_Pillow 58.0/100: 58% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:33.354 st n clawing_shadows Fluffy_Pillow 76.0/100: 76% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), commander_of_the_dead, corrupting_rage
3:34.612 st l death_coil Fluffy_Pillow 89.0/100: 89% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
3:35.870 cooldowns X soul_reaper Fluffy_Pillow 59.0/100: 59% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), runic_corruption, festermight, corrupting_rage
3:37.230 st n clawing_shadows Fluffy_Pillow 69.0/100: 69% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), festermight, corrupting_rage
3:38.550 st l death_coil Fluffy_Pillow 82.0/100: 82% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
3:39.871 st n clawing_shadows Fluffy_Pillow 52.0/100: 52% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
3:41.191 st l death_coil Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:42.511 cooldowns X soul_reaper Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
3:43.832 st l death_coil Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:45.151 st n clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
3:46.472 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:47.793 st o festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:49.114 cooldowns X soul_reaper Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune		 icy_talons(3), festermight(4), corrupting_rage
3:50.435 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 38.0/100: 38% runic_power
2.0/6: 33% rune		 icy_talons(3), sudden_doom, festermight(4), corrupting_rage
3:50.435 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 antimagic_shell, icy_talons(3), sudden_doom, festermight(4), corrupting_rage
3:51.756 st o festering_strike Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune		 antimagic_shell, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
3:53.077 st m death_and_decay Fluffy_Pillow 63.0/100: 63% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), festermight(4), corrupting_rage
3:54.398 cooldowns T dark_transformation PR_Death_Knight_Unholy 73.0/100: 73% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_ground, icy_talons(3), corrupting_rage
3:55.656 high_prio_actions j outbreak Fluffy_Pillow 73.0/100: 73% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:56.914 cooldowns X soul_reaper Fluffy_Pillow 83.0/100: 83% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:58.172 cooldowns U apocalypse Fluffy_Pillow 98.0/100: 98% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, corrupting_rage
3:59.609 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(4), commander_of_the_dead, corrupting_rage
4:00.867 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:02.123 st n clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:03.380 cooldowns X soul_reaper Fluffy_Pillow 88.0/100: 88% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:04.701 st l death_coil Fluffy_Pillow 98.0/100: 98% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:06.021 st n clawing_shadows Fluffy_Pillow 68.0/100: 68% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:07.342 st l death_coil Fluffy_Pillow 81.0/100: 81% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
4:08.662 st n clawing_shadows Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
4:09.983 cooldowns X soul_reaper Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
4:11.304 st l death_coil Fluffy_Pillow 79.0/100: 79% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
4:12.624 st l death_coil Fluffy_Pillow 49.0/100: 49% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead, corrupting_rage
4:13.944 st o festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
4:15.265 st l death_coil Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
4:16.585 cooldowns X soul_reaper Fluffy_Pillow 14.0/100: 14% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), sudden_doom, festermight(7), commander_of_the_dead, corrupting_rage
4:17.906 st l death_coil Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(7), commander_of_the_dead, corrupting_rage
4:19.227 st n clawing_shadows Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, commander_of_the_dead, corrupting_rage
4:20.548 st n clawing_shadows Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight, commander_of_the_dead
4:21.869 st n clawing_shadows Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(2), commander_of_the_dead
4:23.189 high_prio_actions j outbreak Fluffy_Pillow 68.0/100: 68% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3), commander_of_the_dead
4:24.510 cooldowns X soul_reaper Fluffy_Pillow 78.0/100: 78% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(3)
4:25.831 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3)
4:27.151 st n clawing_shadows Fluffy_Pillow 63.0/100: 63% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3)
4:28.471 st l death_coil Fluffy_Pillow 76.0/100: 76% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(4)
4:29.792 st l death_coil Fluffy_Pillow 46.0/100: 46% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(4)
4:31.113 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 16.0/100: 16% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(4)
4:31.113 cooldowns X soul_reaper Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(4)
4:31.415 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(4)
4:32.434 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune		 antimagic_shell, icy_talons(3), festermight(4)
4:33.755 st n clawing_shadows Fluffy_Pillow 1.0/100: 1% runic_power
2.0/6: 33% rune		 antimagic_shell, icy_talons(3), festermight(4)
4:35.076 st l death_coil Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), sudden_doom, festermight(5), corrupting_rage
4:36.397 st o festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
4:37.718 st p death_coil Fluffy_Pillow 49.0/100: 49% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), sudden_doom, festermight(5), corrupting_rage
4:39.038 cooldowns X soul_reaper Fluffy_Pillow 49.0/100: 49% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(5), corrupting_rage
4:40.359 cooldowns T dark_transformation PR_Death_Knight_Unholy 64.0/100: 64% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, corrupting_rage
4:41.680 st m death_and_decay Fluffy_Pillow 64.0/100: 64% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, corrupting_rage
4:43.001 cooldowns W unholy_assault Fluffy_Pillow 79.0/100: 79% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, corrupting_rage
4:44.259 cooldowns U apocalypse Fluffy_Pillow 79.0/100: 79% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, commander_of_the_dead, corrupting_rage
4:45.517 cooldowns X soul_reaper Fluffy_Pillow 96.0/100: 96% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:46.775 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:48.033 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:49.291 high_prio_actions j outbreak Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:50.549 st l death_coil Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:51.807 cooldowns X soul_reaper Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:53.128 st l death_coil Fluffy_Pillow 65.0/100: 65% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:54.449 st l death_coil Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune		 icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:55.770 st n clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:57.090 st n clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:58.411 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
4:59.732 st n clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6014 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3848 0 16397 15616 9166
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 327940 312320 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 21.57% 15.36% 1504
Haste 13.88% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6314 5922 0
Mastery 44.93% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +923 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +923 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Talents

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowUnholy Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=sizzling_seafood_medley
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2,if=!equipped.fyralath_the_dreamrender|raid_event.adds.exists
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
actions.precombat+=/variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl

# Executed every time the actor is available.
actions=auto_attack
# Call Action Lists
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup_complete=0
actions+=/call_action_list,name=cooldowns,if=variable.st_planning
actions+=/call_action_list,name=aoe_cooldowns,if=variable.adds_remain
actions+=/call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
actions+=/call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
actions+=/call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
actions+=/call_action_list,name=st,if=active_enemies<=3

# Generic AoE
actions.aoe=epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# AoE Burst
actions.aoe_burst=epidemic,if=(rune<1|talent.bursting_sores&death_knight.fwounded_targets=0|!talent.bursting_sores)&!variable.pooling_runic_power&(active_enemies>=6|runic_power.deficit<30|buff.festermight.stack=20)
actions.aoe_burst+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=1
actions.aoe_burst+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_burst+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe_burst+=/wound_spender

# AoE Cooldowns
actions.aoe_cooldowns=vile_contagion,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.aoe_cooldowns+=/summon_gargoyle
actions.aoe_cooldowns+=/abomination_limb,if=rune<2|buff.festermight.stack>10|!talent.festermight|buff.festermight.up&buff.festermight.remains<12
actions.aoe_cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=talent.bursting_sores&debuff.festering_wound.up&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
actions.aoe_cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=!talent.bursting_sores&debuff.festering_wound.stack>=4|set_bonus.tier31_2pc&debuff.festering_wound.stack>=1
actions.aoe_cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.stack<=2|buff.dark_transformation.up
actions.aoe_cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.aoe_cooldowns+=/dark_transformation,if=(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.aoe_cooldowns+=/empower_rune_weapon,if=buff.dark_transformation.up
actions.aoe_cooldowns+=/sacrificial_pact,if=!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# AoE Setup
actions.aoe_setup=any_dnd,if=(!talent.bursting_sores|death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets>=8|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5)
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies&talent.bursting_sores
actions.aoe_setup+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies
actions.aoe_setup+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=cooldown.apocalypse.remains<variable.apoc_timing&debuff.festering_wound.stack<4
actions.aoe_setup+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# ST/Cleave Cooldowns
actions.cooldowns=summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=cooldown.apocalypse.remains<5
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)

# Garg Setup
actions.garg_setup=apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.garg_setup+=/any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>1
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
actions.garg_setup+=/empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=23
actions.garg_setup+=/unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=23
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
actions.garg_setup+=/festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
actions.garg_setup+=/death_coil,if=rune<=1

# Priority Actions
actions.high_prio_actions=mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
actions.high_prio_actions+=/antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle))
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
actions.high_prio_actions+=/invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=22|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.army_ghoul.remains<=18|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+10>cooldown.invoke_external_buff_power_infusion.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))
actions.high_prio_actions+=/potion,if=(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
actions.high_prio_actions+=/army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
actions.high_prio_actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|cooldown.unholy_assault.ready|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
actions.high_prio_actions+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains|!talent.summon_gargoyle)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
actions.high_prio_actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd&time>15|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration+3
actions.racials+=/berserking,if=(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(18>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=18|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|active_enemies>=2&death_and_decay.ticking)|fight_remains<=18
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration+3
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Single Target
actions.st=death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
actions.st+=/epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
actions.st+=/any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)
actions.st+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.st+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4
actions.st+=/death_coil
actions.st+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack>=4

# Trinkets
actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&(active_enemies<5|active_enemies>21|fight_remains<4)&(debuff.festering_wound.stack>=2|time>15)
actions.trinkets+=/use_item,use_off_gcd=1,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<16|!talent.summon_gargoyle&pet.army_ghoul.active&pet.army_ghoul.remains<16)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(variable.damage_trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(variable.damage_trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
actions.variables+=/variable,name=garg_setup_complete,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&(cooldown.apocalypse.remains>1|!talent.apocalypse)|!talent.summon_gargoyle|time>20
actions.variables+=/variable,name=apoc_timing,op=setif,value=7,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
actions.variables+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
actions.variables+=/variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4|set_bonus.tier31_4pc&(pet.apoc_magus.active|pet.army_magus.active)&debuff.festering_wound.stack>=1)|fight_remains<5&debuff.festering_wound.stack>=1
actions.variables+=/variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions.variables+=/variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies=1&(!raid_event.adds.exists|raid_event.adds.in>15)
actions.variables+=/variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
actions.variables+=/variable,name=spend_rp,op=setif,value=1,value_else=0,condition=(!talent.rotten_touch|talent.rotten_touch&!debuff.rotten_touch.up|runic_power.deficit<20)&(!set_bonus.tier31_4pc|set_bonus.tier31_4pc&!(pet.apoc_magus.active|pet.army_magus.active)|runic_power.deficit<20|rune<3)&((talent.improved_death_coil&(active_enemies=2|talent.coil_of_devastation)|rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3|!variable.pop_wounds&debuff.festering_wound.stack>=4))

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=9166
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 18224 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
18224.4 18224.4 10.9 / 0.060% 1882.3 / 10.3% 176.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
100.4 99.9 Mana 0.00% 51.8 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 18224
Devouring Plague 4391 24.1% 21.0 14.28s 62788 53935 Direct 21.0 25036 50201 28364 13.2%
Periodic 65.0 9793 19640 11100 13.3% 41.4%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.95 20.95 64.97 64.97 0.00 1.1641 1.9094 1315482.32 1315482.32 0.00% 8861.45 53935.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.78% 18.18 7 25 25036.12 23608 34132 25039.46 23921 26396 455173 455173 0.00%
crit 13.22% 2.77 0 10 50200.96 47215 68264 47361.57 0 68264 139084 139084 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.73% 56.35 35 73 9793.35 2435 16211 9795.41 8984 10651 551850 551850 0.00%
crit 13.27% 8.62 1 22 19640.19 4870 32421 19639.63 7672 29564 169375 169375 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.912450
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.06

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.908300
  • base_td:0.00
  • base_td_mult:1.06
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 191.2%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [K]:20.95
  • if_expr:remains<=gcd.max|insanity.deficit<=16
  • target_if_expr:!talent.distorted_reality|active_enemies=1|remains<=gcd.max

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Percent Cost Mind Devourer3732041-1.000Spell Data
Mind Blast 2682 14.7% 35.8 8.44s 22444 19171 Direct 35.8 19806 39695 22444 13.3%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.81 35.81 0.00 0.00 0.00 1.1707 0.0000 803801.20 803801.20 0.00% 19170.53 19170.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.74% 31.06 19 42 19806.05 18267 28539 19811.38 19110 20718 615268 615268 0.00%
crit 13.26% 4.75 0 16 39694.74 36535 57078 39434.74 0 53660 188533 188533 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:625.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.16

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage{$?s424509=false}[ and increases your spell damage to the target by {$424509s1=10}% for {$214621d=9 seconds}.][.]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s2=0}/100} Insanity.|r][]

Action Priority List

    main
    [M]:35.95
  • if_expr:(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703313PCT0.490
Spell Direct AmountShadow Priest13703322PCT0.370
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Mind Spike 6680 36.7% 176.8 1.68s 11328 9680 Direct 176.8 9997 20034 11328 13.3%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 176.77 176.77 0.00 0.00 0.00 1.1703 0.0000 2002387.99 2002387.99 0.00% 9679.83 9679.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.74% 153.33 113 198 9996.76 9238 14432 9999.41 9731 10470 1532770 1532770 0.00%
crit 13.26% 23.44 7 45 20034.20 18476 28864 20040.66 18973 21922 469618 469618 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.808652
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.06

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage. |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity.|r

Action Priority List

    filler
    [H]:177.41
  • target_if_expr:dot.devouring_plague.remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Shadow Weaving 61 0.3% 33.0 6.42s 545 0 Direct 33.0 545 0 545 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.00 33.00 0.00 0.00 0.00 0.0000 0.0000 17999.92 17999.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 33.00 33 33 545.46 326 1603 545.45 472 699 18000 18000 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:325.81
  • base_dd_max:325.81
  • base_dd_mult:1.06

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Shadow Word: Death 859 4.7% 6.2 10.33s 41520 34285 Direct 6.2 36271 73026 41520 14.3%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.20 6.20 0.00 0.00 0.00 1.2112 0.0000 257238.73 257238.73 0.00% 34284.78 34284.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.72% 5.31 1 8 36271.08 31539 49273 36286.07 31539 42924 192625 192625 0.00%
crit 14.28% 0.88 0 6 73025.91 63077 98545 44771.71 0 98545 64614 64614 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.98

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to your target. If your target is not killed by Shadow Word: Death, you take backlash damage equal to {$s5=8}% of your maximum health.{$?=}A364675[ Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][ Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s4=0}/100} Insanity.|r][]

Action Priority List

    filler
    [G]:6.21
  • target_if_expr:target.health.pct<20|(buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703315PCT0.600
Spell Direct AmountShadow Priest13703320PCT-0.420
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Soulseeker Arrow 1045 5.7% 7.0 38.03s 44526 0 Periodic 80.0 3915 0 3915 0.0% 37.8%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 0.00 79.98 79.98 2.35 0.0000 1.4167 313166.22 313166.22 0.00% 2763.78 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 79.98 14 170 3915.40 121 4407 3911.31 3815 4106 313166 313166 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3629.20
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1730}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 2011 11.0% 13.5 21.05s 44691 37966 Periodic 127.8 4159 8335 4716 13.3% 99.4%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.49 0.00 127.83 127.83 13.49 1.1772 2.3335 602829.53 602829.53 0.00% 1918.88 37966.34
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.67% 110.79 77 145 4159.46 9 5947 4160.54 4037 4343 460807 460807 0.00%
crit 13.33% 17.04 4 35 8334.71 19 11895 8337.60 7265 9252 142022 142022 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.59
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [L]:13.49
  • if_expr:refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
  • target_if_expr:remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Periodic AmountShadow Priest1370334PCT0.500
Spell Direct AmountShadow Priest1370335PCT0.500
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
pet - shadowfiend 4198 / 496
melee 4198 2.7% 33.0 6.42s 4452 4304 Direct 33.0 3935 7873 4452 13.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.00 33.00 0.00 0.00 0.00 1.0344 0.0000 146919.74 146919.74 0.00% 4304.21 4304.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.87% 28.67 19 33 3935.13 3718 4573 3935.12 3794 4293 112811 112811 0.00%
crit 13.13% 4.33 0 14 7873.30 7435 9147 7794.34 0 9147 34108 34108 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 1.0 0.00s

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    cds
    [E]:1.00
  • if_expr:buff.power_infusion.up|fight_remains<=15
Devouring Plague (_heal) 85.9 3.41s

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 85.92 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 191.2%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Percent Cost Mind Devourer3732041-1.000Spell Data
Phial of Static Empowerment 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [D]:1.00
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Shadowfiend 2.0 0.00s

Stats Details: Shadowfiend

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0791 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowfiend

  • id:34433
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:343726
  • description:Summons a shadowy fiend to attack the target for {$d=15 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$262485s1=200}/100} Insanity each time the Shadowfiend attacks.|r][ |cFFFFFFFFGenerates {$=}{{$s4=5}/10}.1% Mana each time the Shadowfiend attacks.|r]

Action Priority List

    main
    [J]:2.00
  • if_expr:variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
Shadowform 1.0 0.00s

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 1.0 0.00s

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 127.8 2.33s

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 127.83 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Periodic AmountShadow Priest1370334PCT0.500
Spell Direct AmountShadow Priest1370335PCT0.500
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 1.0 0.0 0.0s 0.0s 14.4s 4.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.5s / 15.0s
  • uptime_min/max:3.79% / 6.24%

Stack Uptimes

  • blood_fury_1:4.86%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Devoured Pride 1.0 0.0 0.0s 0.0s 15.0s 5.07% 5.84% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s
  • uptime_min/max:4.17% / 6.25%

Stack Uptimes

  • devoured_pride_1:5.07%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0s 0.0s 29.4s 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.5s / 30.0s
  • uptime_min/max:8.01% / 12.49%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0s 0.0s 300.0s 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 61.3s 45.9s 16.5s 23.61% 0.00% 1.1 (1.1) 4.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 210.1s
  • trigger_min/max:0.1s / 197.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.1s
  • uptime_min/max:4.77% / 58.53%

Stack Uptimes

  • sophic_devotion_1:23.61%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.2 0.0 0.0s 0.0s 19.4s 1.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.6s / 20.0s
  • uptime_min/max:0.00% / 8.28%

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:1.63%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.3 0.0 0.0s 0.0s 19.4s 1.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.32%

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:1.67%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.2 0.0 0.0s 0.0s 19.4s 1.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.31%

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:1.62%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.2 0.0 0.0s 0.0s 19.4s 1.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.31%

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:1.63%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0s 0.0s 300.0s 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:Primary stat is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Idol of Y'Shaarj Devoured Violence procs 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 85.32% 83.21% 87.14% 6.3s 0.0s 9.1s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Shadow Word: Death39.1850.000289.272242.788192.880294.314
Shadowfiend0.3500.0000.7290.7000.6670.729
Mind Blast0.253-0.0001.9039.1857.81712.976

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Mana RegenMana716.0929956.59100.00%41.83736824.7996.09%
ShadowfiendInsanity33.0066.006.16%2.000.000.00%
Mind BlastInsanity35.81214.8920.07%6.000.000.00%
Mind SpikeInsanity176.77707.0766.04%4.000.000.00%
Shadow Word: DeathInsanity6.2024.782.31%4.000.000.00%
Vampiric TouchInsanity14.4957.955.41%4.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 20.951047.56100.00%50.0050.001255.76
Mind BlastMana 35.8122383.9374.30%625.00625.0035.91
Shadow Word: DeathMana 6.207744.3025.70%1250.001249.9933.22
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 273300.0 363.10 431.18 466557.0 252876.7 224905.2 273300.0
Mana 250000.0 99.86 100.43 736824.5 249828.3 248130.1 250000.0
Insanity 4.0 3.57 3.49 0.0 23.1 0.0 52.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 18224.35
Minimum 16818.33
Maximum 20156.62
Spread ( max - min ) 3338.29
Range [ ( max - min ) / 2 * 100% ] 9.16%
Standard Deviation 479.9919
5th Percentile 17464.82
95th Percentile 19070.37
( 95th Percentile - 5th Percentile ) 1605.54
Mean Distribution
Standard Deviation 5.5428
95.00% Confidence Interval ( 18213.49 - 18235.22 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2665
0.1 Scale Factor Error with Delta=300 1967
0.05 Scale Factor Error with Delta=300 7868
0.01 Scale Factor Error with Delta=300 196677
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 18224.35
Minimum 16818.33
Maximum 20156.62
Spread ( max - min ) 3338.29
Range [ ( max - min ) / 2 * 100% ] 9.16%
Standard Deviation 479.9919
5th Percentile 17464.82
95th Percentile 19070.37
( 95th Percentile - 5th Percentile ) 1605.54
Mean Distribution
Standard Deviation 5.5428
95.00% Confidence Interval ( 18213.49 - 18235.22 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2665
0.1 Scale Factor Error with Delta=300 1967
0.05 Scale Factor Error with Delta=300 7868
0.01 Scale Factor Error with Delta=300 196677
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 18224.35
Minimum 16818.33
Maximum 20156.62
Spread ( max - min ) 3338.29
Range [ ( max - min ) / 2 * 100% ] 9.16%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 5312905.90
Minimum 4038588.02
Maximum 6639714.17
Spread ( max - min ) 2601126.16
Range [ ( max - min ) / 2 * 100% ] 24.48%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 431.13
Minimum 374.43
Maximum 489.72
Spread ( max - min ) 115.29
Range [ ( max - min ) / 2 * 100% ] 13.37%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 363.26
Minimum 277.28
Maximum 437.98
Spread ( max - min ) 160.70
Range [ ( max - min ) / 2 * 100% ] 22.12%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 shadowform,if=!buff.shadowform.up
5 0.00 arcane_torrent
6 0.00 shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(!set_bonus.tier31_4pc|spell_targets.shadow_crash>1)
7 0.00 vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice|set_bonus.tier31_4pc&spell_targets.shadow_crash=1
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=holding_crash,op=set,value=raid_event.adds.in<15
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
8 0.00 run_action_list,name=aoe,if=active_enemies>2
9 0.00 run_action_list,name=main
actions.cds
# count action,conditions
D 1.00 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
TODO: Check VE/DA enter conditions based on dots
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
E 1.00 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 use_item,name=nymues_unraveling_spindle,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<3+gcd.max|fight_remains<15)
Use Nymue's before we go into our cooldowns
0.00 use_item,name=belorrelos_the_suncaller,use_off_gcd=1,if=gcd.remains>0&(!raid_event.adds.exists&!prev_gcd.1.mindbender|raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)|fight_remains<20
Use Belor'relos, the Suncaller before we go into our cooldowns
0.00 divine_star,if=(raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)&equipped.belorrelos_the_suncaller&trinket.belorrelos_the_suncaller.cooldown.remains<=gcd.max
Fit in a Divine Star as you cast Belor's for the free GCD.
0.00 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
Sync Power Infusion with Voidform or Dark Ascension
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
0.00 dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
F 0.00 call_action_list,name=trinkets
0.00 desperate_prayer,if=health.pct<=75
Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.filler
# count action,conditions
0.00 vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
G 6.21 shadow_word_death,target_if=target.health.pct<20|(buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking
0.00 mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=dot.devouring_plague.remains>cast_time
0.00 mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up
0.00 mindgames,target_if=max:dot.devouring_plague.remains
0.00 shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
0.00 halo,if=spell_targets>1
Save up to 20s if adds are coming soon.
H 177.41 mind_spike,target_if=max:dot.devouring_plague.remains
0.00 mind_flay,target_if=max:dot.devouring_plague.remains,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 divine_star
0.00 shadow_crash,if=raid_event.adds.in>20&!set_bonus.tier31_4pc
Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 shadow_word_death,target_if=max:dot.devouring_plague.remains
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain,target_if=max:dot.devouring_plague.remains,if=set_bonus.tier31_4pc
Use Shadow Word: Pain while moving as a low-priority action with T31 4pc
0.00 shadow_word_pain,target_if=min:remains,if=!set_bonus.tier31_4pc
Use Shadow Word: Pain while moving as a low-priority action without T31 4pc
actions.main
# count action,conditions
0.00 variable,name=dots_up,op=set,value=active_dot.vampiric_touch=active_enemies|action.shadow_crash.in_flight&talent.whispering_shadows
I 0.00 call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
J 2.00 mindbender,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active and sync with Dark Ascension
K 20.95 devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=remains<=gcd.max|insanity.deficit<=16
0.00 shadow_word_death,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)&dot.devouring_plague.ticking
0.00 mind_blast,target_if=dot.devouring_plague.remains>execute_time&(cooldown.mind_blast.full_recharge_time<=gcd.max+execute_time)|pet.fiend.remains<=execute_time+gcd.max,if=pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>execute_time&active_enemies<=7
High priority Mind Blast action when using Inescapable Torment
0.00 shadow_word_death,target_if=dot.devouring_plague.ticking&pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
0.00 void_bolt,if=variable.dots_up
0.00 devouring_plague,if=fight_remains<=duration+4
Spend your Insanity on Devouring Plague at will if the fight will end in less than 10s
0.00 devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=(remains<=gcd.max|remains<3&cooldown.void_torrent.up)|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2|buff.mind_devourer.up&pmultiplier<1.2
Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
0.00 shadow_word_death,if=set_bonus.tier31_2pc
0.00 shadow_crash,if=!variable.holding_crash&(dot.vampiric_touch.refreshable|buff.deaths_torment.stack>9&set_bonus.tier31_4pc)
Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
0.00 shadow_word_pain,if=buff.deaths_torment.stack>9&set_bonus.tier31_4pc&(!variable.holding_crash|!talent.shadow_crash)
Consume T31 4pc SWPs
0.00 shadow_word_death,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
L 13.49 vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
M 35.95 mind_blast,if=(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
0.00 void_torrent,if=!variable.holding_crash,target_if=dot.devouring_plague.remains>=2.5,interrupt_if=cooldown.shadow_word_death.ready&pet.fiend.active&set_bonus.tier31_2pc
Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
N 0.00 call_action_list,name=filler
Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=(buff.power_infusion.up|fight_remains<20)&equipped.voidmenders_shadowgem
0.00 use_item,name=iridal_the_earths_master,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
0.00 use_item,name=dreambinder_loom_of_the_great_cycle,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno,if=equipped.darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime,if=equipped.darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance,if=equipped.darkmoon_deck_box_dance
0.00 use_item,name=erupting_spear_fragment,if=(buff.power_infusion.up|raid_event.adds.up|fight_remains<20)&equipped.erupting_spear_fragment
Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
0.00 use_item,name=beacon_to_the_beyond,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20)&equipped.beacon_to_the_beyond
Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
O 1.00 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex,if=equipped.desperate_invokers_codex

Sample Sequence

01247JMHHHHHHKMHHHHHHLKMHHHHHHMHHHKHHMHHHHHHLMHKHHHHMHHHHHHMKHLHHHMHHHHHKMHHHHHLMHHHHKHMHHHHHHMHLKHHHMHHHHHHMHKHHLHMHHHHHHMKHHHHHMHLHHHKMHHHHHHMHHHHKLMHHHHHHMHHKHHJMLHHHHHKMHHHHHHKMHLHHHHMHHHHKHMHHHHHLMHHKHHHMHHHGHHMHKLHGHMHHHHHGMKHHHLHDMGHHHHKMHOGHHHEHMHHHGKHMHHHH

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 4 shadowform PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 7 vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment
0:00.000 main J shadowfiend Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, static_empowerment
0:00.939 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment
0:01.876 filler H mind_spike Fluffy_Pillow 249380.1/250000: 100% mana
16.0/100: 16% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(2)
0:02.815 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(3)
0:03.753 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(4)
0:04.692 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:05.631 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:06.570 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:07.508 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:08.447 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:09.386 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:10.324 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:11.261 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:12.199 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:13.137 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:14.075 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:15.013 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 bloodlust, shadowform, static_empowerment(5)
0:15.952 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, static_empowerment(5)
0:16.891 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 bloodlust, shadowform, static_empowerment(5)
0:17.828 filler H mind_spike Fluffy_Pillow 249380.1/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, static_empowerment(5)
0:18.767 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 bloodlust, shadowform, static_empowerment(5)
0:19.706 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 bloodlust, shadowform, static_empowerment(5)
0:20.645 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 bloodlust, shadowform, static_empowerment(5)
0:21.584 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 bloodlust, shadowform, static_empowerment(5)
0:22.521 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 bloodlust, shadowform, static_empowerment(5)
0:23.459 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 bloodlust, shadowform, static_empowerment(5)
0:24.398 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
38.0/100: 38% insanity		 bloodlust, shadowform, static_empowerment(5)
0:25.337 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, static_empowerment(5)
0:26.276 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 bloodlust, shadowform, static_empowerment(5)
0:27.214 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 bloodlust, shadowform, static_empowerment(5)
0:28.153 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 bloodlust, shadowform, static_empowerment(5)
0:29.091 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, static_empowerment(5)
0:30.030 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, static_empowerment(5)
0:30.968 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
14.0/100: 14% insanity		 bloodlust, shadowform, static_empowerment(5)
0:31.907 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 bloodlust, shadowform, static_empowerment(5)
0:32.845 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 bloodlust, shadowform, static_empowerment(5)
0:33.784 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 bloodlust, shadowform, static_empowerment(5)
0:34.723 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 bloodlust, shadowform, static_empowerment(5)
0:35.662 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 bloodlust, shadowform, static_empowerment(5)
0:36.601 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 bloodlust, shadowform, static_empowerment(5)
0:37.539 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, static_empowerment(5)
0:38.478 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
48.0/100: 48% insanity		 bloodlust, shadowform, static_empowerment(5)
0:39.417 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, static_empowerment(5)
0:40.356 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
0:41.576 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
0:42.796 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
0:44.016 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:45.236 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:46.533 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:47.753 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:48.972 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:50.192 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:51.412 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:52.632 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:53.852 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:55.072 main K devouring_plague Fluffy_Pillow 249385.2/250000: 100% mana
54.0/100: 54% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:56.292 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:57.512 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:58.732 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
0:59.952 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
1:01.172 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
1:02.392 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
1:03.612 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:04.832 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
1:06.052 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
1:07.272 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:08.491 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
1:09.711 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
1:10.930 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
1:12.149 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:13.369 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
1:14.588 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
1:15.808 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
1:17.027 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
1:18.246 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
1:19.466 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:20.686 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
1:21.906 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
1:23.126 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
1:24.346 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
1:25.565 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
1:26.785 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
1:28.004 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:29.224 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
1:30.444 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
1:31.662 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
1:32.880 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
1:34.099 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
1:35.319 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
1:36.539 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
1:37.758 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:38.978 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
1:40.198 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
1:41.418 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
1:42.638 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
1:43.858 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
1:45.077 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
1:46.296 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
1:47.516 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
1:48.736 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
1:49.955 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:51.175 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
1:52.394 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
1:53.614 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:54.834 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
1:56.053 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
1:57.273 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
1:58.493 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:59.713 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
2:00.933 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
2:02.152 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
2:03.371 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
2:04.591 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
2:05.811 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
2:07.030 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
2:08.250 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
2:09.469 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
2:10.689 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
2:11.909 main K devouring_plague Fluffy_Pillow 249385.2/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
2:13.128 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
2:14.346 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
2:15.566 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
2:16.786 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
2:18.006 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
2:19.226 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
2:20.446 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
2:21.666 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
2:22.886 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
2:24.106 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
2:25.326 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
2:26.546 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
2:27.766 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
2:28.986 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
2:30.206 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
2:31.426 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
2:32.646 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
2:33.866 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
2:35.086 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
2:36.306 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:37.526 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:38.746 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:39.966 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:41.186 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:42.406 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:43.625 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:44.845 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:46.064 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
12.0/100: 12% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:47.284 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:48.504 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:49.724 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:50.944 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:52.164 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:53.382 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:54.602 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
42.0/100: 42% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:55.822 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:57.042 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:58.260 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:59.480 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:00.699 main J shadowfiend Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:01.919 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:03.139 main L vampiric_touch Fluffy_Pillow 249385.2/250000: 100% mana
18.0/100: 18% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:04.359 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:05.579 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:06.799 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:08.019 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:09.239 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:10.459 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
3:11.678 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:12.897 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
3:14.117 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
3:15.335 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
3:16.555 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
3:17.775 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
3:18.995 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
3:20.213 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
3:21.432 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
3:22.651 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:23.871 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
3:25.091 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
3:26.310 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
3:27.530 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
3:28.750 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
3:29.968 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
3:31.188 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
3:32.407 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
3:33.626 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
3:34.846 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
3:36.066 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
3:37.286 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
3:38.506 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:39.726 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
3:40.945 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
3:42.165 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
3:43.385 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:44.605 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:45.825 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:47.044 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:48.264 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
42.0/100: 42% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:49.484 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:50.703 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:51.923 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:53.143 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:54.363 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:55.582 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:56.802 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
18.0/100: 18% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:58.021 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:59.241 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:00.461 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:01.681 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:02.901 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:04.121 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:05.340 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
48.0/100: 48% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:06.560 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:07.780 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:08.999 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:10.219 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:11.681 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:12.901 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:14.121 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:15.341 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:16.560 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
4:17.780 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
4:19.000 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
4:20.220 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
4:21.681 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
4:22.900 main K devouring_plague Fluffy_Pillow 249382.7/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
4:24.120 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
4:25.339 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
4:26.559 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
4:27.779 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
4:28.999 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
4:30.218 cds D potion Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
4:30.218 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:31.437 filler G shadow_word_death Fluffy_Pillow 249382.7/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:32.657 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:33.876 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:35.094 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:36.314 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:37.533 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:38.752 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:39.970 filler H mind_spike Fluffy_Pillow 249380.1/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:41.190 trinkets O use_items Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:41.190 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:42.550 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:43.662 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:44.774 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.886 cds E blood_fury PR_Priest_Shadow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.886 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:46.998 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:48.111 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:49.224 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:50.337 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:51.450 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:52.563 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:53.676 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:54.788 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:55.899 filler H mind_spike Fluffy_Pillow 249380.1/250000: 100% mana
12.0/100: 12% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:57.011 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:58.124 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:59.237 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3848 1 13665 13015 9166
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 273300 260300 0
Mana 250000 250000 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 2560 2560 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +923 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +692 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +923 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +923 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +111 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +692 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +519 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +519 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +923 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Talents

RowPriest Talents [1]
1
2
3
4
5
6
7
8
9
10
RowShadow Talents [2]
1
2
3
4
5
6
7
8
9
10

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(!set_bonus.tier31_4pc|spell_targets.shadow_crash>1)
actions.precombat+=/vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice|set_bonus.tier31_4pc&spell_targets.shadow_crash=1

# Executed every time the actor is available.
actions=variable,name=holding_crash,op=set,value=raid_event.adds.in<15
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
actions+=/run_action_list,name=aoe,if=active_enemies>2
actions+=/run_action_list,name=main

actions.aoe=call_action_list,name=aoe_variables
# High Priority action to put out Vampiric Touch on enemies that will live at least 18 seconds, up to 12 targets manually while prepping AoE
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.dots_up),if=variable.max_vts>0&!variable.manual_vts_applied&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Crash to apply Vampiric Touch to as many adds as possible while being efficient with Vampiric Touch refresh windows
actions.aoe+=/shadow_crash,if=!variable.holding_crash,target_if=dot.vampiric_touch.refreshable|dot.vampiric_touch.remains<=target.time_to_die&!buff.voidform.up&(raid_event.adds.in-dot.vampiric_touch.remains)<15
actions.aoe+=/call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend or Mindbender on cooldown if DoTs are active and sync with Dark Ascension
actions.aoe+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.dots_up|action.shadow_crash.in_flight&talent.whispering_shadows)&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
actions.aoe+=/devouring_plague,target_if=max:target.time_to_die*(!dot.devouring_plague.ticking),if=talent.distorted_reality&(active_dot.devouring_plague=0|insanity.deficit<=20)
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff or if Inescapable Torment is talented with Mindbender active. Only use when facing 3-7 targets.
actions.aoe+=/mind_blast,target_if=max:dot.devouring_plague.remains,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&active_enemies<=7&!buff.mind_devourer.up&dot.devouring_plague.remains>execute_time
# High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
actions.aoe+=/void_bolt,target_if=max:target.time_to_die
# Use Devouring Plague on enemies that will live the longest with distorted reality.
actions.aoe+=/devouring_plague,target_if=max:target.time_to_die*(!dot.devouring_plague.ticking),if=talent.distorted_reality
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.aoe+=/devouring_plague,if=(remains<=gcd.max&!variable.pool_for_cds|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2)&!talent.distorted_reality
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.dots_up),if=variable.max_vts>0&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash)&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
# High Priority Mind Spike: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up&variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# # Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.aoe+=/mind_blast,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent action list for AoE
actions.aoe+=/void_torrent,target_if=max:dot.devouring_plague.remains,if=(!variable.holding_crash|raid_event.adds.count%(active_dot.vampiric_touch+raid_event.adds.count)<1.5)&(dot.devouring_plague.remains>=2.5|buff.voidform.up)
# High priority action for Mind Flay: Insanity to fish for Idol of C'Thun procs, cancel as soon as something else is more important and most of the channel has completed
actions.aoe+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up&talent.idol_of_cthun,interrupt_if=ticks>=2,interrupt_immediate=1
actions.aoe+=/call_action_list,name=filler

actions.aoe_variables=variable,name=max_vts,op=set,default=12,value=spell_targets.vampiric_touch>?12
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
# TODO: Revamp to fix undesired behaviour with unstacked fights
actions.aoe_variables+=/variable,name=dots_up,op=set,value=(active_dot.vampiric_touch+8*(action.shadow_crash.in_flight&talent.whispering_shadows))>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=holding_crash,op=set,value=(variable.max_vts-active_dot.vampiric_touch)<4|raid_event.adds.in<10&raid_event.adds.count>(variable.max_vts-active_dot.vampiric_touch),if=variable.holding_crash&talent.whispering_shadows
actions.aoe_variables+=/variable,name=manual_vts_applied,op=set,value=(active_dot.vampiric_touch+8*!variable.holding_crash)>=variable.max_vts|!variable.is_vt_possible

# TODO: Check VE/DA enter conditions based on dots
actions.cds=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
actions.cds+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions.cds+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions.cds+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions.cds+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
# Use Nymue's before we go into our cooldowns
actions.cds+=/use_item,name=nymues_unraveling_spindle,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<3+gcd.max|fight_remains<15)
# Use Belor'relos, the Suncaller before we go into our cooldowns
actions.cds+=/use_item,name=belorrelos_the_suncaller,use_off_gcd=1,if=gcd.remains>0&(!raid_event.adds.exists&!prev_gcd.1.mindbender|raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)|fight_remains<20
# Fit in a Divine Star as you cast Belor's for the free GCD.
actions.cds+=/divine_star,if=(raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)&equipped.belorrelos_the_suncaller&trinket.belorrelos_the_suncaller.cooldown.remains<=gcd.max
# Sync Power Infusion with Voidform or Dark Ascension
actions.cds+=/power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
# Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
# Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
actions.cds+=/call_action_list,name=trinkets
# Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.cds+=/desperate_prayer,if=health.pct<=75

# Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
actions.filler=vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
actions.filler+=/shadow_word_death,target_if=target.health.pct<20|(buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking
actions.filler+=/mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=dot.devouring_plague.remains>cast_time
actions.filler+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up
actions.filler+=/mindgames,target_if=max:dot.devouring_plague.remains
actions.filler+=/shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
# Save up to 20s if adds are coming soon.
actions.filler+=/halo,if=spell_targets>1
actions.filler+=/mind_spike,target_if=max:dot.devouring_plague.remains
actions.filler+=/mind_flay,target_if=max:dot.devouring_plague.remains,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
actions.filler+=/divine_star
# Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
actions.filler+=/shadow_crash,if=raid_event.adds.in>20&!set_bonus.tier31_4pc
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.filler+=/shadow_word_death,target_if=target.health.pct<20
# Use Shadow Word: Death while moving as a low-priority action
actions.filler+=/shadow_word_death,target_if=max:dot.devouring_plague.remains
# Use Shadow Word: Pain while moving as a low-priority action with T31 4pc
actions.filler+=/shadow_word_pain,target_if=max:dot.devouring_plague.remains,if=set_bonus.tier31_4pc
# Use Shadow Word: Pain while moving as a low-priority action without T31 4pc
actions.filler+=/shadow_word_pain,target_if=min:remains,if=!set_bonus.tier31_4pc

actions.main=variable,name=dots_up,op=set,value=active_dot.vampiric_touch=active_enemies|action.shadow_crash.in_flight&talent.whispering_shadows
actions.main+=/call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active and sync with Dark Ascension
actions.main+=/mindbender,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
actions.main+=/devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=remains<=gcd.max|insanity.deficit<=16
actions.main+=/shadow_word_death,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)&dot.devouring_plague.ticking
# High priority Mind Blast action when using Inescapable Torment
actions.main+=/mind_blast,target_if=dot.devouring_plague.remains>execute_time&(cooldown.mind_blast.full_recharge_time<=gcd.max+execute_time)|pet.fiend.remains<=execute_time+gcd.max,if=pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>execute_time&active_enemies<=7
# High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
actions.main+=/shadow_word_death,target_if=dot.devouring_plague.ticking&pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
actions.main+=/void_bolt,if=variable.dots_up
# Spend your Insanity on Devouring Plague at will if the fight will end in less than 10s
actions.main+=/devouring_plague,if=fight_remains<=duration+4
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.main+=/devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=(remains<=gcd.max|remains<3&cooldown.void_torrent.up)|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2|buff.mind_devourer.up&pmultiplier<1.2
actions.main+=/shadow_word_death,if=set_bonus.tier31_2pc
# Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
actions.main+=/shadow_crash,if=!variable.holding_crash&(dot.vampiric_touch.refreshable|buff.deaths_torment.stack>9&set_bonus.tier31_4pc)
# Consume T31 4pc SWPs
actions.main+=/shadow_word_pain,if=buff.deaths_torment.stack>9&set_bonus.tier31_4pc&(!variable.holding_crash|!talent.shadow_crash)
# Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
actions.main+=/shadow_word_death,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
# Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
actions.main+=/vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
# Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.main+=/mind_blast,if=(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
actions.main+=/void_torrent,if=!variable.holding_crash,target_if=dot.devouring_plague.remains>=2.5,interrupt_if=cooldown.shadow_word_death.ready&pet.fiend.active&set_bonus.tier31_2pc
# Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.main+=/call_action_list,name=filler

actions.trinkets=use_item,name=voidmenders_shadowgem,if=(buff.power_infusion.up|fight_remains<20)&equipped.voidmenders_shadowgem
actions.trinkets+=/use_item,name=iridal_the_earths_master,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
actions.trinkets+=/use_item,name=dreambinder_loom_of_the_great_cycle,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno,if=equipped.darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime,if=equipped.darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance,if=equipped.darkmoon_deck_box_dance
# Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
actions.trinkets+=/use_item,name=erupting_spear_fragment,if=(buff.power_infusion.up|raid_event.adds.up|fight_remains<20)&equipped.erupting_spear_fragment
# Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
actions.trinkets+=/use_item,name=beacon_to_the_beyond,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20)&equipped.beacon_to_the_beyond
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
actions.trinkets+=/use_item,name=desperate_invokers_codex,if=equipped.desperate_invokers_codex

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=9166
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 49821 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
49820.7 49820.7 51.9 / 0.104% 9092.3 / 18.3% 68.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
677.8 676.2 Mana 0.90% 52.1 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQJJSIAAAAAAAAAAAAgSESCJkioQSDAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 49821
Doom Winds 101 0.2% 3.7 90.41s 8050 7268 Direct 3.7 6661 13379 8049 20.7% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.1078 0.0000 30060.69 42944.94 30.00% 7268.06 7268.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.33% 2.96 0 4 6660.67 3767 12981 6652.72 0 9816 19732 28189 29.89%
crit 20.67% 0.77 0 4 13379.48 7534 24478 7710.41 0 24478 10329 14755 17.28%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.73
  • if_expr:raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Flame Shock 1531 3.1% 29.6 10.03s 15540 41036 Direct 29.6 2747 5493 3314 20.6% 0.0%
Periodic 184.2 1626 3253 1961 20.6% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.55 29.55 184.25 184.25 27.96 0.3787 1.5776 459269.69 459269.69 0.00% 1521.45 41035.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.36% 23.45 11 39 2747.12 2332 4450 2746.79 2477 3131 64434 64434 0.00%
crit 20.64% 6.10 0 16 5493.30 4664 8830 5480.96 0 7601 33509 33509 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.41% 146.31 102 191 1626.03 1 2603 1625.70 1499 1816 237902 237902 0.00%
crit 20.59% 37.94 17 66 3253.20 2 5205 3252.45 2922 3770 123425 123425 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Volcanic damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Volcanic damage and then an additional {$=}o2 Volcanic damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Volcanic damage and knocking them into the air.]

Action Priority List

    single
    [O]:1.60
  • if_expr:!ticking
    single
    [W]:7.93

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Spell Periodic AmountFire and Ice3828862PCT0.030
Flametongue Weapon 0 (1370) 0.0% (2.7%) 1.0 0.00s 410464 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFire and Ice3828861PCT0.030
    Flametongue Attack 1370 2.7% 992.3 0.68s 414 0 Direct 992.3 343 686 414 20.7% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 992.34 992.34 0.00 0.00 0.00 0.0000 0.0000 410464.34 410464.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.33% 787.19 522 1033 342.66 285 555 342.74 316 382 269741 269741 0.00%
crit 20.67% 205.15 122 290 685.93 569 1100 686.13 625 782 140723 140723 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Forgestorm Ignited (_damage) 1231 2.5% 28.3 7.71s 13034 0 Direct 28.3 10808 21616 13034 20.6% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.34 28.34 0.00 0.00 0.00 0.0000 0.0000 369361.07 369361.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.40% 22.50 3 72 10807.51 10705 11241 10799.13 10705 11147 243194 243194 0.00%
crit 20.60% 5.84 0 21 21615.90 21411 22481 21370.07 0 22481 126167 126167 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 971 2.0% 14.3 19.36s 20426 17076 Direct 14.3 16912 33889 20426 20.7% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.27 14.27 0.00 0.00 0.00 1.1962 0.0000 291485.59 291485.59 0.00% 17075.90 17075.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.30% 11.32 2 23 16912.31 7534 29684 16962.31 11740 21243 191400 191400 0.00%
crit 20.70% 2.95 0 10 33888.89 15068 59369 32394.79 0 56646 100085 100085 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [U]:14.27

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownEnhancement Shaman1370417ADD6000.000
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Ice Strike 1875 3.8% 21.5 13.79s 26102 22013 Direct 21.5 21687 43379 26101 20.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.54 21.54 0.00 0.00 0.00 1.1858 0.0000 562270.12 562270.12 0.00% 22012.69 22012.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 17.16 8 25 21687.17 17716 34905 21685.30 18961 25048 372094 372094 0.00%
crit 20.35% 4.38 0 13 43378.87 35433 69810 42932.49 0 62852 190176 190176 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [P]:20.50
  • if_expr:!buff.ice_strike.up
    single
    [R]:1.04

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Lava Lash 1761 3.5% 20.0 14.71s 26366 22172 Direct 20.0 21870 43765 26366 20.5% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.03 20.03 0.00 0.00 0.00 1.1892 0.0000 528215.50 528215.50 0.00% 22171.57 22171.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.46% 15.92 6 25 21869.73 18658 35108 21863.33 19659 25252 348157 348157 0.00%
crit 20.54% 4.11 0 12 43764.97 37316 70019 43228.41 0 64740 180058 180058 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [Q]:20.03

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownMolten Assault3340331ADD-3000.000
Spell Direct AmountFire and Ice3828861PCT0.030
Lightning Bolt 13792 27.7% 68.2 4.37s 60648 51280 Direct 68.2 50240 100631 60647 20.7% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.20 68.20 0.00 0.00 0.00 1.1827 0.0000 4135900.59 4135900.59 0.00% 51279.55 51279.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 54.11 32 81 50239.55 34014 100963 50249.85 44116 58394 2718477 2718477 0.00%
crit 20.65% 14.09 3 33 100630.94 68027 201926 100634.31 78609 130054 1417424 1417424 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.09

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [N]:68.19
  • if_expr:((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
Spell Direct AmountThorim's Invocation3844442PCT0.200
main_hand 1790 3.6% 193.5 1.81s 2774 1556 Direct 193.5 2660 5322 2774 20.6% 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.45 193.45 0.00 0.00 0.00 1.7822 0.0000 536622.50 766623.11 30.00% 1556.44 1556.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.06% 121.99 77 168 2660.46 2257 4294 2660.38 2445 2972 324561 463670 30.00%
crit 20.60% 39.84 18 69 5322.16 4513 8587 5322.42 4690 6087 212062 302953 30.00%
miss 16.34% 31.61 13 58 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 897 1.8% 193.6 1.80s 1389 779 Direct 193.6 1332 2664 1389 20.7% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.56 193.56 0.00 0.00 0.00 1.7837 0.0000 268944.44 384216.14 30.00% 779.00 779.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.00% 121.94 79 168 1332.07 1128 2151 1332.11 1227 1506 162437 232059 30.00%
crit 20.65% 39.97 18 68 2664.38 2257 4236 2664.54 2341 3024 106507 152157 30.00%
miss 16.35% 31.64 10 57 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (9725) 0.0% (19.5%) 90.8 3.29s 32106 27364

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.77 0.00 0.00 0.00 0.00 1.1733 0.0000 0.00 0.00 0.00% 27364.31 27364.31

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:57.28
  • if_expr:buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
    single
    [S]:33.49

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
    Stormstrike (_mh) 5271 (6486) 10.6% (13.0%) 120.9 2.46s 16070 0 Direct 120.9 (173.5) 10817 21673 13062 20.7% (14.4%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.93 120.93 0.00 0.00 0.00 0.0000 0.0000 1579663.41 2256719.55 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.32% 95.92 50 147 10817.06 3255 28040 10837.33 9160 12910 1037578 1482293 30.00%
crit 20.68% 25.01 8 46 21673.26 6510 52970 21716.99 15602 30089 542085 774427 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
        Stormblast (_stormstrike_mh) 1214 2.4% 52.6 5.63s 6921 0 Direct 52.6 6921 0 6921 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.56 52.56 0.00 0.00 0.00 0.0000 0.0000 363745.30 363745.30 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 52.56 18 89 6920.92 3572 24419 6923.15 5425 8981 363745 363745 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2634 (3240) 5.3% (6.5%) 120.9 2.46s 8028 0 Direct 120.9 (173.5) 5410 10822 6526 20.6% (14.4%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.93 120.93 0.00 0.00 0.00 0.0000 0.0000 789215.33 1127479.21 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.38% 96.00 46 145 5410.40 1627 14020 5420.31 4547 6332 519406 742027 30.00%
crit 20.62% 24.93 8 50 10822.29 3255 26752 10842.39 7692 14561 269810 385452 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
        Stormblast (_stormstrike_offhand) 606 1.2% 52.6 5.63s 3455 0 Direct 52.6 3455 0 3455 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.56 52.56 0.00 0.00 0.00 0.0000 0.0000 181565.12 181565.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 52.56 18 89 3454.57 1786 12263 3455.96 2747 4613 181565 181565 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 977 2.0% 6.0 50.43s 48645 40915 Direct 6.0 40256 80555 48645 20.8% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.03 6.03 0.00 0.00 0.00 1.1890 0.0000 293113.12 293113.12 0.00% 40914.73 40914.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.19% 4.77 0 8 40256.49 26247 83200 40251.06 0 55731 192087 192087 0.00%
crit 20.81% 1.25 0 6 80555.20 52493 166771 60613.59 0 166771 101026 101026 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [T]:6.03
  • if_expr:raid_event.adds.in>=action.sundering.cooldown

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Tempest Strikes 3779 7.6% 162.5 1.84s 6973 0 Direct 162.5 5779 11570 6972 20.6% 0.0%

Stats Details: Tempest Strikes

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 162.49 162.49 0.00 0.00 0.00 0.0000 0.0000 1132953.09 1132953.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.39% 129.00 75 184 5778.88 4847 9378 5779.37 5305 6490 745469 745469 0.00%
crit 20.61% 33.49 11 63 11570.19 9694 18576 11570.66 10189 13662 387484 387484 0.00%

Action Details: Tempest Strikes

  • id:428078
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:428078
  • name:Tempest Strikes
  • school:nature
  • tooltip:
  • description:{$@spelldesc428071=Stormstrike, Ice Strike, and Lava Lash have a {$h=100}% chance to discharge electricity at your target, dealing {$428078s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Windfury Weapon 0 (6902) 0.0% (13.8%) 1.0 0.00s 2065827 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6902 13.8% 375.4 2.49s 5503 0 Direct 375.4 4555 9144 5503 20.7% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 375.39 375.39 0.00 0.00 0.00 0.0000 0.0000 2065827.34 2951257.16 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.34% 297.85 166 430 4555.31 1878 11454 4556.24 3973 5421 1356803 1938340 30.00%
crit 20.66% 77.54 31 129 9144.13 3756 22908 9144.80 7698 11306 709024 1012917 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
pet - greater_earth_elemental 430 / 89
melee 430 0.2% 38.9 2.21s 681 437 Direct 38.9 564 1129 681 20.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.88 38.88 0.00 0.00 0.00 1.5592 0.0000 26467.04 37811.02 30.00% 436.55 436.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.42% 30.88 19 57 564.49 488 915 563.68 488 717 17433 24905 30.00%
crit 20.58% 8.00 1 20 1128.93 976 1830 1127.12 976 1501 9034 12906 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4089 / 3029
melee 4089 6.1% 383.4 1.56s 2367 2039 Direct 383.4 1961 3926 2367 20.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 383.36 383.36 0.00 0.00 0.00 1.1607 0.0000 907424.05 1296353.13 30.00% 2039.33 2039.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 304.21 204 417 1961.29 1630 3160 1961.54 1818 2194 596646 852373 30.00%
crit 20.65% 79.15 44 125 3926.41 3260 6320 3926.98 3560 4535 310778 443980 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.1 307.91s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.11 0.00 0.00 0.00 0.00 1.0410 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [V]:1.11
Feral Spirit 15.5 20.41s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.51 0.00 0.00 0.00 0.00 1.1691 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:15.51

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 302.01s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 3.1 114.09s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.09 0.00 0.00 0.00 0.00 0.5583 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Action Priority List

    single
    [M]:1.49
  • if_expr:!buff.windfury_totem.up
    single
    [X]:0.60
  • if_expr:buff.windfury_totem.remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.3s 58.7s 50.5s 80.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 335.0s
  • trigger_min/max:15.0s / 311.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 350.2s
  • uptime_min/max:52.10% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.28%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Crumbling Power 2.0 0.0 180.4s 5.4s 18.4s 12.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.3s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s
  • uptime_min/max:10.25% / 15.37%

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.36%
  • crumbling_power_3:0.73%
  • crumbling_power_4:0.74%
  • crumbling_power_5:0.75%
  • crumbling_power_6:0.71%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.67%
  • crumbling_power_19:0.70%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4s 90.4s 7.9s 9.88% 12.57% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.6s
  • trigger_min/max:90.0s / 92.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:8.72% / 11.47%

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 15.5 0.0 22.2s 19.9s 16.9s 74.07% 100.00% 0.0 (0.0) 12.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.2s / 82.8s
  • trigger_min/max:5.2s / 38.0s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 76.7s
  • uptime_min/max:62.05% / 86.25%

Stack Uptimes

  • earthen_weapon_2:72.36%
  • earthen_weapon_4:1.71%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 301.2s 302.0s 27.5s 13.45% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 318.8s
  • trigger_min/max:300.0s / 318.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.97% / 18.18%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.45%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 13.2 2.4 23.7s 20.4s 16.9s 74.07% 0.00% 62.3 (62.3) 12.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 82.8s
  • trigger_min/max:5.5s / 38.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 76.7s
  • uptime_min/max:62.05% / 86.26%

Stack Uptimes

  • feral_spirit_1:74.07%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 36.8 446.7 8.2s 0.6s 7.2s 88.15% 92.41% 446.7 (1083.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 83.0s
  • trigger_min/max:0.0s / 14.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 82.2s
  • uptime_min/max:77.94% / 96.73%

Stack Uptimes

  • flurry_1:18.94%
  • flurry_2:36.14%
  • flurry_3:33.07%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 108.0 18.0s 2.4s 14.6s 83.72% 100.00% 48.0 (48.0) 16.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 51.1s
  • trigger_min/max:0.0s / 45.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:69.04% / 93.60%

Stack Uptimes

  • forceful_winds_1:16.14%
  • forceful_winds_2:14.97%
  • forceful_winds_3:13.09%
  • forceful_winds_4:10.63%
  • forceful_winds_5:28.89%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=20}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.3s 46.4s 12.9s 19.47% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 209.3s
  • trigger_min/max:0.2s / 209.3s
  • trigger_pct:98.80%
  • duration_min/max:0.0s / 57.5s
  • uptime_min/max:3.84% / 53.26%

Stack Uptimes

  • forgestorm_ignited_1:19.47%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.5 1.0 14.5s 13.8s 8.9s 60.95% 87.63% 1.0 (1.0) 7.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.7s / 61.5s
  • trigger_min/max:8.7s / 43.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.0s
  • uptime_min/max:41.06% / 83.70%

Stack Uptimes

  • ice_strike_1:60.95%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 25.0 23.7 12.0s 6.1s 8.1s 67.91% 100.00% 23.7 (23.7) 24.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 61.4s
  • trigger_min/max:0.9s / 32.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.0s
  • uptime_min/max:55.66% / 79.50%

Stack Uptimes

  • legacy_of_the_frost_witch_1:67.91%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your Physical and Frost abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 69.0 400.8 4.4s 0.6s 3.6s 83.94% 100.00% 58.5 (58.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 24.7s
  • trigger_min/max:0.0s / 7.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.5s
  • uptime_min/max:76.70% / 88.94%

Stack Uptimes

  • maelstrom_weapon_1:9.85%
  • maelstrom_weapon_2:10.49%
  • maelstrom_weapon_3:11.46%
  • maelstrom_weapon_4:12.00%
  • maelstrom_weapon_5:9.97%
  • maelstrom_weapon_6:7.30%
  • maelstrom_weapon_7:5.12%
  • maelstrom_weapon_8:3.74%
  • maelstrom_weapon_9:2.85%
  • maelstrom_weapon_10:11.16%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.2s 45.7s 16.5s 23.63% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 219.9s
  • trigger_min/max:0.0s / 219.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.9s
  • uptime_min/max:5.10% / 60.03%

Stack Uptimes

  • sophic_devotion_1:23.63%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.0s 45.6s 32.2s 38.27% 0.00% 25.7 (25.7) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 260.8s
  • trigger_min/max:0.0s / 205.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 193.2s
  • uptime_min/max:7.61% / 84.78%

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.28%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.82%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Stormbringer 52.7 15.0 5.6s 4.4s 1.1s 19.49% 57.69% 15.0 (15.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 81.0s
  • trigger_min/max:0.0s / 81.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s
  • uptime_min/max:8.92% / 33.56%

Stack Uptimes

  • stormbringer_1:19.49%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.5 36.0 66.0 18.0s 15.0s 51.1s
Windfury-ForcefulWinds: 2 50.5 33.0 66.0 18.2s 0.3s 63.9s
Windfury-ForcefulWinds: 3 48.3 27.0 66.0 19.0s 0.4s 74.2s
Windfury-ForcefulWinds: 4 43.9 18.0 63.0 20.9s 1.2s 92.1s
Windfury-ForcefulWinds: 5 181.3 81.0 297.0 5.0s 0.0s 91.7s
Windfury (Main Hand) 26.8 8.0 47.0 10.9s 1.3s 143.3s
Windfury (Off Hand) 26.8 10.0 48.0 10.9s 1.3s 123.6s
Windfury: Unruly Winds 125.1 72.0 175.0 2.5s 0.0s 45.6s
Stormflurry 30.2 6.0 67.0 9.5s 0.0s 153.4s
Flametongue: Windfury Attack 375.4 216.0 525.0 2.5s 0.0s 45.6s
Stormbringer: Windfury Attack 38.2 10.0 72.0 8.7s 0.0s 130.8s
Flametongue: main_hand 161.8 115.0 211.0 2.2s 1.3s 19.0s
Windfury: main_hand 61.1 32.0 92.0 5.3s 1.3s 64.7s
Flametongue: offhand 161.9 110.0 214.0 2.2s 1.3s 16.2s
Flametongue: Doom Winds 3.7 3.0 4.0 90.4s 90.0s 92.6s
Windfury: Doom Winds 3.7 3.0 4.0 90.4s 90.0s 92.6s
Flametongue: Lava Lash 20.0 14.0 27.0 14.7s 8.8s 54.5s
Stormbringer: Lava Lash 2.1 0.0 8.0 76.5s 8.8s 340.7s
Flametongue: Sundering 6.0 3.0 8.0 50.5s 40.0s 170.6s
Stormbringer: Sundering 0.6 0.0 5.0 112.4s 40.0s 331.7s
Windfury: Sundering 1.9 0.0 7.0 94.1s 40.0s 335.1s
Flametongue: Ice Strike 21.5 15.0 28.0 13.8s 8.7s 43.3s
Stormbringer: Ice Strike 2.2 0.0 9.0 75.4s 8.7s 325.5s
Windfury: Ice Strike 7.2 0.0 17.0 38.4s 8.7s 297.8s
Flametongue: Stormstrike 120.9 62.0 174.0 2.5s 0.0s 19.8s
Stormbringer: Stormstrike 12.3 2.0 35.0 22.4s 0.0s 271.0s
Windfury: Stormstrike 51.3 20.0 88.0 5.8s 0.0s 87.1s
Flametongue: Stormstrike Off-Hand 120.9 62.0 174.0 2.5s 0.0s 19.8s
Stormbringer: Stormstrike Off-Hand 12.3 1.0 30.0 22.3s 0.1s 245.2s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 36.15% 23.22% 45.30% 0.6s 0.0s 5.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike
Stormstrike		1.3230.0008.249120.61270.025174.127
Feral Spirit0.7880.0001.48612.2413.22820.466
Doom Winds0.5350.0002.6031.9980.8645.730
Lava Lash3.2620.00042.11666.09523.729119.993
Sundering12.0080.000130.56174.81919.470170.938
Ice Strike2.2530.00030.95748.95715.08189.911
Frost Shock15.3840.000165.213232.317151.611325.454
Flame Shock24.4130.000237.541255.557176.615339.255
Earth Elemental32.5390.000224.88237.60010.389293.496

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack73.716.514.86%28.11%
main_hand34.84.17.01%7.06%
offhand34.64.46.98%7.44%
Feral Spirit76.39.315.38%15.80%
Doom Winds0.80.10.17%0.10%
Lightning Bolt98.20.019.80%0.00%
Lava Lash24.80.05.01%0.00%
Sundering1.50.00.30%0.00%
Ice Strike26.70.05.39%0.00%
Stormstrike75.914.915.31%25.39%
Stormstrike (_mh)24.44.64.93%7.82%
Stormstrike Off-Hand24.24.94.88%8.29%
Overflow Stacks0.058.50.00%10.56%
Actual Stacks495.80.089.44%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt491.7100.00%
Total Spent491.7100.00%
Casts per Maelstrom Weapon Stack Consumed
Ability 0 1 2 3 4 5 6 7 8 9 10
Lightning Bolt          18.45 13.38 9.12 6.26 4.54 16.44
Total           18.45
(27.06%)		 13.38
(19.62%)		 9.12
(13.38%)		 6.26
(9.18%)		 4.54
(6.66%)		 16.44
(24.10%)

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
Mana RegenMana652.43202870.81100.00%310.94564159.7973.55%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 270980.0 0.00 868.21 0.0 10516.9 -393152.2 270980.0
Mana 250000.0 676.23 677.80 564161.0 249528.9 247000.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.001000.000.49%1000.001000.000.00
Flame ShockMana 9.527140.853.51%750.00241.6264.32
Frost ShockMana 14.277135.183.51%500.00500.0040.85
Ice StrikeMana 21.5435543.0817.48%1650.001650.0115.82
Lava LashMana 20.038013.443.94%400.00400.0065.92
Lightning BoltMana 68.1934096.9916.77%500.00499.99121.30
StormstrikeMana 90.7790769.1044.64%1000.001000.0132.11
SunderingMana 6.0318077.198.89%3000.003000.0616.21
Windfury TotemMana 3.091566.090.77%507.13507.130.00

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 49820.72
Minimum 40985.18
Maximum 59273.61
Spread ( max - min ) 18288.43
Range [ ( max - min ) / 2 * 100% ] 18.35%
Standard Deviation 2291.0703
5th Percentile 46196.52
95th Percentile 53728.19
( 95th Percentile - 5th Percentile ) 7531.67
Mean Distribution
Standard Deviation 26.4568
95.00% Confidence Interval ( 49768.86 - 49872.57 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 82
0.1% Error 8124
0.1 Scale Factor Error with Delta=300 44809
0.05 Scale Factor Error with Delta=300 179235
0.01 Scale Factor Error with Delta=300 4480851
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 49820.72
Minimum 40985.18
Maximum 59273.61
Spread ( max - min ) 18288.43
Range [ ( max - min ) / 2 * 100% ] 18.35%
Standard Deviation 2291.0703
5th Percentile 46196.52
95th Percentile 53728.19
( 95th Percentile - 5th Percentile ) 7531.67
Mean Distribution
Standard Deviation 26.4568
95.00% Confidence Interval ( 49768.86 - 49872.57 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 82
0.1% Error 8124
0.1 Scale Factor Error with Delta=300 44809
0.05 Scale Factor Error with Delta=300 179235
0.01 Scale Factor Error with Delta=300 4480851
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 49820.72
Minimum 40985.18
Maximum 59273.61
Spread ( max - min ) 18288.43
Range [ ( max - min ) / 2 * 100% ] 18.35%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 13998677.23
Minimum 9929577.64
Maximum 18646071.14
Spread ( max - min ) 8716493.50
Range [ ( max - min ) / 2 * 100% ] 31.13%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 868.32
Minimum 0.00
Maximum 2120.83
Spread ( max - min ) 2120.83
Range [ ( max - min ) / 2 * 100% ] 122.12%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
0.00 primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
G 15.51 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
H 3.73 doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
J 0.00 call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
K 0.00 call_action_list,name=funnel,if=active_enemies>1&rotation.funnel
actions.single
# count action,conditions
0.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
L 57.28 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
0.00 lava_lash,if=buff.hot_hand.up
M 1.49 windfury_totem,if=!buff.windfury_totem.up
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
N 68.19 lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
0.00 primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
O 1.60 flame_shock,if=!ticking
0.00 ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
0.00 lava_lash,if=talent.lashing_flames.enabled
P 20.50 ice_strike,if=!buff.ice_strike.up
0.00 frost_shock,if=buff.hailstorm.up
Q 20.03 lava_lash
R 1.04 ice_strike
0.00 windstrike
S 33.49 stormstrike
T 6.03 sundering,if=raid_event.adds.in>=action.sundering.cooldown
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
0.00 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
U 14.27 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
V 1.11 earth_elemental
W 7.93 flame_shock
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
X 0.60 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGHLLNLLNOPLLNQLLNLGNRSTLLLNQLUPNNSULGLNQLLLNNPNGNQSNUVWPNSLNQLLLNPSTGUQNNNSPUWNLNQGNLHNLPNLNNQSGLLNPSLLLNLQTMNPLUGNNQNSNNNPSLGNLQUNSLNNPSLLNQSTGNPSNNNNQSNSGLEFNHPULLLLLNNQGPNNSUWTQLLNPSNUWXQSGNPSNNSUQNSUPNWSUNQSGNNPLLNSQTNSUPWSNQUWGHLLNLPLLLNQSUWPNSGLNQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 250000.0/250000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 2 augmentation PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 3 windfury_weapon PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 4 flametongue_weapon PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 6 windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
0:00.000 default B bloodlust Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), corrupting_rage
0:00.000 default C potion Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage
0:00.000 default D auto_attack Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default F berserking PR_Shaman_Enhancement 249000.0/250000: 100% mana bloodlust, flurry(3), forceful_winds, maelstrom_weapon(2), crumbling_power(20), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, berserking, flurry(3), forceful_winds, maelstrom_weapon(2), crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:00.865 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:01.731 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), doom_winds, crumbling_power(18), corrupting_rage, elemental_potion_of_ultimate_power
0:02.597 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds, crumbling_power(17), corrupting_rage, elemental_potion_of_ultimate_power
0:03.462 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(16), corrupting_rage, elemental_potion_of_ultimate_power
0:04.328 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, crumbling_power(15), corrupting_rage, elemental_potion_of_ultimate_power
0:05.194 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), doom_winds, legacy_of_the_frost_witch, crumbling_power(14), corrupting_rage, elemental_potion_of_ultimate_power
0:06.060 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), doom_winds, legacy_of_the_frost_witch, crumbling_power(13), spiraling_winds, corrupting_rage, elemental_potion_of_ultimate_power
0:06.926 single O flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), doom_winds, legacy_of_the_frost_witch, crumbling_power(12), spiraling_winds, corrupting_rage, elemental_potion_of_ultimate_power
0:07.792 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds, corrupting_rage, elemental_potion_of_ultimate_power
0:08.658 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), doom_winds, ice_strike, crumbling_power(10), spiraling_winds(2), corrupting_rage, elemental_potion_of_ultimate_power
0:09.523 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, crumbling_power(9), spiraling_winds(2), corrupting_rage, elemental_potion_of_ultimate_power
0:10.389 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, crumbling_power(8), spiraling_winds(3), corrupting_rage, elemental_potion_of_ultimate_power
0:11.255 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(3), corrupting_rage, elemental_potion_of_ultimate_power
0:12.121 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(4), corrupting_rage, elemental_potion_of_ultimate_power
0:13.074 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(4), corrupting_rage, elemental_potion_of_ultimate_power
0:14.027 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(5), corrupting_rage, elemental_potion_of_ultimate_power
0:14.980 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch, crumbling_power(3), spiraling_winds(5), corrupting_rage, elemental_potion_of_ultimate_power
0:15.933 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), maelstrom_weapon(4), ice_strike, crumbling_power(2), spiraling_winds(6), corrupting_rage, elemental_potion_of_ultimate_power
0:16.952 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, crumbling_power, spiraling_winds(6), corrupting_rage, elemental_potion_of_ultimate_power
0:17.905 single R ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), corrupting_rage, elemental_potion_of_ultimate_power
0:18.858 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), corrupting_rage, elemental_potion_of_ultimate_power
0:19.811 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), corrupting_rage, elemental_potion_of_ultimate_power
0:20.764 single L stormstrike Fluffy_Pillow 249439.7/250000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), corrupting_rage, elemental_potion_of_ultimate_power
0:21.717 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), corrupting_rage, elemental_potion_of_ultimate_power
0:22.670 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(9), corrupting_rage, elemental_potion_of_ultimate_power
0:23.622 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(9), corrupting_rage, elemental_potion_of_ultimate_power
0:24.575 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage, elemental_potion_of_ultimate_power
0:25.527 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_potion_of_ultimate_power
0:26.480 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_potion_of_ultimate_power
0:27.432 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_potion_of_ultimate_power
0:28.384 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_potion_of_ultimate_power
0:29.337 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_potion_of_ultimate_power
0:30.289 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
0:31.242 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
0:32.195 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), forceful_winds(4), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited
0:33.148 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch, forgestorm_ignited
0:34.101 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited
0:35.054 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), forgestorm_ignited
0:36.007 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited
0:36.960 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited
0:37.913 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch, forgestorm_ignited
0:38.865 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited
0:39.817 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited
0:40.770 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
0:42.008 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
0:43.246 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:44.484 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:45.721 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(4), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:46.959 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(4), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:48.386 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:49.623 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:50.861 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, corrupting_rage
0:52.098 single V earth_elemental Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), corrupting_rage
0:53.335 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), corrupting_rage
0:54.573 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), corrupting_rage
0:55.810 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, corrupting_rage
0:57.048 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:58.286 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:59.524 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
1:00.761 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
1:01.999 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), corrupting_rage
1:03.237 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), corrupting_rage
1:04.475 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), corrupting_rage
1:05.712 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(10), ice_strike, spiraling_winds(5), corrupting_rage
1:06.950 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(5), legacy_of_the_frost_witch, spiraling_winds(6), corrupting_rage
1:08.188 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), corrupting_rage
1:09.426 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, corrupting_rage
1:10.663 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, corrupting_rage
1:11.900 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, spiraling_winds(8), forgestorm_ignited, corrupting_rage
1:13.136 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(9), forgestorm_ignited, corrupting_rage
1:14.374 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(7), spiraling_winds(9), forgestorm_ignited, corrupting_rage
1:15.612 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:16.850 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:18.087 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:19.325 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:20.563 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
1:21.801 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
1:23.037 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), corrupting_rage
1:24.275 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:25.512 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:26.750 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
1:27.988 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited
1:29.226 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(10), forgestorm_ignited
1:30.464 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited
1:31.702 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited
1:32.940 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited
1:34.178 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited
1:35.416 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), doom_winds, legacy_of_the_frost_witch, forgestorm_ignited
1:36.654 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), doom_winds, ice_strike, legacy_of_the_frost_witch
1:37.892 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), doom_winds, ice_strike, legacy_of_the_frost_witch
1:39.130 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), doom_winds, ice_strike, legacy_of_the_frost_witch
1:40.367 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch
1:41.604 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch
1:42.842 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:44.079 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:45.317 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:46.555 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, forgestorm_ignited, corrupting_rage
1:47.793 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), forgestorm_ignited, corrupting_rage
1:49.031 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:50.269 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:51.507 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:52.745 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:53.983 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, forgestorm_ignited, corrupting_rage
1:55.221 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, corrupting_rage
1:56.458 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:57.696 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:58.934 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:00.171 single M windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:00.996 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(5), ice_strike, corrupting_rage
2:02.234 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
2:03.472 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), corrupting_rage
2:04.710 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), corrupting_rage
2:05.948 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(3), corrupting_rage
2:07.317 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(4), corrupting_rage
2:08.555 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(4), corrupting_rage
2:09.793 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(5), corrupting_rage
2:11.274 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(6), corrupting_rage
2:12.510 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(6), corrupting_rage
2:13.748 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(7), corrupting_rage
2:14.986 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(7), corrupting_rage
2:16.223 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, spiraling_winds(8), corrupting_rage
2:17.460 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(9), corrupting_rage
2:18.698 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), corrupting_rage
2:19.936 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:21.174 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(4), maelstrom_weapon(7), ice_strike, spiraling_winds(10), corrupting_rage
2:22.411 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), ice_strike, spiraling_winds(10), corrupting_rage
2:23.649 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:24.887 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:26.124 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:27.362 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:28.599 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:29.837 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:31.075 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:32.313 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:33.551 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:34.788 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:36.026 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:37.264 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:38.501 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(10), ice_strike, sophic_devotion, corrupting_rage
2:39.738 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:40.976 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:42.214 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:43.451 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:44.688 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, sophic_devotion, corrupting_rage
2:45.925 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), sophic_devotion, corrupting_rage
2:47.163 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, sophic_devotion, corrupting_rage
2:48.400 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, sophic_devotion, corrupting_rage
2:49.637 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:50.875 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:52.113 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:53.351 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:54.589 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:55.827 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:57.064 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:58.302 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, corrupting_rage
2:59.540 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, corrupting_rage
3:00.778 default E use_item_irideus_fragment Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, corrupting_rage
3:00.778 default F berserking PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, crumbling_power(20), corrupting_rage
3:00.778 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, crumbling_power(19), corrupting_rage
3:01.903 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), corrupting_rage
3:03.028 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), doom_winds, crumbling_power(18), corrupting_rage
3:04.153 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), doom_winds, ice_strike, crumbling_power(17), corrupting_rage
3:05.277 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), doom_winds, crumbling_power(16), corrupting_rage
3:06.402 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds, crumbling_power(15), corrupting_rage
3:07.526 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(14), corrupting_rage
3:08.651 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(13), corrupting_rage
3:09.776 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(12), corrupting_rage
3:10.901 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), crumbling_power(11), corrupting_rage
3:12.026 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(10), corrupting_rage
3:13.151 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(9), corrupting_rage
3:14.389 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(8), sophic_devotion, corrupting_rage
3:15.627 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, crumbling_power(7), sophic_devotion, corrupting_rage
3:16.865 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), sophic_devotion, corrupting_rage
3:18.103 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), sophic_devotion, corrupting_rage
3:19.341 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), sophic_devotion, corrupting_rage
3:20.579 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), sophic_devotion, corrupting_rage
3:21.817 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
3:23.055 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
3:24.292 Waiting     1.028s 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, corrupting_rage
3:25.320 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, corrupting_rage
3:26.729 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), sophic_devotion, corrupting_rage
3:27.967 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(9), sophic_devotion, corrupting_rage
3:29.205 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), corrupting_rage
3:30.443 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
3:31.681 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(3), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion, corrupting_rage
3:32.919 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion, forgestorm_ignited, corrupting_rage
3:34.155 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(4), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, forgestorm_ignited, corrupting_rage
3:35.393 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon(2), spiraling_winds(3), sophic_devotion, forgestorm_ignited, corrupting_rage
3:36.631 single X windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(3), spiraling_winds(3), sophic_devotion, forgestorm_ignited, corrupting_rage
3:37.456 Waiting     0.176s 250000.0/250000: 100% mana flurry, maelstrom_weapon(3), spiraling_winds(4), sophic_devotion, forgestorm_ignited, corrupting_rage
3:37.632 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon(3), spiraling_winds(4), sophic_devotion, forgestorm_ignited, corrupting_rage
3:39.069 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(4), spiraling_winds(4), sophic_devotion, forgestorm_ignited, corrupting_rage
3:40.307 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon(6), spiraling_winds(5), sophic_devotion, forgestorm_ignited, corrupting_rage
3:41.627 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(8), spiraling_winds(6), sophic_devotion, forgestorm_ignited, corrupting_rage
3:42.864 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, forgestorm_ignited, corrupting_rage
3:44.102 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage
3:45.340 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, forgestorm_ignited, corrupting_rage
3:46.577 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, corrupting_rage
3:47.813 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, corrupting_rage
3:49.051 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, corrupting_rage
3:50.289 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:51.527 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:52.765 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:54.002 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:55.240 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:56.478 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:57.716 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, ice_strike, corrupting_rage
3:58.954 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, ice_strike, corrupting_rage
4:00.192 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(2), ice_strike, corrupting_rage
4:01.430 Waiting     0.842s 250000.0/250000: 100% mana flurry, forceful_winds, maelstrom_weapon(3), corrupting_rage
4:02.272 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(5), corrupting_rage
4:03.509 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, legacy_of_the_frost_witch, corrupting_rage
4:04.746 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(2), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
4:05.983 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(5), legacy_of_the_frost_witch, corrupting_rage
4:07.221 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, corrupting_rage
4:08.457 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, corrupting_rage
4:09.693 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
4:10.931 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:12.169 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:13.406 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion
4:14.644 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion
4:15.881 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion
4:17.119 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion
4:18.356 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion
4:19.593 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion
4:20.831 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion
4:22.068 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion
4:23.306 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion
4:24.543 Waiting     1.002s 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(4), ice_strike, spiraling_winds(4), sophic_devotion
4:25.545 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(4), ice_strike, spiraling_winds(5)
4:27.001 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(6), ice_strike, spiraling_winds(5)
4:28.239 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana ice_strike, spiraling_winds(6), corrupting_rage
4:29.477 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(3), ice_strike, spiraling_winds(7), corrupting_rage
4:30.715 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(3), spiraling_winds(7), corrupting_rage
4:31.953 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(4), spiraling_winds(8), sophic_devotion, corrupting_rage
4:33.191 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(9), sophic_devotion, forgestorm_ignited, corrupting_rage
4:34.428 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, spiraling_winds(9), sophic_devotion, forgestorm_ignited, corrupting_rage
4:35.666 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, spiraling_winds(10), sophic_devotion, forgestorm_ignited, corrupting_rage
4:36.902 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, spiraling_winds(10), sophic_devotion, forgestorm_ignited, corrupting_rage
4:38.140 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited, corrupting_rage
4:39.378 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), doom_winds, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited, corrupting_rage
4:40.614 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited, corrupting_rage
4:41.852 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited, corrupting_rage
4:43.090 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, forgestorm_ignited, corrupting_rage
4:44.327 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion, forgestorm_ignited, corrupting_rage
4:45.564 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:46.801 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:48.039 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:49.276 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon(4), legacy_of_the_frost_witch, corrupting_rage
4:50.514 Waiting     1.005s 250000.0/250000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(4), corrupting_rage
4:51.519 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(4), corrupting_rage
4:52.956 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(5), ice_strike, corrupting_rage
4:54.194 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:55.432 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:56.669 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:57.905 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:59.143 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 250000 250000 0
Spell Power 2280 6148 0
Crit 21.84% 15.63% 1013
Haste 21.55% 21.55% 3663
Versatility 3.93% 0.93% 191
Mana Regen 2560 2560 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [16]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [29]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQJJSIAAAAAAAAAAAAgSESCJkioQSDAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
actions+=/primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
actions+=/call_action_list,name=funnel,if=active_enemies>1&rotation.funnel

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.funnel=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.funnel+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.funnel+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/windstrike,if=(talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1)|buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/stormstrike,if=buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&buff.crackling_thunder.up
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)|(talent.converging_storms.enabled&buff.converging_storms.stack<buff.converging_storms.max_stack)
actions.funnel+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.funnel+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.funnel+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.funnel+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.funnel+=/sundering
actions.funnel+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.funnel+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=3
actions.funnel+=/stormstrike,if=buff.crash_lightning.up&talent.deeply_rooted_elements.enabled
actions.funnel+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.funnel+=/windstrike
actions.funnel+=/stormstrike
actions.funnel+=/ice_strike
actions.funnel+=/lava_lash
actions.funnel+=/crash_lightning
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=2
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5
actions.funnel+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.funnel+=/flame_shock,if=!ticking
actions.funnel+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
actions.single+=/primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
actions.single+=/lava_lash,if=talent.lashing_flames.enabled
actions.single+=/ice_strike,if=!buff.ice_strike.up
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/ice_strike
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=action.sundering.cooldown
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Ele : 59228 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
59227.7 59227.7 54.9 / 0.093% 9395.9 / 15.9% 106.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
525.8 524.6 Mana 0.32% 53.7 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkESSSDlEAAAAAAAAAAAAAKRIJkQKiCJNAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Ele 59228
Elemental Blast 11348 19.2% 24.8 12.22s 137372 120042 Direct 24.8 113343 226993 137422 21.2% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.77 24.76 0.00 0.00 0.00 1.1444 0.0000 3402118.06 3402118.06 0.00% 120042.27 120042.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.81% 19.51 8 30 113343.43 46819 267596 113343.93 94987 135200 2211399 2211399 0.00%
crit 21.19% 5.25 0 14 226993.48 93638 523336 226147.81 0 385160 1190720 1190720 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:0.30
  • if_expr:buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
    single
    [O]:6.41
  • if_expr:buff.maelstrom_weapon.stack>=5&charges=max_charges
    single
    [Q]:18.06
  • if_expr:buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Resource Cost 2Enhancement Shaman13704112PCT-1.000
Spell Direct AmountEnhancement Shaman13704122PCT-0.090
Spell Direct AmountEnhancement Shaman13704123PCT0.100
Spell Direct AmountFire and Ice3828861PCT0.030
Flame Shock 5856 9.9% 90.3 3.32s 19432 152397 Direct 90.3 6999 14026 8514 21.6% 0.0%
Periodic 196.0 4136 8284 5033 21.6% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.34 90.34 195.98 195.98 89.34 0.1275 1.5215 1755456.47 1755456.47 0.00% 5668.28 152396.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.44% 70.86 40 105 6998.93 3928 17884 6999.19 5977 8251 495942 495942 0.00%
crit 21.56% 19.48 3 41 14025.79 7856 34113 14027.24 11148 18840 273230 273230 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 78.38% 153.62 109 197 4135.82 2271 10264 4135.86 3509 4798 635332 635332 0.00%
crit 21.62% 42.36 18 72 8284.38 4541 19712 8284.29 7088 9944 350953 350953 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Volcanic damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Volcanic damage and then an additional {$=}o2 Volcanic damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Volcanic damage and knocking them into the air.]

Action Priority List

    single
    [a]:9.75

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Spell Periodic AmountFire and Ice3828862PCT0.030
Flametongue Weapon 0 (967) 0.0% (1.6%) 1.0 0.00s 289962 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFire and Ice3828861PCT0.030
    Flametongue Attack 967 1.6% 610.1 0.74s 475 0 Direct 610.1 391 782 475 21.6% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 610.13 610.13 0.00 0.00 0.00 0.0000 0.0000 289962.39 289962.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.38% 478.24 347 633 390.62 297 1076 390.61 344 459 186807 186807 0.00%
crit 21.62% 131.90 75 200 782.09 594 2176 782.17 688 929 103156 103156 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Forgestorm Ignited (_damage) 1267 2.1% 29.0 7.57s 13135 0 Direct 29.0 10808 21616 13135 21.5% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.96 28.96 0.00 0.00 0.00 0.0000 0.0000 380376.12 380376.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.47% 22.72 2 67 10807.96 10705 11241 10799.53 10705 11158 245592 245592 0.00%
crit 21.53% 6.24 0 24 21616.17 21411 22481 21441.96 0 22481 134784 134784 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 6482 10.9% 42.9 6.94s 45337 39762 Direct 42.9 37272 74664 45337 21.6% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.86 42.86 0.00 0.00 0.00 1.1402 0.0000 1943291.46 1943291.46 0.00% 39762.07 39762.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.43% 33.62 18 50 37272.40 7862 119032 37320.77 29111 46301 1253044 1253044 0.00%
crit 21.57% 9.24 0 22 74664.39 15725 226337 74730.21 0 135014 690247 690247 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [V]:42.59
  • if_expr:buff.hailstorm.up
    single
    [Y]:0.27

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownEnhancement Shaman1370417ADD6000.000
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Ice Strike 2404 4.1% 24.2 12.54s 29834 26166 Direct 24.2 24489 49046 29834 21.8% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.15 24.15 0.00 0.00 0.00 1.1402 0.0000 720571.45 720571.45 0.00% 26166.44 26166.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.23% 18.90 9 28 24488.56 18489 52836 24491.11 20840 30767 462716 462716 0.00%
crit 21.77% 5.26 0 14 49046.41 36979 106706 48948.13 0 85736 257856 257856 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [T]:24.15
  • if_expr:talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Lava Lash 12598 21.3% 73.6 4.05s 51295 45046 Direct 73.6 (73.6) 42149 84415 51295 21.6% (21.6%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 73.61 73.61 0.00 0.00 0.00 1.1387 0.0000 3775827.25 3775827.25 0.00% 45045.78 45045.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.36% 57.68 30 93 42148.77 21808 126515 42147.65 36549 50618 2431182 2431182 0.00%
crit 21.64% 15.93 3 33 84415.41 43617 242348 84387.70 65842 119496 1344645 1344645 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [M]:48.54
  • if_expr:buff.hot_hand.up
    single
    [U]:25.07
  • if_expr:talent.lashing_flames.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownMolten Assault3340331ADD-6000.000
Spell Direct AmountFire and Ice3828861PCT0.030
Lightning Bolt 6048 10.2% 28.7 10.38s 63230 53738 Direct 28.7 52005 103991 63230 21.6% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.68 28.68 0.00 0.00 0.00 1.1767 0.0000 1813244.06 1813244.06 0.00% 53738.49 53738.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.41% 22.48 9 35 52005.25 29581 130417 52042.35 42380 64414 1169320 1169320 0.00%
crit 21.59% 6.19 0 15 103990.81 59163 257821 103866.09 0 171999 643925 643925 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.91

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [P]:6.93
  • if_expr:buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [R]:12.50
  • if_expr:((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
    single
    [X]:9.25
  • if_expr:talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
main_hand 1809 3.1% 194.0 1.80s 2796 1605 Direct 194.0 2656 5316 2796 21.6% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 194.00 194.00 0.00 0.00 0.00 1.7417 0.0000 542427.12 774915.65 30.00% 1605.33 1605.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.06% 120.40 75 166 2656.46 2257 4294 2656.19 2454 3000 319828 456909 30.00%
crit 21.58% 41.87 18 69 5315.95 4513 8571 5315.23 4783 6102 222599 318007 30.00%
miss 16.36% 31.73 9 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 926 1.6% 198.2 1.76s 1402 806 Direct 198.2 1331 2665 1402 21.7% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 198.15 198.15 0.00 0.00 0.00 1.7388 0.0000 277733.27 396771.93 30.00% 806.09 806.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.87% 122.60 80 165 1331.01 1128 2151 1330.92 1228 1477 163182 233123 30.00%
crit 21.69% 42.98 20 72 2665.39 2257 4302 2665.04 2398 3016 114551 163648 30.00%
miss 16.44% 32.57 10 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 0 (3742) 0.0% (6.3%) 7.0 46.18s 160538 134318

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 0.00 0.00 0.00 0.00 1.1953 0.0000 0.00 0.00 0.00% 134317.69 134317.69

Action Details: Primordial Wave

  • id:375982
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:elemental
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:1.00
  • if_expr:!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
    single
    [S]:5.98
  • if_expr:raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
    Primordial Wave (_damage) 1105 1.9% 7.0 46.18s 47397 0 Direct 7.0 38890 78129 47401 21.7% 0.0%

Stats Details: Primordial Wave Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 0.00 0.0000 0.0000 330795.95 330795.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.32% 5.47 1 8 38890.46 31062 60094 38909.26 31062 50819 212578 212578 0.00%
crit 21.68% 1.51 0 6 78128.74 62125 119038 64374.93 0 119038 118218 118218 0.00%

Action Details: Primordial Wave Damage

  • id:375984
  • school:elemental
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:6.00

Spelldata

  • id:375984
  • name:Primordial Wave
  • school:elemental
  • tooltip:
  • description:{$@spelldesc375982=Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman13704121PCT5.000
    Lightning Bolt (_pw) 2637 4.4% 6.9 45.77s 114027 0 Direct 6.9 93744 187401 114027 21.7% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 0.00 0.0000 0.0000 789950.85 789950.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.34% 5.43 0 8 93744.15 59163 195625 93741.35 0 138336 508773 508773 0.00%
crit 21.66% 1.50 0 6 187401.43 118325 371923 151489.78 0 353811 281178 281178 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.91

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
Stormstrike 0 (1894) 0.0% (3.2%) 32.4 9.12s 17547 15350

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.37 0.00 0.00 0.00 0.00 1.1432 0.0000 0.00 0.00 0.00% 15349.90 15349.90

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [W]:32.37

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
    Stormstrike (_mh) 1262 2.1% 32.4 9.12s 11697 0 Direct 32.4 9610 19267 11697 21.6% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.37 32.37 0.00 0.00 0.00 0.0000 0.0000 378620.43 540900.12 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.39% 25.37 10 44 9610.49 8137 15311 9609.48 8526 11254 243850 348366 30.00%
crit 21.61% 6.99 0 19 19266.91 16274 30623 19240.85 0 25679 134770 192534 29.96%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
    Stormstrike Off-Hand 631 1.1% 32.4 9.12s 5850 0 Direct 32.4 4806 9626 5850 21.7% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.37 32.37 0.00 0.00 0.00 0.0000 0.0000 189356.71 270516.48 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.34% 25.36 9 42 4806.32 4069 7656 4805.60 4247 5605 121879 174117 30.00%
crit 21.66% 7.01 0 17 9625.62 8137 15311 9621.15 0 14247 67478 96400 29.98%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
Windfury Weapon 0 (901) 0.0% (1.5%) 1.0 0.00s 270035 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 901 1.5% 119.8 5.14s 2254 0 Direct 119.8 1853 3710 2254 21.6% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.79 119.79 0.00 0.00 0.00 0.0000 0.0000 270034.95 385774.05 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.39% 93.90 42 147 1853.06 1565 3028 1852.92 1672 2121 174004 248584 30.00%
crit 21.61% 25.89 6 53 3709.84 3130 5997 3710.02 3225 4383 96031 137190 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
pet - greater_earth_elemental 500 / 107
melee 500 0.2% 44.3 2.53s 720 507 Direct 44.3 592 1185 720 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.29 44.29 0.00 0.00 0.00 1.4190 0.0000 31897.35 45568.81 30.00% 507.48 507.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.40% 34.73 19 66 591.91 488 905 589.25 488 744 20555 29365 30.00%
crit 21.60% 9.57 0 27 1185.45 976 1810 1179.88 0 1604 11343 16204 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2462 / 958
melee 2462 1.6% 120.3 2.69s 2387 2140 Direct 120.3 1961 3929 2387 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.27 120.27 0.00 0.00 0.00 1.1153 0.0000 287039.59 410067.01 30.00% 2139.99 2139.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.36% 94.24 10 215 1960.78 1630 3160 1958.71 1645 2466 184792 263995 30.00%
crit 21.64% 26.03 2 66 3928.81 3260 6320 3922.72 3260 5030 102248 146072 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2461 / 960
melee 2461 1.6% 120.4 2.68s 2387 2138 Direct 120.4 1961 3928 2387 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.37 120.37 0.00 0.00 0.00 1.1164 0.0000 287299.60 410438.46 30.00% 2137.90 2137.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.36% 94.33 10 212 1961.06 1630 3124 1958.44 1630 2450 184977 264260 30.00%
crit 21.64% 26.05 2 61 3928.45 3260 6247 3922.65 3260 5030 102322 146178 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2464 / 960
melee 2464 1.6% 120.4 2.66s 2388 2139 Direct 120.4 1962 3932 2388 21.7% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.37 120.37 0.00 0.00 0.00 1.1164 0.0000 287489.72 410710.08 30.00% 2139.39 2139.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.34% 94.29 9 211 1961.65 1630 3160 1959.55 1630 2555 184969 264248 30.00%
crit 21.66% 26.07 1 67 3931.69 3260 6320 3927.07 3260 5120 102521 146462 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Ele
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.2 311.18s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.20 0.00 0.00 0.00 0.00 0.9258 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Z]:1.20
Feral Spirit 14.4 22.15s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.35 0.00 0.00 0.00 0.00 1.1334 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:14.35

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 303.69s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 3.0 116.98s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.00 0.5473 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Action Priority List

    single
    [N]:1.66
  • if_expr:!buff.windfury_totem.up
    single
    [b]:0.38
  • if_expr:buff.windfury_totem.remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 73.2 122.8 4.1s 1.5s 3.3s 80.07% 98.30% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 16.3s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:71.57% / 87.13%

Stack Uptimes

  • ashen_catalyst_1:33.61%
  • ashen_catalyst_2:18.10%
  • ashen_catalyst_3:12.74%
  • ashen_catalyst_4:10.13%
  • ashen_catalyst_5:4.25%
  • ashen_catalyst_6:0.97%
  • ashen_catalyst_7:0.22%
  • ashen_catalyst_8:0.04%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.5s 50.1s 80.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 341.0s
  • trigger_min/max:15.0s / 326.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 353.2s
  • uptime_min/max:47.98% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.16%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Crackling Surge 8.0 0.0 37.2s 36.8s 15.0s 38.89% 43.84% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.4s / 231.6s
  • trigger_min/max:11.4s / 231.6s
  • trigger_pct:84.61%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:0.00% / 72.67%

Stack Uptimes

  • crackling_surge_1:31.08%
  • crackling_surge_2:7.79%
  • crackling_surge_3:0.02%
  • crackling_surge_4:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases Nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4s 5.3s 17.8s 12.06% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 165.8s
  • trigger_pct:100.00%
  • duration_min/max:15.1s / 20.0s
  • uptime_min/max:9.82% / 15.02%

Stack Uptimes

  • crumbling_power_1:0.43%
  • crumbling_power_2:0.63%
  • crumbling_power_3:0.65%
  • crumbling_power_4:0.64%
  • crumbling_power_5:0.63%
  • crumbling_power_6:0.62%
  • crumbling_power_7:0.62%
  • crumbling_power_8:0.60%
  • crumbling_power_9:0.59%
  • crumbling_power_10:0.60%
  • crumbling_power_11:0.62%
  • crumbling_power_12:0.64%
  • crumbling_power_13:0.66%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.68%
  • crumbling_power_16:0.69%
  • crumbling_power_17:0.69%
  • crumbling_power_18:0.69%
  • crumbling_power_19:0.69%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Elemental Blast: Critical Strike 8.3 0.0 35.1s 35.1s 9.8s 27.15% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 245.6s
  • trigger_min/max:10.0s / 245.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.80% / 50.24%

Stack Uptimes

  • elemental_blast_critical_strike_1:27.15%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 8.2 0.0 35.4s 35.4s 9.8s 26.93% 0.00% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 217.6s
  • trigger_min/max:10.0s / 217.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:5.69% / 50.23%

Stack Uptimes

  • elemental_blast_haste_1:26.93%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 8.3 0.0 35.1s 35.1s 9.8s 27.16% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 252.7s
  • trigger_min/max:10.0s / 252.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.96% / 51.43%

Stack Uptimes

  • elemental_blast_mastery_1:27.16%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.0s 303.5s 27.5s 13.44% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 317.5s
  • trigger_min/max:300.0s / 317.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.97% / 18.14%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.44%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 13.7 0.6 22.6s 22.1s 15.3s 69.99% 0.00% 56.7 (56.7) 13.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 45.1s
  • trigger_min/max:13.0s / 35.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:63.04% / 76.35%

Stack Uptimes

  • feral_spirit_1:69.99%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 44.5 281.7 6.8s 0.9s 5.6s 83.35% 89.81% 281.7 (617.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 59.3s
  • trigger_min/max:0.0s / 17.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.7s
  • uptime_min/max:71.53% / 92.85%

Stack Uptimes

  • flurry_1:21.78%
  • flurry_2:36.70%
  • flurry_3:24.87%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.2s 46.1s 13.0s 19.52% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 208.4s
  • trigger_min/max:0.1s / 202.9s
  • trigger_pct:98.91%
  • duration_min/max:0.0s / 49.5s
  • uptime_min/max:3.80% / 51.17%

Stack Uptimes

  • forgestorm_ignited_1:19.52%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 43.1 10.3 7.0s 5.6s 3.6s 51.97% 99.37% 10.3 (78.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 39.6s
  • trigger_min/max:0.8s / 16.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.5s
  • uptime_min/max:36.63% / 66.36%

Stack Uptimes

  • hailstorm_5:4.21%
  • hailstorm_6:3.83%
  • hailstorm_7:3.58%
  • hailstorm_8:10.56%
  • hailstorm_9:7.71%
  • hailstorm_10:22.09%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.7 5.7 27.4s 17.4s 9.9s 35.36% 86.47% 5.7 (5.7) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 187.0s
  • trigger_min/max:0.0s / 187.0s
  • trigger_pct:5.00%
  • duration_min/max:0.0s / 47.4s
  • uptime_min/max:5.68% / 61.67%

Stack Uptimes

  • hot_hand_1:35.36%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.1 0.0 12.6s 12.5s 3.4s 27.66% 55.50% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.6s / 32.5s
  • trigger_min/max:7.6s / 32.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.2s
  • uptime_min/max:13.96% / 42.01%

Stack Uptimes

  • ice_strike_1:27.66%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 8.0 0.0 37.1s 36.7s 15.0s 38.95% 100.00% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.3s / 271.6s
  • trigger_min/max:11.3s / 271.6s
  • trigger_pct:84.54%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:0.00% / 69.04%

Stack Uptimes

  • icy_edge_1:31.07%
  • icy_edge_2:7.85%
  • icy_edge_3:0.02%
  • icy_edge_4:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases Frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 54.3 378.7 5.6s 0.7s 4.6s 84.01% 100.00% 28.2 (41.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 16.9s
  • trigger_min/max:0.0s / 6.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.6s
  • uptime_min/max:79.45% / 88.25%

Stack Uptimes

  • maelstrom_weapon_1:9.73%
  • maelstrom_weapon_2:9.98%
  • maelstrom_weapon_3:10.18%
  • maelstrom_weapon_4:10.15%
  • maelstrom_weapon_5:9.08%
  • maelstrom_weapon_6:8.12%
  • maelstrom_weapon_7:7.23%
  • maelstrom_weapon_8:6.34%
  • maelstrom_weapon_9:4.16%
  • maelstrom_weapon_10:9.03%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 8.0 0.0 37.0s 36.7s 15.0s 38.96% 100.00% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.5s / 279.8s
  • trigger_min/max:11.5s / 279.8s
  • trigger_pct:84.50%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:5.44% / 72.02%

Stack Uptimes

  • molten_weapon_1:31.12%
  • molten_weapon_2:7.81%
  • molten_weapon_3:0.02%
  • molten_weapon_4:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases Fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Wave 7.0 0.0 46.2s 46.2s 2.7s 6.30% 24.27% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 57.2s
  • trigger_min/max:45.0s / 57.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:2.96% / 15.45%

Stack Uptimes

  • primordial_wave_1:6.30%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.2 60.9s 45.5s 16.5s 23.58% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 213.8s
  • trigger_min/max:0.0s / 213.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 62.2s
  • uptime_min/max:4.69% / 58.53%

Stack Uptimes

  • sophic_devotion_1:23.58%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.1s 45.7s 32.1s 38.10% 0.00% 25.5 (25.5) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 249.4s
  • trigger_min/max:0.1s / 201.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 187.6s
  • uptime_min/max:7.97% / 84.38%

Stack Uptimes

  • spiraling_winds_1:2.34%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.28%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.22%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.66%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 6.9 0.0 45.8s 45.8s 11.8s 27.27% 31.06% 0.0 (0.0) 6.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:33.2s / 88.1s
  • trigger_min/max:33.2s / 88.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:22.97% / 29.89%

Stack Uptimes

  • splintered_elements_1:27.27%

Spelldata

  • id:382043
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc382042=Primordial Wave grants you {$s1=20}% Haste plus {$s2=4}% for each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave for {$382043d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 15.9 5.0 18.3s 13.7s 5.6s 29.64% 44.17% 5.0 (5.0) 1.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 158.2s
  • trigger_min/max:0.0s / 158.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.4s
  • uptime_min/max:3.87% / 53.89%

Stack Uptimes

  • stormbringer_1:29.64%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 26.9 10.0 52.0 10.9s 1.1s 144.4s
Windfury (Off Hand) 27.3 10.0 50.0 10.7s 1.1s 119.9s
Elemental Blast: Critical Strike 8.3 1.0 17.0 35.1s 10.0s 245.6s
Elemental Blast: Haste 8.2 2.0 18.0 35.4s 10.0s 217.6s
Elemental Blast: Mastery 8.3 1.0 16.0 35.1s 10.0s 252.7s
Maelstrom Weapon Swing Reset 6.9 5.0 8.0 45.8s 33.2s 88.1s
Flametongue: Windfury Attack 119.8 48.0 190.0 5.1s 0.0s 70.8s
Stormbringer: Windfury Attack 8.9 0.0 25.0 31.4s 0.0s 289.9s
Flametongue: main_hand 162.3 110.0 218.0 2.2s 1.1s 17.9s
Hot Hand: main_hand 8.1 0.0 22.0 32.9s 1.1s 290.3s
Windfury: main_hand 44.4 20.0 72.0 7.0s 1.1s 79.8s
Flametongue: offhand 165.6 116.0 217.0 2.2s 1.1s 18.1s
Hot Hand: offhand 8.3 0.0 24.0 32.2s 1.1s 319.3s
Flametongue: Lava Lash 73.6 39.0 111.0 4.0s 0.8s 16.2s
Stormbringer: Lava Lash 5.4 0.0 16.0 44.5s 0.8s 313.8s
Flametongue: Ice Strike 24.2 18.0 30.0 12.5s 7.6s 32.5s
Stormbringer: Ice Strike 1.8 0.0 8.0 83.0s 7.9s 345.3s
Windfury: Ice Strike 6.6 0.0 16.0 40.5s 7.9s 293.7s
Flametongue: Stormstrike 32.4 17.0 49.0 9.1s 0.8s 74.1s
Stormbringer: Stormstrike 2.4 0.0 11.0 67.7s 0.8s 350.8s
Windfury: Stormstrike 8.9 1.0 22.0 30.4s 0.8s 291.9s
Flametongue: Stormstrike Off-Hand 32.4 17.0 49.0 9.1s 0.8s 74.1s
Stormbringer: Stormstrike Off-Hand 2.4 0.0 11.0 68.2s 0.8s 336.7s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 42.53% 34.21% 49.17% 0.7s 0.0s 5.4s
Hot Hand 35.36% 5.68% 61.67% 9.9s 0.0s 47.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike
Stormstrike		3.8730.00054.871127.75864.952212.135
Primordial Wave1.1400.00012.1907.9901.16124.868
Feral Spirit0.7740.0001.49111.1374.45918.509
Lava Lash0.5720.0008.32542.23218.90570.088
Elemental Blast0.5070.00013.52212.6421.78639.131
Ice Strike1.1960.00020.07229.0419.18564.701
Frost Shock2.4230.00032.959104.82955.565158.681
Flame Shock23.8130.000263.132253.892177.983340.562
Earth Elemental18.7680.000200.71024.7516.149277.152

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack26.52.25.84%5.32%
main_hand35.43.47.80%8.12%
offhand36.53.28.03%7.81%
Primordial Wave50.319.511.07%46.96%
Feral Spirit76.66.416.86%15.34%
Lava Lash84.56.718.60%16.14%
Ice Strike54.00.111.89%0.16%
Frost Shock42.60.09.38%0.00%
Stormstrike32.30.17.11%0.17%
Stormstrike (_mh)7.80.01.72%0.00%
Stormstrike Off-Hand7.70.01.70%0.00%
Overflow Stacks0.041.60.00%8.39%
Actual Stacks454.30.091.61%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt234.552.10%
Elemental Blast215.647.90%
Total Spent450.1100.00%
Casts per Maelstrom Weapon Stack Consumed
Ability 0 1 2 3 4 5 6 7 8 9 10
Lightning Bolt          3.15 3.03 3.07 5.66 3.89 9.88
Elemental Blast          1.12 1.00 0.88 7.15 5.52 9.09
Total           4.27
(7.98%)		 4.03
(7.54%)		 3.95
(7.40%)		 12.82
(23.98%)		 9.41
(17.61%)		 18.97
(35.49%)

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Ele
Mana RegenMana631.60157389.31100.00%249.19609631.7279.48%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 270980.0 0.00 873.98 0.0 8786.4 -459565.5 270980.0
Mana 250000.0 524.63 525.84 609632.0 249638.9 248350.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement_Ele
BloodlustMana 1.001000.000.63%1000.001000.000.00
Flame ShockMana 9.757312.824.64%750.0080.95240.05
Frost ShockMana 42.8621431.6113.59%500.00500.0090.67
Ice StrikeMana 24.1539851.6525.26%1650.001650.0018.08
Lava LashMana 73.6129443.8118.66%400.00400.00128.24
Lightning BoltMana 28.6814338.499.09%500.00500.00126.46
Primordial WaveMana 6.9810471.806.64%1500.001500.00107.03
StormstrikeMana 32.3732368.0820.52%1000.001000.0017.55
Windfury TotemMana 3.041532.200.97%503.53503.520.00

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Ele Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Ele Damage Per Second
Count 7499
Mean 59227.75
Minimum 50793.23
Maximum 69367.64
Spread ( max - min ) 18574.41
Range [ ( max - min ) / 2 * 100% ] 15.68%
Standard Deviation 2427.4652
5th Percentile 55514.57
95th Percentile 63305.09
( 95th Percentile - 5th Percentile ) 7790.52
Mean Distribution
Standard Deviation 28.0318
95.00% Confidence Interval ( 59172.81 - 59282.69 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 65
0.1% Error 6453
0.1 Scale Factor Error with Delta=300 50303
0.05 Scale Factor Error with Delta=300 201211
0.01 Scale Factor Error with Delta=300 5030252
Priority Target DPS
PR_Shaman_Enhancement_Ele Priority Target Damage Per Second
Count 7499
Mean 59227.75
Minimum 50793.23
Maximum 69367.64
Spread ( max - min ) 18574.41
Range [ ( max - min ) / 2 * 100% ] 15.68%
Standard Deviation 2427.4652
5th Percentile 55514.57
95th Percentile 63305.09
( 95th Percentile - 5th Percentile ) 7790.52
Mean Distribution
Standard Deviation 28.0318
95.00% Confidence Interval ( 59172.81 - 59282.69 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 65
0.1% Error 6453
0.1 Scale Factor Error with Delta=300 50303
0.05 Scale Factor Error with Delta=300 201211
0.01 Scale Factor Error with Delta=300 5030252
DPS(e)
PR_Shaman_Enhancement_Ele Damage Per Second (Effective)
Count 7499
Mean 59227.75
Minimum 50793.23
Maximum 69367.64
Spread ( max - min ) 18574.41
Range [ ( max - min ) / 2 * 100% ] 15.68%
Damage
PR_Shaman_Enhancement_Ele Damage
Count 7499
Mean 16859766.54
Minimum 12363767.94
Maximum 22686511.26
Spread ( max - min ) 10322743.32
Range [ ( max - min ) / 2 * 100% ] 30.61%
DTPS
PR_Shaman_Enhancement_Ele Damage Taken Per Second
Count 7499
Mean 874.12
Minimum 0.00
Maximum 2298.40
Spread ( max - min ) 2298.40
Range [ ( max - min ) / 2 * 100% ] 131.47%
HPS
PR_Shaman_Enhancement_Ele Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Ele Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Ele Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Ele Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Ele Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_EleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Ele Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
0.00 primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
G 14.35 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
0.00 doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
I 0.00 call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
J 0.00 call_action_list,name=funnel,if=active_enemies>1&rotation.funnel
actions.single
# count action,conditions
K 1.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
L 0.30 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
0.00 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
M 48.54 lava_lash,if=buff.hot_hand.up
N 1.66 windfury_totem,if=!buff.windfury_totem.up
O 6.41 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
P 6.93 lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
Q 18.06 elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
R 12.50 lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
S 5.98 primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
0.00 flame_shock,if=!ticking
T 24.15 ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
U 25.07 lava_lash,if=talent.lashing_flames.enabled
0.00 ice_strike,if=!buff.ice_strike.up
V 42.59 frost_shock,if=buff.hailstorm.up
0.00 lava_lash
0.00 ice_strike
0.00 windstrike
W 32.37 stormstrike
0.00 sundering,if=raid_event.adds.in>=action.sundering.cooldown
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
X 9.25 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 0.27 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Z 1.20 earth_elemental
a 9.75 flame_shock
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
b 0.38 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGKOTUPVWZUXVWTQUVWWGQMVMTMRMVUWMQMTMRMGMVMQMTVWURSPVWURTGVWQUVaWXTUVWRaVUWaTOVUGWWQVaMSMMPMTMVGQUVWXMTMQMVUQWVXNTUGVWQaUVWTRSPUVWWMGMQMTMQMVMMRMVMTRUVGWMQMVMTMQEFVWSMGMPMTMQMVMWMRMMTMRMVMGMOMMTMQMVMWRVaSPTGUVQWaVUXTNVWQUVXWaVTGMQMVMQMVTWRVUSPVWGTQUVWXaVUWTQVaUWXVCa

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 2 augmentation PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 3 windfury_weapon PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 4 flametongue_weapon PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 6 windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana corrupting_rage
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
0:00.000 default B bloodlust Fluffy_Pillow 250000.0/250000: 100% mana corrupting_rage
0:00.000 default C potion Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, corrupting_rage
0:00.000 default D auto_attack Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, maelstrom_weapon, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default F berserking PR_Shaman_Enhancement_Ele 249000.0/250000: 100% mana bloodlust, maelstrom_weapon, crumbling_power(20), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, berserking, maelstrom_weapon, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:00.894 single K primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, feral_spirit, crackling_surge(2), maelstrom_weapon(2), crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:01.787 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), primordial_wave, feral_spirit, crackling_surge(2), maelstrom_weapon(10), crumbling_power(18), corrupting_rage, elemental_potion_of_ultimate_power
0:02.681 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, hailstorm(10), crumbling_power(17), corrupting_rage, elemental_potion_of_ultimate_power
0:03.573 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(6), hailstorm(10), ice_strike, crumbling_power(16), corrupting_rage, elemental_potion_of_ultimate_power
0:04.466 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, crackling_surge(2), stormbringer, maelstrom_weapon(8), hailstorm(10), ice_strike, crumbling_power(15), corrupting_rage, elemental_potion_of_ultimate_power
0:05.359 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, stormbringer, hailstorm(10), ice_strike, crumbling_power(14), corrupting_rage, elemental_potion_of_ultimate_power
0:06.112 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(2), crumbling_power(13), corrupting_rage, elemental_potion_of_ultimate_power
0:06.866 single Z earth_elemental Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(3), crumbling_power(12), corrupting_rage, elemental_potion_of_ultimate_power
0:07.620 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(3), crumbling_power(11), corrupting_rage, elemental_potion_of_ultimate_power
0:08.409 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), maelstrom_weapon(5), crumbling_power(10), corrupting_rage, elemental_potion_of_ultimate_power
0:09.163 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon, hailstorm(5), crumbling_power(9), corrupting_rage, elemental_potion_of_ultimate_power
0:09.917 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(2), crumbling_power(8), corrupting_rage, elemental_potion_of_ultimate_power
0:10.671 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(5), crumbling_power(7), corrupting_rage, elemental_potion_of_ultimate_power
0:11.425 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(9), ice_strike, crumbling_power(6), corrupting_rage, elemental_potion_of_ultimate_power
0:12.179 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon, hailstorm(9), ice_strike, crumbling_power(5), corrupting_rage, elemental_potion_of_ultimate_power
0:12.998 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(2), hailstorm(9), ice_strike, crumbling_power(4), corrupting_rage, elemental_potion_of_ultimate_power
0:13.817 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(3), crumbling_power(3), corrupting_rage, elemental_potion_of_ultimate_power
0:14.636 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(4), crumbling_power(2), corrupting_rage, elemental_potion_of_ultimate_power
0:15.455 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst(3), stormbringer, maelstrom_weapon(7), crumbling_power, corrupting_rage, elemental_potion_of_ultimate_power
0:16.274 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(8), corrupting_rage, elemental_potion_of_ultimate_power
0:17.091 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(5), hot_hand, stormbringer, maelstrom_weapon, hailstorm(8), corrupting_rage, elemental_potion_of_ultimate_power
0:18.074 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, crackling_surge(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(8), corrupting_rage, elemental_potion_of_ultimate_power
0:19.057 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), corrupting_rage, elemental_potion_of_ultimate_power
0:20.040 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), corrupting_rage, elemental_potion_of_ultimate_power
0:21.023 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, corrupting_rage, elemental_potion_of_ultimate_power
0:22.006 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, crackling_surge(2), hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:22.989 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:23.972 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:24.954 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(3), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:25.937 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), stormbringer, maelstrom_weapon(4), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:26.920 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:27.903 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:28.886 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(10), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:29.869 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), hot_hand, maelstrom_weapon(2), hailstorm(10), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:30.852 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(7), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
0:31.835 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(9), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
0:32.818 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
0:33.800 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, hot_hand, maelstrom_weapon(2), hailstorm(10), ice_strike, corrupting_rage
0:34.783 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), ice_strike, corrupting_rage
0:35.766 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, corrupting_rage
0:36.749 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), corrupting_rage
0:37.730 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), corrupting_rage
0:38.771 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, hailstorm(8), corrupting_rage
0:39.754 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(8), corrupting_rage
0:40.737 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), hailstorm(8), ice_strike, corrupting_rage
0:42.013 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), corrupting_rage
0:43.288 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(7), corrupting_rage
0:44.564 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(9), corrupting_rage
0:45.840 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(9), corrupting_rage
0:47.169 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(10), hailstorm(9), spiraling_winds, corrupting_rage
0:48.444 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hailstorm(10), spiraling_winds(2), corrupting_rage
0:49.508 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds(2), corrupting_rage
0:50.572 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, ashen_catalyst(5), maelstrom_weapon(7), spiraling_winds(3), corrupting_rage
0:51.634 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, maelstrom_weapon(8), spiraling_winds(3), corrupting_rage
0:52.697 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hailstorm(8), spiraling_winds(4), corrupting_rage
0:53.761 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(2), maelstrom_weapon(3), hailstorm(8), ice_strike, spiraling_winds(4), corrupting_rage
0:54.825 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), hailstorm(8), ice_strike, spiraling_winds(5), corrupting_rage
0:55.889 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(7), spiraling_winds(5), corrupting_rage
0:56.953 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(10), spiraling_winds(6), corrupting_rage
0:58.017 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), hailstorm(10), spiraling_winds(7), corrupting_rage
0:59.049 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon, hailstorm(10), spiraling_winds(7), corrupting_rage
1:00.081 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), spiraling_winds(8), corrupting_rage
1:01.319 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), spiraling_winds(8), corrupting_rage
1:02.686 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(7), spiraling_winds(9), corrupting_rage
1:03.925 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon, hailstorm(7), spiraling_winds(10), corrupting_rage
1:05.164 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(4), hailstorm(7), ice_strike, spiraling_winds(10), corrupting_rage
1:06.403 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, stormbringer, maelstrom_weapon(6), hailstorm(7), ice_strike, spiraling_winds(10), corrupting_rage
1:07.642 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(7), spiraling_winds(10), corrupting_rage
1:08.918 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst(2), maelstrom_weapon(10), spiraling_winds(10), corrupting_rage
1:10.194 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(3), hailstorm(10), spiraling_winds(10), corrupting_rage
1:11.470 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(3), hailstorm(10), corrupting_rage
1:12.753 Waiting     0.279s 250000.0/250000: 100% mana ashen_catalyst(4), maelstrom_weapon, corrupting_rage
1:13.032 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(4), maelstrom_weapon, corrupting_rage
1:14.554 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(2), corrupting_rage
1:15.830 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(3), corrupting_rage
1:17.105 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(3), maelstrom_weapon(3), corrupting_rage
1:18.381 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst(3), maelstrom_weapon(5), ice_strike, corrupting_rage
1:19.657 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(4), hailstorm(5), ice_strike, corrupting_rage
1:20.933 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(5), maelstrom_weapon, corrupting_rage
1:22.237 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(2), forgestorm_ignited, corrupting_rage
1:23.513 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(3), forgestorm_ignited
1:24.789 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(5), forgestorm_ignited
1:26.064 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(9), forgestorm_ignited
1:27.340 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon, hailstorm(9), forgestorm_ignited
1:28.615 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(3), forgestorm_ignited
1:29.890 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(5), hot_hand, maelstrom_weapon(4), forgestorm_ignited
1:31.164 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), forgestorm_ignited
1:32.440 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), forgestorm_ignited
1:33.716 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, primordial_wave, feral_spirit, crackling_surge(2), hot_hand, stormbringer, maelstrom_weapon(10)
1:34.991 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10)
1:36.266 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, stormbringer, hailstorm(10)
1:37.329 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10)
1:38.393 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(10), ice_strike, corrupting_rage
1:39.457 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(10), ice_strike, corrupting_rage
1:40.521 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), corrupting_rage
1:41.585 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(9), corrupting_rage
1:42.649 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), stormbringer, hailstorm(9), corrupting_rage
1:43.681 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), stormbringer, maelstrom_weapon(3), hailstorm(9), corrupting_rage
1:44.713 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, stormbringer, maelstrom_weapon(4), corrupting_rage
1:45.744 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(5), corrupting_rage
1:46.777 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), hot_hand, maelstrom_weapon(2), hailstorm(5), corrupting_rage
1:47.810 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, crackling_surge(2), hot_hand, maelstrom_weapon(4), hailstorm(5), corrupting_rage
1:49.140 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), hailstorm(5), ice_strike, corrupting_rage
1:50.379 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(5), ice_strike, corrupting_rage
1:51.618 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, corrupting_rage
1:52.894 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), hot_hand, maelstrom_weapon(4), hailstorm(10), ice_strike, corrupting_rage
1:54.170 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(7), corrupting_rage
1:55.445 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(9), corrupting_rage
1:56.720 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(3), hailstorm(9), corrupting_rage
1:57.996 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(5), hailstorm(9), corrupting_rage
1:59.272 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(6), corrupting_rage
2:00.547 single N windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(4), hailstorm(6), corrupting_rage
2:01.399 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(4), hailstorm(6), corrupting_rage
2:02.675 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(5), maelstrom_weapon(2), hailstorm(6), ice_strike, corrupting_rage
2:03.951 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(3), hailstorm(6), ice_strike, corrupting_rage
2:05.227 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(6), hailstorm(6), ice_strike, corrupting_rage
2:06.502 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(7), corrupting_rage
2:07.777 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(9), corrupting_rage
2:09.053 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(4), hailstorm(9), sophic_devotion, corrupting_rage
2:10.329 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon, hailstorm(9), sophic_devotion
2:11.634 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(9), sophic_devotion
2:12.910 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, maelstrom_weapon(3), sophic_devotion
2:14.186 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(6), sophic_devotion
2:15.462 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(9), ice_strike, sophic_devotion
2:16.738 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon, hailstorm(9), ice_strike, sophic_devotion
2:18.014 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(10), hailstorm(9), ice_strike, sophic_devotion
2:19.290 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(5), maelstrom_weapon(2), hailstorm(10), ice_strike, sophic_devotion
2:20.354 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, sophic_devotion, forgestorm_ignited
2:21.418 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon(6), sophic_devotion, forgestorm_ignited
2:22.480 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), sophic_devotion, forgestorm_ignited
2:23.544 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, ashen_catalyst(3), hot_hand, maelstrom_weapon(9), forgestorm_ignited
2:24.608 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(10), forgestorm_ignited
2:25.672 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), forgestorm_ignited, corrupting_rage
2:26.735 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(10), forgestorm_ignited, corrupting_rage
2:27.799 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), forgestorm_ignited, corrupting_rage
2:28.831 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(10), forgestorm_ignited, corrupting_rage
2:29.864 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(8), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
2:30.896 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(10), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
2:32.135 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
2:33.418 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds, corrupting_rage
2:34.657 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), spiraling_winds, sophic_devotion, corrupting_rage
2:35.896 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(6), spiraling_winds(2), sophic_devotion, corrupting_rage
2:37.135 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(8), spiraling_winds(2), sophic_devotion, corrupting_rage
2:38.409 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, hailstorm(8), spiraling_winds(3), sophic_devotion, corrupting_rage
2:39.684 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(8), spiraling_winds(4), sophic_devotion, corrupting_rage
2:40.958 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(3), spiraling_winds(4), sophic_devotion
2:42.233 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(5), spiraling_winds(5), sophic_devotion
2:43.509 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(2), maelstrom_weapon(9), ice_strike, spiraling_winds(6), sophic_devotion
2:44.784 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(3), hailstorm(9), ice_strike, spiraling_winds(6), sophic_devotion
2:46.060 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon(2), hailstorm(9), ice_strike, spiraling_winds(7), sophic_devotion
2:47.336 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst, maelstrom_weapon(3), spiraling_winds(8), sophic_devotion
2:48.612 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(8), sophic_devotion
2:49.886 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hot_hand, maelstrom_weapon(8), spiraling_winds(9)
2:51.162 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(10), spiraling_winds(9)
2:52.438 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, hailstorm(10), spiraling_winds(10)
2:53.677 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), spiraling_winds(10)
2:54.916 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), spiraling_winds(10)
2:56.154 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(5), spiraling_winds(10), corrupting_rage
2:57.393 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(9), ice_strike, spiraling_winds(10), corrupting_rage
2:58.631 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(10), ice_strike, corrupting_rage
2:59.870 default E use_item_irideus_fragment Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(10), ice_strike, corrupting_rage
3:00.000 default F berserking PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(10), ice_strike, crumbling_power(20), corrupting_rage
3:00.000 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(10), ice_strike, crumbling_power(19), corrupting_rage
3:01.127 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(4), crumbling_power(19), corrupting_rage
3:02.254 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(5), crumbling_power(18), corrupting_rage
3:03.415 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_mastery, primordial_wave, ashen_catalyst(4), hot_hand, maelstrom_weapon(10), crumbling_power(17), corrupting_rage
3:04.576 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_mastery, primordial_wave, ashen_catalyst, hot_hand, maelstrom_weapon(10), crumbling_power(16), spiraling_winds, corrupting_rage
3:05.736 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), crumbling_power(15), spiraling_winds, corrupting_rage
3:06.897 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(10), crumbling_power(14), spiraling_winds(2), corrupting_rage
3:08.057 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), crumbling_power(13), spiraling_winds(2), corrupting_rage
3:09.025 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), crumbling_power(12), spiraling_winds(3), corrupting_rage
3:09.992 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), hailstorm(10), ice_strike, crumbling_power(11), spiraling_winds(3), corrupting_rage
3:10.960 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(10), ice_strike, crumbling_power(10), spiraling_winds(4), corrupting_rage
3:11.928 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, hailstorm(10), ice_strike, crumbling_power(9), spiraling_winds(4), corrupting_rage
3:12.867 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, crumbling_power(8), spiraling_winds(5), corrupting_rage
3:13.900 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3), crumbling_power(7), spiraling_winds(5), corrupting_rage
3:14.933 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(5), crumbling_power(6), spiraling_winds(6)
3:15.966 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(6), crumbling_power(5), spiraling_winds(6)
3:16.999 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), crumbling_power(4), spiraling_winds(7)
3:18.032 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, hailstorm(9), crumbling_power(3), spiraling_winds(7)
3:19.065 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(9), crumbling_power(2), spiraling_winds(8)
3:20.304 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(9), spiraling_winds(8)
3:21.543 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(9), ice_strike, spiraling_winds(9)
3:22.819 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(9), ice_strike, spiraling_winds(10)
3:24.095 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, hailstorm(10), ice_strike, spiraling_winds(10)
3:25.371 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds(10)
3:26.647 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3), spiraling_winds(10)
3:27.923 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst, stormbringer, maelstrom_weapon(5), spiraling_winds(10)
3:29.199 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), spiraling_winds(10), corrupting_rage
3:30.475 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), corrupting_rage
3:31.750 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(8), corrupting_rage
3:33.026 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(8)
3:34.302 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(8)
3:35.578 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(8), ice_strike
3:36.854 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(8), ice_strike
3:38.127 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike
3:39.403 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike
3:40.679 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4)
3:41.954 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(5)
3:43.230 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(8)
3:44.506 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon, hailstorm(8)
3:45.781 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(2)
3:47.057 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(2)
3:48.530 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, primordial_wave, ashen_catalyst(5), maelstrom_weapon(10), corrupting_rage
3:49.806 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(6), hailstorm(10), corrupting_rage
3:50.870 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst(6), maelstrom_weapon(3), hailstorm(10), ice_strike, corrupting_rage
3:51.933 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(7), maelstrom_weapon(4), hailstorm(10), ice_strike, corrupting_rage
3:52.997 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(6), hailstorm(10), ice_strike, corrupting_rage
3:54.060 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(8), corrupting_rage
3:55.123 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon, hailstorm(8), corrupting_rage
3:56.186 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(2), hailstorm(8), corrupting_rage
3:57.249 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(4), hailstorm(8), corrupting_rage
3:58.313 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(5), corrupting_rage
3:59.377 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), maelstrom_weapon(6), corrupting_rage
4:00.441 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon, hailstorm(6), forgestorm_ignited, corrupting_rage
4:01.505 single N windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(3), hailstorm(6), ice_strike, forgestorm_ignited, corrupting_rage
4:02.357 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(4), hailstorm(6), ice_strike, forgestorm_ignited, corrupting_rage
4:03.632 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(6), forgestorm_ignited, corrupting_rage
4:04.908 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(9), forgestorm_ignited, corrupting_rage
4:06.184 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(5), maelstrom_weapon(2), hailstorm(9), forgestorm_ignited, corrupting_rage
4:07.459 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(4), hailstorm(9), forgestorm_ignited, corrupting_rage
4:08.735 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(5), forgestorm_ignited, corrupting_rage
4:10.011 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), stormbringer, hailstorm(5), forgestorm_ignited, corrupting_rage
4:11.287 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(3), hailstorm(5), forgestorm_ignited, corrupting_rage
4:12.562 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), hailstorm(5), corrupting_rage
4:13.838 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(4), stormbringer, maelstrom_weapon(5), corrupting_rage
4:15.114 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(5), hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, corrupting_rage
4:16.388 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), hot_hand, stormbringer, maelstrom_weapon(9), ice_strike, corrupting_rage
4:17.664 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, corrupting_rage
4:18.940 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, corrupting_rage
4:20.179 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, corrupting_rage
4:21.418 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(7), corrupting_rage
4:22.656 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(8), corrupting_rage
4:23.895 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, hailstorm(8), corrupting_rage
4:25.134 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(2), hailstorm(8), corrupting_rage
4:26.373 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), corrupting_rage
4:27.611 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), ice_strike, corrupting_rage
4:28.849 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(8), ice_strike, corrupting_rage
4:30.125 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon, hailstorm(8), ice_strike, corrupting_rage
4:31.425 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(5), maelstrom_weapon(2), corrupting_rage
4:32.701 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon(4), sophic_devotion, corrupting_rage
4:33.977 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, ashen_catalyst, maelstrom_weapon(10), sophic_devotion, corrupting_rage
4:35.252 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(2), hailstorm(10), sophic_devotion, corrupting_rage
4:36.316 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(3), maelstrom_weapon, sophic_devotion, corrupting_rage
4:37.378 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst(3), maelstrom_weapon(4), sophic_devotion, corrupting_rage
4:38.441 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(5), sophic_devotion, corrupting_rage
4:39.504 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(8), ice_strike, sophic_devotion, corrupting_rage
4:40.567 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(6), maelstrom_weapon, hailstorm(8), ice_strike, sophic_devotion, corrupting_rage
4:41.631 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), maelstrom_weapon(3), hailstorm(8), ice_strike, sophic_devotion, corrupting_rage
4:42.694 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(4), sophic_devotion, corrupting_rage
4:43.757 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(6), sophic_devotion, corrupting_rage
4:44.821 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), hailstorm(6), sophic_devotion, corrupting_rage
4:45.885 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), hailstorm(6), sophic_devotion, corrupting_rage
4:46.949 Waiting     0.089s 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(3), sophic_devotion, corrupting_rage
4:47.038 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(3), sophic_devotion, corrupting_rage
4:48.544 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, maelstrom_weapon(4), sophic_devotion, corrupting_rage
4:49.820 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(7), sophic_devotion, corrupting_rage
4:51.095 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(9), ice_strike, sophic_devotion, forgestorm_ignited, corrupting_rage
4:52.371 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), hailstorm(9), ice_strike, forgestorm_ignited, corrupting_rage
4:53.610 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(3), forgestorm_ignited, corrupting_rage
4:54.848 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(5), maelstrom_weapon(3), forgestorm_ignited, corrupting_rage
4:56.086 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, maelstrom_weapon(4), forgestorm_ignited, corrupting_rage
4:57.325 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, maelstrom_weapon(5), forgestorm_ignited, corrupting_rage
4:58.562 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), hailstorm(5), forgestorm_ignited
4:59.801 default C potion Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon, forgestorm_ignited
5:00.000 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon, forgestorm_ignited, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 250000 250000 0
Spell Power 2280 6148 0
Crit 22.03% 15.82% 1047
Haste 17.84% 17.84% 3032
Versatility 3.93% 0.93% 191
Mana Regen 2560 2560 0
Attack Power 5440 5012 0
Mastery 58.69% 58.69% 3842
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +519 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [16]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement_Ele"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkESSSDlEAAAAAAAAAAAAAKRIJkQKiCJNAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
actions+=/primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
actions+=/call_action_list,name=funnel,if=active_enemies>1&rotation.funnel

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.funnel=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.funnel+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.funnel+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/windstrike,if=(talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1)|buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/stormstrike,if=buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&buff.crackling_thunder.up
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)|(talent.converging_storms.enabled&buff.converging_storms.stack<buff.converging_storms.max_stack)
actions.funnel+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.funnel+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.funnel+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.funnel+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.funnel+=/sundering
actions.funnel+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.funnel+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=3
actions.funnel+=/stormstrike,if=buff.crash_lightning.up&talent.deeply_rooted_elements.enabled
actions.funnel+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.funnel+=/windstrike
actions.funnel+=/stormstrike
actions.funnel+=/ice_strike
actions.funnel+=/lava_lash
actions.funnel+=/crash_lightning
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=2
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5
actions.funnel+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.funnel+=/flame_shock,if=!ticking
actions.funnel+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
actions.single+=/primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
actions.single+=/lava_lash,if=talent.lashing_flames.enabled
actions.single+=/ice_strike,if=!buff.ice_strike.up
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/ice_strike
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=action.sundering.cooldown
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1047
# gear_haste_rating=3032
# gear_mastery_rating=3842
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:
Total Events Processed: 243740448
Max Event Queue: 289
Sim Seconds: 2250297
CPU Seconds: 251.7641
Physical Seconds: 126.1316
Speed Up: 8938

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.94sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 183375 611 7.61 3660 7344 38.0 38.0 31.5% 0.0% 0.0% 0.0% 6.76sec 183375 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost antimagic_shell 48707 51056 170 0.64 16014 0 6.8 3.2 0.0% 0.0% 0.0% 0.0% 42.73sec 51056 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 145.20sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 807198 2691 38.75 3623 7251 193.8 193.8 31.3% 16.4% 0.0% 0.0% 1.80sec 1153169 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 393388 1311 37.86 1811 3627 189.3 189.3 31.4% 16.8% 0.0% 0.0% 1.80sec 561997 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost blood_draw 374606 30155 101 0.40 11516 23083 2.0 2.0 30.8% 0.0% 0.0% 0.0% 0.00sec 30155 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.60sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_damage 155166 3213131 10710 26.87 18221 36373 134.4 134.4 31.4% 0.0% 0.0% 0.0% 2.00sec 3213131 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 220759 736 0.56 60343 120648 3.0 2.8 31.6% 0.0% 0.0% 0.0% 119.66sec 220759 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay ticks -43265 35826 119 0.00 480 962 5.2 0.0 31.3% 0.0% 0.0% 0.0% 48.67sec 35826 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 369577 1232 1.66 33767 67542 8.3 8.3 31.5% 0.0% 0.0% 0.0% 29.32sec 527981 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 83.39sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 382154 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 786735 2622 19.74 6074 12124 60.3 98.7 31.4% 0.0% 0.0% 0.0% 4.95sec 786735 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 222026 764699 2549 8.75 13332 26574 43.7 43.7 31.4% 0.0% 0.0% 0.0% 4.93sec 764699 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 382725 1276 8.75 6665 13292 43.7 43.7 31.5% 0.0% 0.0% 0.0% 4.93sec 382725 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 76.50sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 2078847 6929 12.07 26221 52325 60.3 60.3 31.5% 0.0% 0.0% 0.0% 4.95sec 2078847 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 411147 1370 12.02 5205 10383 60.1 60.1 31.6% 0.0% 0.0% 0.0% 4.97sec 411147 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 415727 1386 9.40 6734 13489 47.0 47.0 31.2% 0.0% 0.0% 0.0% 6.28sec 593911 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 207725 692 9.40 3367 6744 47.0 47.0 31.1% 0.0% 0.0% 0.0% 6.28sec 296758 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1916209 6387 11.49 0 33354 57.5 57.5 100.0% 0.0% 0.0% 0.0% 5.15sec 1916209 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 958104 3194 11.49 0 16677 57.5 57.5 100.0% 0.0% 0.0% 0.0% 5.15sec 958104 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost overwhelming_rage ticks -374037 265279 884 3.95 13429 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 59.93sec 326693 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 35.91sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 304.81sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.50sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul auto_attack 0 283202 1743 35.69 2227 4467 96.6 96.6 31.4% 0.0% 0.0% 0.0% 2.85sec 404585 162.48sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 137665 847 19.48 1983 3972 52.8 52.8 31.5% 0.0% 0.0% 0.0% 5.30sec 196670 162.48sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 254 2 1.07 67 134 2.9 2.9 31.2% 0.0% 0.0% 0.0% 121.51sec 363 162.48sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 20.38sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1783398 5945 47.88 5672 11329 239.4 239.4 31.4% 0.0% 0.0% 0.0% 1.25sec 1783398 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 62392 208 4.08 2323 4647 20.4 20.4 31.5% 0.0% 0.0% 0.0% 14.27sec 89134 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 62706 209 4.10 2323 4646 20.5 20.5 31.6% 0.0% 0.0% 0.0% 14.16sec 89583 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.5 0.0 0.0% 0.0% 0.0% 0.0% 14.19sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy algethar_puzzle_box_channel 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy antimagic_shell 48707 48278 161 0.61 15824 0 7.0 3.1 0.0% 0.0% 0.0% 0.0% 45.42sec 48278 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 72456 242 1.36 8828 17667 6.8 6.8 20.3% 0.0% 0.0% 0.0% 46.26sec 72456 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 1249537 9453 117.40 4012 8027 258.6 258.6 20.4% 0.0% 0.0% 0.0% 4.33sec 1785098 132.19sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 298399 2257 86.19 1306 2611 189.9 189.9 20.3% 0.0% 0.0% 0.0% 5.97sec 426296 132.19sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_magus frostbolt 317792 195027 1475 9.00 8174 16336 19.8 19.8 20.4% 0.0% 0.0% 0.0% 14.91sec 195027 132.19sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_magus shadow_bolt 317791 620717 4696 28.42 8231 16463 62.6 62.6 20.4% 0.0% 0.0% 0.0% 4.53sec 620717 132.19sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1163796 19046 334.12 2841 5673 340.3 340.3 20.5% 0.0% 0.0% 0.0% 0.74sec 1662608 61.10sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 222970 3649 203.57 894 1782 207.3 207.3 20.5% 0.0% 0.0% 0.0% 1.33sec 318537 61.10sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_magus frostbolt 317792 84805 1413 8.00 8814 17491 8.0 8.0 20.6% 0.0% 0.0% 0.0% 31.09sec 84805 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_magus shadow_bolt 317791 390549 6509 35.76 9082 18079 35.8 35.8 20.5% 0.0% 0.0% 0.0% 6.33sec 390549 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 812425 2708 29.40 4589 9178 147.0 147.0 20.4% 0.0% 0.0% 0.0% 2.46sec 1160636 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.60sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy blood_draw 374606 28632 95 0.40 11787 23544 2.0 2.0 21.5% 0.0% 0.0% 0.0% 0.00sec 28632 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy clawing_shadows 207311 2365271 7884 14.20 27699 55316 71.0 71.0 20.3% 0.0% 0.0% 0.0% 4.10sec 2365271 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 46.16sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation_damage 344955 63125 210 1.39 7561 15150 0.0 6.9 20.2% 0.0% 0.0% 0.0% 0.00sec 63125 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_and_decay ticks -43265 81530 272 0.00 733 1465 8.5 0.0 20.4% 0.0% 0.0% 0.0% 36.35sec 81530 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 2196652 7322 19.27 18945 37891 96.4 96.3 20.4% 0.0% 0.0% 0.0% 3.08sec 2196652 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 647358 2158 27.39 4728 0 0.0 136.9 0.0% 0.0% 0.0% 0.0% 0.00sec 647358 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 223236 744 1.09 33982 67979 5.5 5.5 20.2% 0.0% 0.0% 0.0% 46.67sec 318917 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 168.46sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 469245 1564 4.54 17166 34297 22.7 22.7 20.4% 0.0% 0.0% 0.0% 13.23sec 670367 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 755384 2518 19.66 6382 12766 98.3 98.3 20.4% 0.0% 0.0% 0.0% 3.77sec 755384 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound_application 197147 0 0 0.00 0 0 102.0 0.0 0.0% 0.0% 0.0% 0.0% 5.28sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 382154 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 26156 87 2.32 1867 3734 11.6 11.6 20.5% 0.0% 0.0% 0.0% 27.01sec 26156 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak_aoe 196780 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 27.01sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy overwhelming_rage ticks -374037 263393 878 3.94 13373 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.36sec 322959 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 303.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul auto_attack 0 1642907 5476 37.20 7336 14703 186.0 186.0 20.3% 0.0% 0.0% 0.0% 1.61sec 2347069 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 598188 1994 12.59 7893 15786 62.9 62.9 20.4% 0.0% 0.0% 0.0% 4.66sec 598188 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 129734 432 7.86 2742 5480 39.3 39.3 20.4% 0.0% 0.0% 0.0% 7.74sec 185340 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 422 1 0.75 94 188 3.7 3.7 20.3% 0.0% 0.0% 0.0% 90.13sec 602 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 219512 732 3.08 11856 23734 15.4 15.4 20.2% 0.0% 0.0% 0.0% 6.95sec 219512 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 1017054 3390 3.08 54970 109957 15.4 15.4 20.1% 0.0% 0.0% 0.0% 6.95sec 1017054 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.21sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 903157 18063 32.54 27705 55270 27.1 27.1 20.3% 0.0% 0.0% 0.0% 7.85sec 903157 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 117455 392 0.73 26719 53645 3.6 3.6 20.6% 0.0% 0.0% 0.0% 91.71sec 117455 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 20.7 0.0 0.0% 0.0% 0.0% 0.0% 14.15sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 381660 1272 19.90 3182 6371 11.6 99.5 20.5% 0.0% 0.0% 0.0% 27.01sec 381660 300.00sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 594257 1981 4.19 25036 50201 21.0 21.0 13.2% 0.0% 0.0% 0.0% 14.28sec 1315482 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 721225 2404 12.99 9793 19640 21.0 65.0 13.3% 0.0% 0.0% 0.0% 14.28sec 1315482 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 85.9 0.0 0.0% 0.0% 0.0% 0.0% 3.41sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 803801 2679 7.16 19806 39695 35.8 35.8 13.3% 0.0% 0.0% 0.0% 8.44sec 803801 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 2002388 6675 35.35 9997 20034 176.8 176.8 13.3% 0.0% 0.0% 0.0% 1.68sec 2002388 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 18000 60 6.60 545 0 33.0 33.0 0.0% 0.0% 0.0% 0.0% 6.42sec 18000 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 257239 857 1.24 36271 73026 6.2 6.2 14.3% 0.0% 0.0% 0.0% 10.33sec 257239 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage 32409 129354 431 1.22 21195 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 10.33sec 133435 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowfiend 34433 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 313166 1044 16.00 3915 0 7.0 80.0 0.0% 0.0% 0.0% 0.0% 38.03sec 313166 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 602830 2009 25.57 4159 8335 13.5 127.8 13.3% 0.0% 0.0% 0.0% 21.05sec 602830 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 127.8 0.0 0.0% 0.0% 0.0% 0.0% 2.33sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_shadowfiend melee 0 146920 4198 56.57 3935 7873 33.0 33.0 13.1% 0.0% 0.0% 0.0% 6.42sec 146920 35.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement doom_winds 384352 30061 100 0.75 6661 13379 3.7 3.7 20.7% 0.0% 0.0% 0.0% 90.41sec 42945 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 307.91sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 15.5 0.0 0.0% 0.0% 0.0% 0.0% 20.41sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 97943 326 5.91 2747 5493 29.6 29.6 20.6% 0.0% 0.0% 0.0% 10.03sec 459270 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 361327 1204 36.85 1626 3253 29.6 184.2 20.6% 0.0% 0.0% 0.0% 10.03sec 459270 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 410464 1368 198.47 343 686 992.3 992.3 20.7% 0.0% 0.0% 0.0% 0.68sec 410464 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 369361 1231 5.67 10808 21616 28.3 28.3 20.6% 0.0% 0.0% 0.0% 7.71sec 369361 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 291486 972 2.85 16912 33889 14.3 14.3 20.7% 0.0% 0.0% 0.0% 19.36sec 291486 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 562270 1874 4.31 21687 43379 21.5 21.5 20.4% 0.0% 0.0% 0.0% 13.79sec 562270 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 528215 1761 4.01 21870 43765 20.0 20.0 20.5% 0.0% 0.0% 0.0% 14.71sec 528215 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 4135901 13786 13.64 50240 100631 68.2 68.2 20.7% 0.0% 0.0% 0.0% 4.37sec 4135901 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 1 536622 1789 38.69 2660 5322 193.5 193.5 20.6% 16.3% 0.0% 0.0% 1.81sec 766623 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 2 268944 896 38.71 1332 2664 193.6 193.6 20.7% 16.3% 0.0% 0.0% 1.80sec 384216 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement overwhelming_rage ticks -374037 260463 868 3.92 13283 0 4.0 19.6 0.0% 0.0% 0.0% 0.0% 60.12sec 265686 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.01sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 90.8 0.0 0.0% 0.0% 0.0% 0.0% 3.29sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 1579663 5266 24.19 10817 21673 120.9 120.9 20.7% 0.0% 0.0% 0.0% 2.46sec 2256720 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_mh 390287 363745 1212 10.51 6921 0 52.6 52.6 0.0% 0.0% 0.0% 0.0% 5.63sec 363745 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 789215 2631 24.19 5410 10822 120.9 120.9 20.6% 0.0% 0.0% 0.0% 2.46sec 1127479 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_offhand 390287 181565 605 10.51 3455 0 52.6 52.6 0.0% 0.0% 0.0% 0.0% 5.63sec 181565 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 293113 977 1.21 40256 80555 6.0 6.0 20.8% 0.0% 0.0% 0.0% 50.43sec 293113 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement tempest_strikes 428078 1132953 3777 32.50 5779 11570 162.5 162.5 20.6% 0.0% 0.0% 0.0% 1.84sec 1132953 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_totem 8512 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 114.09sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 2065827 6886 75.08 4555 9144 375.4 375.4 20.7% 0.0% 0.0% 0.0% 2.49sec 2951257 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 26467 430 37.92 564 1129 38.9 38.9 20.6% 0.0% 0.0% 0.0% 2.21sec 37811 61.52sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_spirit_wolf melee 0 907424 8003 202.87 1961 3926 383.4 383.4 20.6% 0.0% 0.0% 0.0% 1.56sec 1296353 113.38sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 311.18sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele elemental_blast 117014 3402118 11340 4.95 113343 226993 24.8 24.8 21.2% 0.0% 0.0% 0.0% 12.22sec 3402118 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele feral_spirit 51533 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 22.15sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock 188389 769172 2564 18.07 6999 14026 90.3 90.3 21.6% 0.0% 0.0% 0.0% 3.32sec 1755456 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock ticks -188389 986284 3288 39.20 4136 8284 90.3 196.0 21.6% 0.0% 0.0% 0.0% 3.32sec 1755456 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_attack 10444 289962 967 122.03 391 782 610.1 610.1 21.6% 0.0% 0.0% 0.0% 0.74sec 289962 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele forgestorm_ignited_damage 381700 380376 1268 5.79 10808 21616 29.0 29.0 21.5% 0.0% 0.0% 0.0% 7.57sec 380376 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele frost_shock 196840 1943291 6478 8.57 37272 74664 42.9 42.9 21.6% 0.0% 0.0% 0.0% 6.94sec 1943291 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele ice_strike 342240 720571 2402 4.83 24489 49046 24.2 24.2 21.8% 0.0% 0.0% 0.0% 12.54sec 720571 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lava_lash 60103 3775827 12586 14.72 42149 84415 73.6 73.6 21.6% 0.0% 0.0% 0.0% 4.05sec 3775827 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt 188196 1813244 6044 5.74 52005 103991 28.7 28.7 21.6% 0.0% 0.0% 0.0% 10.38sec 1813244 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele main_hand 1 542427 1808 38.80 2656 5316 194.0 194.0 21.6% 16.4% 0.0% 0.0% 1.80sec 774916 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele offhand 2 277733 926 39.63 1331 2665 198.2 198.2 21.7% 16.4% 0.0% 0.0% 1.76sec 396772 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele overwhelming_rage ticks -374037 262194 874 3.95 13283 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.10sec 267451 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 303.69sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave 375982 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 46.18sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave_damage 375984 330796 1103 1.40 38890 78129 7.0 7.0 21.7% 0.0% 0.0% 0.0% 46.18sec 330796 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt_pw 188196 789951 2633 1.39 93744 187401 6.9 6.9 21.7% 0.0% 0.0% 0.0% 45.77sec 789951 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike 17364 0 0 0.00 0 0 32.4 0.0 0.0% 0.0% 0.0% 0.0% 9.12sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_mh 32175 378620 1262 6.47 9610 19267 32.4 32.4 21.6% 0.0% 0.0% 0.0% 9.12sec 540900 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_offhand 32176 189357 631 6.47 4806 9626 32.4 32.4 21.7% 0.0% 0.0% 0.0% 9.12sec 270516 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_totem 8512 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 116.98sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_attack 25504 270035 900 23.96 1853 3710 119.8 119.8 21.6% 0.0% 0.0% 0.0% 5.14sec 385774 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_greater_earth_elemental melee 0 31897 500 41.70 592 1185 44.3 44.3 21.6% 0.0% 0.0% 0.0% 2.53sec 45569 63.74sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_lightning_wolf melee 0 287040 8212 206.44 1961 3929 120.3 120.3 21.6% 0.0% 0.0% 0.0% 2.69sec 410067 34.96sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_frost_wolf melee 0 287300 7164 180.08 1961 3928 120.4 120.4 21.6% 0.0% 0.0% 0.0% 2.68sec 410438 40.11sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_fiery_wolf melee 0 287490 7712 193.74 1962 3932 120.4 120.4 21.7% 0.0% 0.0% 0.0% 2.66sec 410710 37.28sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
232286.2 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.7 2.2 22.1s 18.6s 5.5s 23.18% 0.00% 2.2 (2.2) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.3s / 213.0s
  • trigger_min/max:1.2s / 213.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 26.0s
  • uptime_min/max:5.91% / 47.53%

Stack Uptimes

  • brittle_1:23.18%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.3 22.3s 18.7s 5.5s 23.24% 0.00% 2.3 (2.3) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 192.0s
  • trigger_min/max:3.0s / 192.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s
  • uptime_min/max:4.05% / 44.98%

Stack Uptimes

  • brittle_1:23.24%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 114.9 169.2s 2.6s 293.1s 98.53% 0.00% 105.8 (105.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.4s / 289.4s
  • trigger_min/max:0.0s / 14.9s
  • trigger_pct:100.00%
  • duration_min/max:2.1s / 355.6s
  • uptime_min/max:96.71% / 98.80%

Stack Uptimes

  • death_rot_1:0.28%
  • death_rot_2:0.29%
  • death_rot_3:0.68%
  • death_rot_4:0.50%
  • death_rot_5:1.07%
  • death_rot_6:0.64%
  • death_rot_7:0.54%
  • death_rot_8:0.54%
  • death_rot_9:0.53%
  • death_rot_10:93.47%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% from you for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 6.4 233.0 50.1s 1.3s 46.2s 98.39% 0.00% 176.7 (176.7) 5.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 245.1s
  • trigger_min/max:0.0s / 15.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 321.2s
  • uptime_min/max:94.77% / 100.00%

Stack Uptimes

  • everfrost_1:2.13%
  • everfrost_2:2.12%
  • everfrost_3:2.11%
  • everfrost_4:2.10%
  • everfrost_5:2.10%
  • everfrost_6:2.09%
  • everfrost_7:2.08%
  • everfrost_8:2.07%
  • everfrost_9:2.06%
  • everfrost_10:79.54%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 23.5 33.5 12.7s 5.3s 10.4s 81.14% 0.00% 1.8 (2.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 100.2s
  • trigger_min/max:0.0s / 30.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 96.1s
  • uptime_min/max:65.12% / 92.07%

Stack Uptimes

  • festering_wound_1:23.45%
  • festering_wound_2:26.12%
  • festering_wound_3:17.99%
  • festering_wound_4:7.63%
  • festering_wound_5:3.32%
  • festering_wound_6:2.62%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 72.6 3.6s 4.0s 296.7s 98.89% 99.05% 72.6 (72.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.6s / 3.6s
  • trigger_min/max:0.8s / 16.2s
  • trigger_pct:100.00%
  • duration_min/max:236.4s / 357.8s
  • uptime_min/max:98.21% / 99.50%

Stack Uptimes

  • lashing_flames_1:98.89%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.1 59.0 189.9s 5.0s 278.5s 99.11% 0.00% 54.8 (54.8) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 350.1s
  • trigger_min/max:0.9s / 45.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 357.9s
  • uptime_min/max:91.86% / 99.43%

Stack Uptimes

  • razorice_1:1.09%
  • razorice_2:0.88%
  • razorice_3:0.80%
  • razorice_4:0.93%
  • razorice_5:95.41%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Rotten Touch 11.9 7.7 25.2s 15.0s 13.5s 53.50% 0.00% 7.7 (7.7) 11.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rotten_touch
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.4s / 108.7s
  • trigger_min/max:0.8s / 58.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.1s
  • uptime_min/max:32.95% / 80.26%

Stack Uptimes

  • rotten_touch_1:53.50%

Spelldata

  • id:390276
  • name:Rotten Touch
  • tooltip:Scourge Strike damage taken from {$@=}auracaster is increased by {$s1=50}%.
  • description:{$@spelldesc390275=Sudden Doom causes your next Death Coil to also increase your {$?s207311=true}[Clawing Shadows][Scourge Strike] damage against the target by {$390276s1=50}% for {$390276d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 235789.48
Minimum 217577.81
Maximum 259251.17
Spread ( max - min ) 41673.36
Range [ ( max - min ) / 2 * 100% ] 8.84%
Standard Deviation 5244.9527
5th Percentile 227469.87
95th Percentile 244615.58
( 95th Percentile - 5th Percentile ) 17145.71
Mean Distribution
Standard Deviation 60.5675
95.00% Confidence Interval ( 235670.77 - 235908.19 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1901
0.1 Scale Factor Error with Delta=300 234838
0.05 Scale Factor Error with Delta=300 939349
0.01 Scale Factor Error with Delta=300 23483717
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3708
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 55990261 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.