SimulationCraft 1025-01

for World of Warcraft 10.2.5.53262 Live (hotfix 2024-02-15/53262, git build 68fdaaa2c6)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 51544 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
51543.5 51543.5 56.0 / 0.109% 9560.4 / 18.5% 4033.7
APS APS Error APS Range APR
172.2 3.9 / 2.250% 445.0 / 258.4% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.4 12.7 Runic Power 2.37% 54.3 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 51544
Abomination Limb 0 (616) 0.0% (1.2%) 3.0 120.93s 61528 49838

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 1.2348 0.0000 0.00 0.00 0.00% 49838.15 49838.15

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [f]:0.13
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
    cooldowns
    [g]:2.85
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
    Abomination Limb (_damage) 616 1.2% 38.0 6.76s 4814 0 Direct 38.0 3656 7335 4814 31.5% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.04 38.04 0.00 0.00 0.00 0.0000 0.0000 183155.19 183155.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.52% 26.07 10 36 3656.05 2460 7080 3658.92 3028 4524 95302 95302 0.00%
crit 31.48% 11.98 2 24 7335.25 4878 13991 7337.71 5423 9982 87854 87854 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
auto_attack_mh 2698 5.2% 193.8 1.80s 4172 2325 Direct 193.8 3622 7252 4172 31.5% 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.78 193.78 0.00 0.00 0.00 1.7943 0.0000 808425.58 1154923.14 30.00% 2325.13 2325.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.20% 101.15 61 144 3622.03 2527 7436 3622.76 3374 3966 366379 523413 30.00%
crit 31.45% 60.95 35 92 7252.32 5053 14872 7251.99 6439 8067 442046 631511 30.00%
miss 16.35% 31.67 13 58 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1313 2.5% 189.4 1.80s 2077 1158 Direct 189.4 1811 3625 2077 31.4% 16.8%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 189.41 189.41 0.00 0.00 0.00 1.7940 0.0000 393362.74 561961.09 30.00% 1157.64 1157.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.82% 98.15 55 142 1810.68 1263 3718 1810.95 1658 1975 177721 253894 30.00%
crit 31.41% 59.48 29 98 3625.19 2527 7436 3624.98 3242 4076 215642 308067 30.00%
miss 16.77% 31.77 12 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 103 0.2% 2.0 0.00s 15236 0 Direct 2.0 11527 23117 15235 32.0% 0.0%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 30475.23 30475.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.00% 1.36 0 3 11526.52 10395 18756 10358.88 0 17698 15678 15678 0.00%
crit 32.00% 0.64 0 2 23117.20 20789 36332 12472.87 0 36332 14797 14797 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Breath of Sindragosa 0 (10739) 0.0% (20.8%) 2.9 120.57s 1088929 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [j]:2.95
  • if_expr:!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
    Breath of Sindragosa (_damage) 10739 20.8% 134.2 2.00s 23911 0 Direct 134.2 18212 36350 23911 31.4% 0.0%

Stats Details: Breath Of Sindragosa Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 134.23 134.23 0.00 0.00 0.00 0.0000 0.0000 3209427.96 3209427.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.58% 92.05 33 139 18212.21 9604 41487 18246.61 16202 21534 1676514 1676514 0.00%
crit 31.42% 42.17 13 72 36349.82 19207 82032 36413.46 31675 42840 1532914 1532914 0.00%

Action Details: Breath Of Sindragosa Damage

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Burnout Wave 734 1.4% 3.0 119.64s 74595 0 Direct 2.8 60475 120423 79240 31.3% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 2.78 0.00 0.00 0.00 0.0000 0.0000 220364.42 220364.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.71% 1.91 0 3 60475.22 22015 69346 57738.79 0 69346 115564 115564 0.00%
crit 31.29% 0.87 0 3 120423.32 44029 138692 77569.86 0 138692 104800 104800 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 120 0.2% 5.2 48.63s 6824 5989 Periodic 56.8 480 961 630 31.2% 0.0% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.24 0.00 0.00 56.81 0.00 1.1394 0.0000 35786.10 35786.10 0.00% 5989.31 5989.31
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.84% 39.10 6 82 480.16 312 952 483.95 402 697 18776 18776 0.00%
crit 31.16% 17.70 2 46 960.88 625 1905 968.30 751 1465 17010 17010 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    breath
    [X]:5.24
  • if_expr:talent.unholy_ground&!death_and_decay.ticking&runic_power.deficit>=10|runic_power<36&rune.time_to_2>runic_power%18

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Dragon Games Equipment 1025 2.0% 6.9 29.31s 44248 0 Direct 6.9 33773 67516 44281 31.1% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.95 6.94 0.00 0.00 0.00 0.0000 0.0000 307473.02 439258.37 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.86% 4.78 0 9 33772.82 33171 34829 33737.67 0 34829 161483 230695 29.95%
crit 31.14% 2.16 0 9 67516.49 66341 69658 61086.64 0 69658 145990 208563 27.13%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 2623 5.1% 60.3 4.95s 13041 0 Periodic 98.7 6074 12117 7974 31.4% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.35 0.00 98.70 98.70 59.34 0.0000 2.9998 786990.33 786990.33 0.00% 2658.10 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.56% 67.67 43 97 6073.83 196 14969 6073.99 5461 6659 410999 410999 0.00%
crit 31.44% 31.03 12 55 12116.92 490 30275 12115.95 10325 14904 375991 375991 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.33
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountFrost Death Knight1370065PCT0.280
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Frost Strike 2542 (3813) 5.0% (7.4%) 43.8 4.94s 26250 19668 Direct 43.8 (87.5) 13334 26606 17506 31.4% (31.4%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.77 43.77 0.00 0.00 0.00 1.3346 0.0000 766271.82 766271.82 0.00% 19668.47 19668.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.56% 30.01 12 61 13334.04 8141 26383 13314.80 11258 14752 400161 400161 0.00%
crit 31.44% 13.76 3 31 26605.63 16283 51310 26552.31 21314 31873 366111 366111 0.00%

Action Details: Frost Strike

  • id:222026
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}

Action Priority List

    high_prio_actions
    [m]:2.45
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [o]:29.72
  • if_expr:buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
    single_target
    [r]:4.02
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [v]:7.57
  • if_expr:!variable.pooling_runic_power

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountImproved Frost Strike3168031PCT0.200
    Frost Strike Off-Hand 1270 2.5% 43.8 4.94s 8744 0 Direct 43.8 6670 13290 8744 31.3% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.77 43.77 0.00 0.00 0.00 0.0000 0.0000 382721.01 382721.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.68% 30.06 10 59 6669.82 4071 13191 6659.66 5889 7441 200495 200495 0.00%
crit 31.32% 13.71 2 32 13290.45 8141 24098 13262.73 10290 16107 182226 182226 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Frost Strike3168031PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Howling Blast 6945 (8316) 13.5% (16.1%) 60.3 4.95s 41238 34421 Direct 60.3 (120.4) 26216 52363 34442 31.5% (31.4%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.35 60.35 0.00 0.00 0.00 1.1981 0.0000 2078513.71 2078513.71 0.00% 34421.06 34421.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.54% 41.36 21 63 26215.79 4280 62655 26221.08 22574 30003 1084376 1084376 0.00%
crit 31.46% 18.99 6 34 52363.01 8560 119969 52370.54 39092 68519 994138 994138 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [T]:37.85
  • if_expr:variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
    breath
    [Y]:0.62
  • if_expr:runic_power<36&rune.time_to_2>runic_power%18
    breath
    [a]:0.17
  • if_expr:buff.rime.react
    single_target
    [q]:21.70
  • if_expr:buff.rime.react&talent.icebreaker.rank=2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Rime5905223.000Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Percent Cost Rime590521-1.000Spell Data
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
    Avalanche 1371 2.7% 60.1 4.97s 6827 0 Direct 60.1 5203 10386 6827 31.3% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.09 60.09 0.00 0.00 0.00 0.0000 0.0000 410197.46 410197.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.67% 41.26 19 62 5202.90 2842 12279 5204.35 4541 6139 214661 214661 0.00%
crit 31.33% 18.83 4 39 10385.81 5685 24835 10388.73 8383 12996 195537 195537 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Obliterate 1384 (11669) 2.7% (22.6%) 46.9 6.27s 74490 27624 Direct 46.9 (208.8) 6733 13488 8834 31.1% (69.1%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.94 46.94 0.00 0.00 0.00 2.6966 0.0000 414689.44 592428.59 30.00% 27624.19 27624.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.90% 32.34 13 57 6733.37 4477 13813 6740.82 5858 7837 217770 311108 30.00%
crit 31.10% 14.60 2 32 13488.27 8954 27625 13484.86 10274 18398 196919 281320 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]

Action Priority List

    breath
    [V]:24.77
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [W]:29.76
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Z]:5.09
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [p]:27.05
  • if_expr:buff.killing_machine.react
    single_target
    [s]:17.75
  • if_expr:!variable.pooling_runes

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
    Obliterate Off-Hand 693 1.3% 46.9 6.27s 4422 0 Direct 46.9 3366 6745 4422 31.2% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.94 46.94 0.00 0.00 0.00 0.0000 0.0000 207579.05 296549.06 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.76% 32.27 13 54 3366.41 2238 6906 3369.87 2954 3894 108651 155219 30.00%
crit 31.24% 14.67 2 34 6745.29 4477 13813 6747.24 5286 9462 98928 141330 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
    Obliterate (_km) 6395 12.4% 57.5 5.16s 33340 0 Direct 57.5 0 33340 33340 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.48 57.48 0.00 0.00 0.00 0.0000 0.0000 1916267.53 1916267.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 57.48 33 84 33340.36 18680 81609 33319.37 28895 37150 1916268 1916268 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
    Obliterate Off-Hand (_km) 3197 6.2% 57.5 5.16s 16670 0 Direct 57.5 0 16670 16670 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.48 57.48 0.00 0.00 0.00 0.0000 0.0000 958133.76 958133.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 57.48 33 84 16670.18 9340 40804 16659.68 14447 18575 958134 958134 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Raise Dead 0 (1405) 0.0% (2.7%) 3.0 121.51s 142414 0

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [k]:2.96
    auto_attack 1748  / 945 1.8% 96.6 2.85s 2932 1930 Direct 96.6 2227 4464 2932 31.5% 0.0%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.64 96.64 0.00 0.00 0.00 1.5187 0.0000 283321.19 404754.87 30.00% 1930.47 1930.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.49% 66.19 38 90 2226.97 1426 4400 2230.06 2015 2550 147402 210580 30.00%
crit 31.51% 30.45 12 53 4463.81 2852 8801 4470.16 3650 5239 135919 194175 30.00%

Action Details: Auto Attack

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:2.92
    Claw 849  / 459 0.9% 52.8 5.31s 2607 2607 Direct 52.8 1981 3974 2607 31.4% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.77 52.77 0.00 0.00 0.00 1.0000 0.0000 137551.17 196506.68 30.00% 2606.57 2606.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.62% 36.21 18 51 1981.17 1284 3960 1983.57 1725 2299 71739 102486 30.00%
crit 31.38% 16.56 4 31 3973.87 2567 7921 3977.94 3192 4997 65813 94020 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.77
  • if_expr:energy>70
    Gnaw 2  / 1 0.0% 2.9 121.52s 88 88 Direct 2.9 67 133 88 31.3% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.90 2.90 0.00 0.00 0.00 1.0000 0.0000 254.31 363.32 30.00% 87.60 87.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.65% 1.99 0 3 66.70 45 111 64.31 0 103 133 190 28.91%
crit 31.35% 0.91 0 3 133.34 91 216 88.82 0 214 121 173 19.98%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.90
Remorseless Winter 0 (5954) 0.0% (11.6%) 15.2 20.38s 117089 93637

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.23 0.00 0.00 0.00 0.00 1.2505 0.0000 0.00 0.00 0.00% 93636.71 93636.71

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    high_prio_actions
    [n]:15.23
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5954 11.6% 239.4 1.25s 7451 0 Direct 239.4 5671 11336 7451 31.4% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 239.40 239.40 0.00 0.00 0.00 0.0000 0.0000 1783685.72 1783685.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.58% 164.18 109 226 5670.63 1254 17533 5671.54 4843 6613 930985 930985 0.00%
crit 31.42% 75.22 38 111 11336.33 2508 35066 11338.35 9161 13590 852701 852701 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Periodic AmountBiting Cold3770562PCT0.350
Spell Direct AmountBiting Cold3770563PCT0.350

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Gathering Storm21180510.100Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Everfrost37697410.060
Brittle37455710.060
Strike Twice 208 0.4% 20.5 14.24s 3051 0 Direct 20.5 2323 4646 3051 31.3% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.47 20.47 0.00 0.00 0.00 0.0000 0.0000 62472.80 89249.13 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.66% 14.06 3 30 2323.24 2296 2411 2323.22 2296 2373 32657 46654 30.00%
crit 31.34% 6.42 0 19 4646.21 4593 4822 4636.31 0 4822 29816 42595 29.94%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 208 0.4% 20.5 14.26s 3053 0 Direct 20.5 2323 4646 3053 31.4% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.46 20.46 0.00 0.00 0.00 0.0000 0.0000 62463.23 89235.46 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.57% 14.03 3 30 2323.34 2296 2411 2323.22 2296 2373 32591 46560 30.00%
crit 31.43% 6.43 0 19 4646.41 4593 4822 4641.37 0 4822 29872 42675 29.97%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Frost 0
Anti-Magic Shell 172 100.0% 6.8 42.74s 7624 0 Direct 3.2 16014 0 16014 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.77 3.22 0.00 0.00 0.00 0.0000 0.0000 51632.65 51632.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.22 0 14 16013.62 16014 16014 13871.78 0 16014 51633 51633 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [l]:6.77
  • if_expr:runic_power.deficit>40&death_knight.first_ams_cast<time

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownAnti-Magic Barrier2057271ADD-20000.000
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Arcane Torrent 1.9 146.59s

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.93 0.00 0.00 0.00 0.00 1.2577 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [b]:0.87
  • if_expr:runic_power<60
    single_target
    [u]:1.06
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 4.0 83.19s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [d]:0.30
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
    cooldowns
    [e]:3.66
  • if_expr:buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929621SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929631SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382154
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 3.9 77.95s

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.87 0.00 0.00 0.00 0.00 1.1699 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [U]:3.01
  • if_expr:rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
    single_target
    [t]:0.86
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Pillar of Frost 8.7 35.93s

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.70 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [h]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [i]:8.38
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Elemental Potion of Ultimate Power 1.5 304.76s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [c]:1.45
  • if_expr:(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
Unholy Strength 20.5 14.26s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.9s 120.9s 11.8s 11.80% 0.00% 32.2 (32.2) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 123.8s
  • trigger_min/max:120.0s / 123.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:9.80% / 14.21%

Stack Uptimes

  • abomination_limb_1:11.80%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Anti-Magic Shell 6.8 0.0 42.7s 42.7s 6.9s 15.59% 18.85% 0.0 (0.0) 6.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.40
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 97.8s
  • trigger_min/max:40.0s / 97.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:11.20% / 18.04%

Stack Uptimes

  • antimagic_shell_1:15.59%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 10.6 37.3 29.1s 6.2s 18.8s 66.25% 0.00% 0.0 (0.0) 3.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 71.9s
  • trigger_min/max:0.9s / 44.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.8s
  • uptime_min/max:49.76% / 82.22%

Stack Uptimes

  • bonegrinder_crit_1:17.19%
  • bonegrinder_crit_2:14.91%
  • bonegrinder_crit_3:12.89%
  • bonegrinder_crit_4:11.34%
  • bonegrinder_crit_5:9.91%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 6.0 0.0 48.8s 48.8s 9.8s 19.58% 16.57% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.2s / 225.3s
  • trigger_min/max:16.2s / 225.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.91% / 31.91%

Stack Uptimes

  • bonegrinder_frost_1:19.58%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 3.0 14.7 120.5s 15.0s 19.4s 19.24% 0.00% 2.0 (2.0) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 125.8s
  • trigger_min/max:0.0s / 115.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:16.14% / 22.68%

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.88%
  • bound_by_fire_and_blaze_2:4.36%
  • bound_by_fire_and_blaze_3:4.21%
  • bound_by_fire_and_blaze_4:3.68%
  • bound_by_fire_and_blaze_5:2.75%
  • bound_by_fire_and_blaze_6:3.37%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.6s 120.6s 45.5s 44.83% 0.00% 133.9 (133.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 125.2s
  • trigger_min/max:120.0s / 125.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 105.0s
  • uptime_min/max:22.83% / 68.55%

Stack Uptimes

  • breath_of_sindragosa_1:44.83%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.2s 58.5s 50.3s 80.23% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 349.0s
  • trigger_min/max:15.0s / 309.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.0s
  • uptime_min/max:46.95% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.23%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dragon Games Equipment 2.8 0.0 120.5s 120.5s 0.7s 0.69% 0.00% 6.9 (6.9) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.87
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 125.7s
  • trigger_min/max:120.0s / 125.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.9s
  • uptime_min/max:0.46% / 0.98%

Stack Uptimes

  • dragon_games_equipment_1:0.69%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 304.8s 304.8s 27.1s 12.87% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.4s
  • trigger_min/max:300.0s / 329.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.74% / 17.93%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.87%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 83.5s 83.1s 19.6s 25.88% 0.00% 11.6 (11.6) 3.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 291.8s
  • trigger_min/max:0.0s / 291.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.4s
  • uptime_min/max:17.12% / 30.20%

Stack Uptimes

  • empower_rune_weapon_1:25.88%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 8.4 0.0 35.9s 35.9s 12.7s 35.39% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.8s / 51.4s
  • trigger_min/max:26.8s / 51.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s
  • uptime_min/max:23.72% / 47.11%

Stack Uptimes

  • enduring_strength_1:35.39%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 8.6 21.0 36.2s 9.8s 10.0s 28.68% 98.93% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:22.8s / 111.2s
  • trigger_min/max:0.9s / 103.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:14.56% / 36.24%

Stack Uptimes

  • enduring_strength_builder_1:10.28%
  • enduring_strength_builder_2:8.84%
  • enduring_strength_builder_3:5.52%
  • enduring_strength_builder_4:2.59%
  • enduring_strength_builder_5:1.03%
  • enduring_strength_builder_6:0.33%
  • enduring_strength_builder_7:0.07%
  • enduring_strength_builder_8:0.01%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storm 12.8 123.5 24.4s 2.2s 15.5s 66.15% 85.81% 70.8 (110.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 105.4s
  • trigger_min/max:0.9s / 34.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 95.7s
  • uptime_min/max:53.45% / 76.05%

Stack Uptimes

  • gathering_storm_1:2.47%
  • gathering_storm_2:5.48%
  • gathering_storm_3:4.78%
  • gathering_storm_4:3.95%
  • gathering_storm_5:5.15%
  • gathering_storm_6:3.67%
  • gathering_storm_7:3.66%
  • gathering_storm_8:2.79%
  • gathering_storm_9:2.22%
  • gathering_storm_10:31.98%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 1.0 176.7 150.9s 1.7s 292.0s 97.95% 0.00% 174.6 (174.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:89.0s / 243.8s
  • trigger_min/max:1.0s / 14.2s
  • trigger_pct:100.00%
  • duration_min/max:10.2s / 354.8s
  • uptime_min/max:95.89% / 98.58%

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.26%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 45.3 14.4 6.6s 5.0s 2.4s 35.80% 55.06% 1.9 (1.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 53.3s
  • trigger_min/max:0.0s / 41.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.4s
  • uptime_min/max:17.68% / 59.80%

Stack Uptimes

  • killing_machine_1:30.16%
  • killing_machine_2:5.64%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 8.7 0.0 35.9s 35.9s 11.8s 34.16% 36.11% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.8s / 51.4s
  • trigger_min/max:26.8s / 51.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:29.66% / 38.57%

Stack Uptimes

  • pillar_of_frost_1:34.16%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 8.7 57.9 36.0s 4.3s 11.4s 33.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:25.4s / 51.4s
  • trigger_min/max:0.9s / 40.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:26.76% / 37.29%

Stack Uptimes

  • pillar_of_frost_bonus_1:1.91%
  • pillar_of_frost_bonus_2:3.25%
  • pillar_of_frost_bonus_3:3.48%
  • pillar_of_frost_bonus_4:2.86%
  • pillar_of_frost_bonus_5:3.41%
  • pillar_of_frost_bonus_6:3.25%
  • pillar_of_frost_bonus_7:2.92%
  • pillar_of_frost_bonus_8:2.71%
  • pillar_of_frost_bonus_9:1.95%
  • pillar_of_frost_bonus_10:1.36%
  • pillar_of_frost_bonus_11:1.15%
  • pillar_of_frost_bonus_12:1.01%
  • pillar_of_frost_bonus_13:0.92%
  • pillar_of_frost_bonus_14:0.84%
  • pillar_of_frost_bonus_15:0.64%
  • pillar_of_frost_bonus_16:0.46%
  • pillar_of_frost_bonus_17:0.31%
  • pillar_of_frost_bonus_18:0.21%
  • pillar_of_frost_bonus_19:0.18%
  • pillar_of_frost_bonus_20:0.14%
  • pillar_of_frost_bonus_21:0.07%
  • pillar_of_frost_bonus_22:0.02%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 12.9 2.4 24.4s 20.4s 17.4s 74.84% 0.00% 220.1 (220.1) 12.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 102.4s
  • trigger_min/max:20.0s / 27.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 97.8s
  • uptime_min/max:65.21% / 83.16%

Stack Uptimes

  • remorseless_winter_1:74.84%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 60.5 10.9 5.0s 4.2s 2.0s 39.80% 99.56% 10.9 (10.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 52.5s
  • trigger_min/max:0.0s / 52.5s
  • trigger_pct:63.12%
  • duration_min/max:0.0s / 33.5s
  • uptime_min/max:24.56% / 56.48%

Stack Uptimes

  • rime_1:39.80%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.5 14.2 22.3s 10.6s 11.8s 52.98% 0.00% 14.2 (14.2) 13.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 151.2s
  • trigger_min/max:0.9s / 120.0s
  • trigger_pct:14.98%
  • duration_min/max:0.0s / 78.2s
  • uptime_min/max:21.15% / 80.79%

Stack Uptimes

  • rune_mastery_1:52.98%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.6 23.2s 14.3s 10.1s 43.42% 42.22% 7.6 (7.6) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 82.1s
  • trigger_min/max:0.0s / 62.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.2s
  • uptime_min/max:23.97% / 73.04%

Stack Uptimes

  • rune_of_hysteria_1:43.42%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Ground 5.1 0.2 50.1s 48.4s 10.0s 17.01% 0.00% 0.2 (0.2) 4.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 275.6s
  • trigger_min/max:1.2s / 275.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.4s
  • uptime_min/max:4.15% / 33.94%

Stack Uptimes

  • unholy_ground_1:17.01%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 12.0 36.0s 14.2s 23.7s 66.63% 0.00% 12.0 (12.0) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 190.3s
  • trigger_min/max:0.0s / 64.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 186.6s
  • uptime_min/max:44.25% / 93.61%

Stack Uptimes

  • unholy_strength_1:66.63%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 1.0 176.7 150.9s 1.7s 292.0s 97.95% 0.00% 174.6 (174.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:89.0s / 243.8s
  • trigger_min/max:1.0s / 14.2s
  • trigger_pct:100.00%
  • duration_min/max:10.2s / 354.8s
  • uptime_min/max:95.89% / 98.58%

Stack Uptimes

  • unleashed_frenzy_1:0.34%
  • unleashed_frenzy_2:0.34%
  • unleashed_frenzy_3:97.26%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=10 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (sizzling_seafood_medley)

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_sizzling_seafood_medley
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382154
  • name:Well Fed
  • tooltip:Haste and mastery increased by {$=}w1.
  • description:Increases Haste and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 27.0 9.0 47.0 10.8s 1.2s 120.0s
Windfury (Off Hand) 22.7 8.0 45.0 12.8s 1.2s 155.4s
Killing Machine spent on Obliterate 57.5 33.0 84.0 5.2s 0.9s 41.5s
Killing Machine: Critical auto attacks 57.9 34.0 84.0 5.5s 1.2s 41.2s
Killing Machine wasted: Critical auto attacks 1.9 0.0 11.0 63.3s 1.2s 323.3s
Rune ready 225.8 163.0 281.0 1.5s 0.0s 12.9s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.56% 0.00% 7.94% 0.7s 0.0s 7.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Horn of Winter29.6020.000247.679136.24760.015301.208
Remorseless Winter0.3440.0007.5065.2540.87814.628
Death and Decay19.9230.000233.964151.18130.528297.824
Empower Rune Weapon1.3610.00079.7575.3764.11784.912
Abomination Limb0.9670.0003.7632.8851.0286.914
Pillar of Frost1.3620.0008.13711.8645.45823.775
Breath of Sindragosa2.1040.0006.1866.2074.12010.929
Raise Dead1.6960.0004.4315.0232.3689.173
Anti-Magic Shell6.9350.00057.79047.50421.63298.647

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=452892)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0711.400 / 1.1643.83023.118
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
14.20046.09184.540 / 82.214129.728208.387

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Anti-Magic ShellRunic Power3.2215.690.41%4.870.432.68%
Breath of SindragosaRune11.1210.764.77%0.970.363.23%
Empower Rune WeaponRunic Power19.1889.672.35%4.676.256.52%
Empower Rune WeaponRune19.1819.008.41%0.990.190.97%
Frost FeverRunic Power32.75156.434.11%4.787.314.46%
Horn of WinterRunic Power3.8796.832.54%25.000.000.00%
Horn of WinterRune7.757.753.43%1.000.000.00%
Murderous EfficiencyRune28.7528.7512.73%1.000.000.00%
Rage of the Frozen ChampionRunic Power60.09472.9212.41%7.877.761.61%
Rune RegenerationRune85.8585.8538.01%1.000.000.00%
Rune of HysteriaRunic Power159.18326.618.57%2.0525.447.23%
Runic AttenuationRunic Power72.17349.579.18%4.8411.303.13%
Runic EmpowermentRune74.3673.7332.65%0.990.630.85%
Arcane TorrentRunic Power1.9338.601.01%20.000.000.00%
Death and DecayRunic Power5.2452.441.38%10.000.000.00%
Howling BlastRunic Power60.352.640.07%0.040.000.00%
ObliterateRunic Power104.422061.0954.10%19.7427.281.31%
Remorseless WinterRunic Power15.23147.283.87%9.675.053.32%
pet - ghoul
Energy RegenEnergy1091.211953.72100.00%1.79167.047.88%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_damage)Runic Power 133.902410.1564.73%18.0017.961331.63
Death and DecayRune 5.245.242.28%1.001.006823.90
Frost StrikeRunic Power 43.771313.1035.27%30.0030.00875.02
Howling BlastRune 60.350.260.11%0.000.009437726.23
ObliterateRune 104.42208.8490.97%2.004.4516743.52
Remorseless WinterRune 15.2315.236.64%1.001.00117089.16
pet - ghoul
ClawEnergy 52.772110.89100.00%40.0040.0065.16
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 330760.0 756.61 877.58 260171.7 294470.3 -46999.9 330760.0
Runic Power 0.0 12.70 12.41 90.8 86.5 0.4 124.0
Rune 6.0 0.75 0.77 0.0 2.3 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 51543.50
Minimum 43191.41
Maximum 61665.21
Spread ( max - min ) 18473.80
Range [ ( max - min ) / 2 * 100% ] 17.92%
Standard Deviation 2475.7638
5th Percentile 47556.24
95th Percentile 55729.95
( 95th Percentile - 5th Percentile ) 8173.72
Mean Distribution
Standard Deviation 28.5896
95.00% Confidence Interval ( 51487.47 - 51599.54 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 89
0.1% Error 8863
0.1 Scale Factor Error with Delta=300 52325
0.05 Scale Factor Error with Delta=300 209297
0.01 Scale Factor Error with Delta=300 5232414
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 51543.50
Minimum 43191.41
Maximum 61665.21
Spread ( max - min ) 18473.80
Range [ ( max - min ) / 2 * 100% ] 17.92%
Standard Deviation 2475.7638
5th Percentile 47556.24
95th Percentile 55729.95
( 95th Percentile - 5th Percentile ) 8173.72
Mean Distribution
Standard Deviation 28.5896
95.00% Confidence Interval ( 51487.47 - 51599.54 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 89
0.1% Error 8863
0.1 Scale Factor Error with Delta=300 52325
0.05 Scale Factor Error with Delta=300 209297
0.01 Scale Factor Error with Delta=300 5232414
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 51543.50
Minimum 43191.41
Maximum 61665.21
Spread ( max - min ) 18473.80
Range [ ( max - min ) / 2 * 100% ] 17.92%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 15018456.10
Minimum 10343667.13
Maximum 19115939.16
Spread ( max - min ) 8772272.04
Range [ ( max - min ) / 2 * 100% ] 29.20%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 877.43
Minimum 0.00
Maximum 2452.23
Spread ( max - min ) 2452.23
Range [ ( max - min ) / 2 * 100% ] 139.74%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 755.25
Minimum 0.00
Maximum 1915.57
Spread ( max - min ) 1915.57
Range [ ( max - min ) / 2 * 100% ] 126.82%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
B 0.00 variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
E 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
F 0.00 variable,name=2h_check,value=main_hand.2h
G 0.00 variable,name=erw_pooling_time,op=setif,value=30,value_else=45,condition=death_knight.ams_absorb_percent>0.59
Protects Breath from starving itself on ERW charges depending on anticipated resource gains. More resources enable more aggressive use.
Default action list Executed every time the actor is available.
# count action,conditions
H 1.00 auto_attack
I 0.00 call_action_list,name=variables
Choose Action list to run
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=high_prio_actions
L 0.00 call_action_list,name=cooldowns
M 0.00 call_action_list,name=racials
N 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
O 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
P 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
Q 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
R 0.00 call_action_list,name=aoe,if=active_enemies>=2
S 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
T 37.85 howling_blast,if=variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
Breath Active Rotation
U 3.01 horn_of_winter,if=rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
V 24.77 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&(buff.killing_machine.react|runic_power>45)
W 29.76 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up
0.00 remorseless_winter,if=runic_power<36&rune.time_to_2>runic_power%18
X 5.24 death_and_decay,if=talent.unholy_ground&!death_and_decay.ticking&runic_power.deficit>=10|runic_power<36&rune.time_to_2>runic_power%18
Y 0.62 howling_blast,if=runic_power<36&rune.time_to_2>runic_power%18
Z 5.09 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
a 0.17 howling_blast,if=buff.rime.react
b 0.87 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
c 1.45 potion,if=(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
Cooldowns
d 0.30 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
e 3.66 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
f 0.13 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
g 2.85 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=set_bonus.tier31_2pc&buff.chilling_rage.remains<3
0.00 chill_streak,if=!set_bonus.tier31_2pc&active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
h 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
i 8.38 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
j 2.95 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
k 2.96 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react&rune>2|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>50|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.high_prio_actions
# count action,conditions
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
l 6.77 antimagic_shell,if=runic_power.deficit>40&death_knight.first_ams_cast<time
0.00 antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.ready|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up))
0.00 antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&((!talent.obliteration|talent.obliteration&(!cooldown.pillar_of_frost.ready|buff.pillar_of_frost.up&!buff.killing_machine.react))|(equipped.fyralath_the_dreamrender&!dot.mark_of_fyralath.ticking))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
m 2.45 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
n 15.23 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target
# count action,conditions
o 29.72 frost_strike,if=buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
Single Target Rotation
0.00 howling_blast,if=buff.rime.react&set_bonus.tier30_2pc&buff.killing_machine.stack<2
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
p 27.05 obliterate,if=buff.killing_machine.react
q 21.70 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)&talent.obliteration&talent.breath_of_sindragosa
r 4.02 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
s 17.75 obliterate,if=!variable.pooling_runes
t 0.86 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
u 1.06 arcane_torrent,if=runic_power.deficit>20
v 7.57 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.pillar_of_frost.up&!buff.empower_rune_weapon.up&!death_and_decay.ticking&(active_enemies<2|dot.frost_fever.ticking)
Trinkets
0.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
w 2.95 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&((variable.damage_trinket_priority=1|trinket.2.cooldown.remains)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
x 2.78 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&((variable.damage_trinket_priority=2|trinket.1.cooldown.remains)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGHngkqssjweicTWTTWTVWWTXUVVVZnZZlXxVTVVVTVZTWWTneVibVVWTXWTVTVTVWUnVTlsqssoqvssoqiponqososvsposovvpvnlvpqmipvpqpvgkpqwjnUTWWWeTWWXVTWTVTxlVniTVTVWTWTWTWWXsunvpqvpqptmpopiosnopoqsoqposoqolsnoopqoipoqrssoqsnopopoqposogkqrljwVnTiVWTWeTWTVTVTVTWxWnTVVTUVVWTWiXsqlsqnmupoqrsv

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 4 trinket_1_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 5 trinket_2_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 6 trinket_1_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 7 trinket_2_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat A trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat B damage_trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat E rw_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat F 2h_check PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat G erw_pooling_time PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
0:00.000 default H auto_attack Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
0:00.000 high_prio_actions n remorseless_winter Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune		 bloodlust, corrupting_rage
0:01.031 cooldowns g abomination_limb Fluffy_Pillow 10.0/124: 8% runic_power
5.0/6: 83% rune		 bloodlust, remorseless_winter, corrupting_rage
0:02.062 cooldowns k raise_dead PR_Death_Knight_Frost 15.0/124: 12% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, remorseless_winter, rime, corrupting_rage
0:02.062 single_target q howling_blast Fluffy_Pillow 15.0/124: 12% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, remorseless_winter, rime, corrupting_rage
0:03.093 single_target s obliterate Fluffy_Pillow 23.0/124: 19% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, gathering_storm, remorseless_winter, corrupting_rage
0:04.124 single_target s obliterate Fluffy_Pillow 43.0/124: 35% runic_power
3.0/6: 50% rune		 bloodlust, abomination_limb, gathering_storm(3), remorseless_winter, corrupting_rage
0:05.155 cooldowns j breath_of_sindragosa Fluffy_Pillow 68.0/124: 55% runic_power
1.0/6: 17% rune		 bloodlust, abomination_limb, gathering_storm(5), remorseless_winter, rime, corrupting_rage
0:05.155 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 68.0/124: 55% runic_power
3.0/6: 50% rune		 bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, corrupting_rage
0:05.155 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 68.0/124: 55% runic_power
3.0/6: 50% rune		 bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bound_by_fire_and_blaze, corrupting_rage
0:05.155 cooldowns i pillar_of_frost PR_Death_Knight_Frost 73.0/124: 59% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bound_by_fire_and_blaze, corrupting_rage
0:05.155 cooldowns c potion Fluffy_Pillow 73.0/124: 59% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bound_by_fire_and_blaze, corrupting_rage
0:05.155 breath T howling_blast Fluffy_Pillow 73.0/124: 59% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bound_by_fire_and_blaze, corrupting_rage, elemental_potion_of_ultimate_power
0:06.051 breath W obliterate Fluffy_Pillow 86.0/124: 69% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bound_by_fire_and_blaze, corrupting_rage, elemental_potion_of_ultimate_power
0:06.948 breath T howling_blast Fluffy_Pillow 93.0/124: 75% runic_power
2.0/6: 33% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons, breath_of_sindragosa, gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy, bound_by_fire_and_blaze, corrupting_rage, elemental_potion_of_ultimate_power
0:07.844 breath T howling_blast Fluffy_Pillow 83.0/124: 67% runic_power
2.0/6: 33% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(2), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy(2), bound_by_fire_and_blaze, corrupting_rage, elemental_potion_of_ultimate_power
0:08.741 breath W obliterate Fluffy_Pillow 73.0/124: 59% runic_power
2.0/6: 33% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage, elemental_potion_of_ultimate_power
0:09.638 breath T howling_blast Fluffy_Pillow 80.0/124: 65% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage, elemental_potion_of_ultimate_power
0:10.535 breath V obliterate Fluffy_Pillow 75.0/124: 60% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage, elemental_potion_of_ultimate_power
0:11.432 breath W obliterate Fluffy_Pillow 82.0/124: 66% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_potion_of_ultimate_power
0:12.329 breath W obliterate Fluffy_Pillow 89.0/124: 72% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_potion_of_ultimate_power
0:13.226 breath T howling_blast Fluffy_Pillow 91.0/124: 73% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:14.123 breath X death_and_decay Fluffy_Pillow 104.0/124: 84% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:15.020 breath U horn_of_winter PR_Death_Knight_Frost 96.0/124: 77% runic_power
0.0/6: 0% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:15.875 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:16.730 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:17.585 Waiting     0.190s 111.0/124: 90% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:17.775 breath V obliterate Fluffy_Pillow 111.0/124: 90% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:18.630 Waiting     0.586s 106.0/124: 85% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:19.216 breath Z obliterate Fluffy_Pillow 88.0/124: 71% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:20.070 high_prio_actions n remorseless_winter Fluffy_Pillow 113.0/124: 91% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_potion_of_ultimate_power
0:20.925 Waiting     0.280s 106.0/124: 85% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_potion_of_ultimate_power
0:21.205 breath Z obliterate Fluffy_Pillow 88.0/124: 71% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_potion_of_ultimate_power
0:22.060 Waiting     0.190s 108.0/124: 87% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_potion_of_ultimate_power
0:22.250 breath Z obliterate Fluffy_Pillow 90.0/124: 73% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_potion_of_ultimate_power
0:23.103 Waiting     1.100s 115.0/124: 93% runic_power
0.0/6: 0% rune		 bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_potion_of_ultimate_power
0:24.203 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 79.0/124: 64% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_potion_of_ultimate_power
0:24.203 breath X death_and_decay Fluffy_Pillow 79.0/124: 64% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_potion_of_ultimate_power
0:25.100 Waiting     0.084s 94.0/124: 76% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_potion_of_ultimate_power
0:25.184 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 82.2/124: 66% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_potion_of_ultimate_power
0:25.184 breath V obliterate Fluffy_Pillow 82.2/124: 66% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), dragon_games_equipment, elemental_potion_of_ultimate_power
0:26.166 breath T howling_blast Fluffy_Pillow 95.2/124: 77% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:27.148 breath V obliterate Fluffy_Pillow 105.1/124: 85% runic_power
3.0/6: 50% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:28.129 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:29.111 breath V obliterate Fluffy_Pillow 112.2/124: 90% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:30.091 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:31.073 breath V obliterate Fluffy_Pillow 104.1/124: 84% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:32.055 Waiting     0.192s 106.0/124: 85% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:32.247 breath Z obliterate Fluffy_Pillow 88.0/124: 71% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:33.229 breath T howling_blast Fluffy_Pillow 94.8/124: 76% runic_power
0.0/6: 0% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:34.211 Waiting     1.008s 92.9/124: 75% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:35.219 breath W obliterate Fluffy_Pillow 81.1/124: 65% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
0:36.249 Waiting     1.847s 87.9/124: 71% runic_power
0.0/6: 0% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
0:38.096 breath W obliterate Fluffy_Pillow 81.1/124: 65% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, unleashed_frenzy(3), corrupting_rage
0:39.127 breath T howling_blast Fluffy_Pillow 83.1/124: 67% runic_power
0.0/6: 0% rune		 bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
0:40.158 high_prio_actions n remorseless_winter Fluffy_Pillow 55.1/124: 44% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, unleashed_frenzy(3), corrupting_rage
0:40.158 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 67.5/124: 54% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, unleashed_frenzy(3), corrupting_rage
0:41.498 breath V obliterate Fluffy_Pillow 61.9/124: 50% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, unleashed_frenzy(3), corrupting_rage
0:42.662 Waiting     0.254s 68.7/124: 55% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
0:42.916 cooldowns i pillar_of_frost PR_Death_Knight_Frost 68.7/124: 55% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
0:43.155 breath b arcane_torrent PR_Death_Knight_Frost 50.7/124: 41% runic_power
1.0/6: 17% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
0:44.319 breath V obliterate Fluffy_Pillow 57.5/124: 46% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
0:45.484 breath V obliterate Fluffy_Pillow 76.7/124: 62% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
0:46.649 breath W obliterate Fluffy_Pillow 83.5/124: 67% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:47.813 breath T howling_blast Fluffy_Pillow 90.3/124: 73% runic_power
0.0/6: 0% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:48.977 breath X death_and_decay Fluffy_Pillow 80.3/124: 65% runic_power
1.0/6: 17% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:50.142 Waiting     0.090s 72.3/124: 58% runic_power
1.0/6: 17% rune		 unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:50.232 breath W obliterate Fluffy_Pillow 59.3/124: 48% runic_power
2.0/6: 33% rune		 unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:51.342 breath T howling_blast Fluffy_Pillow 61.3/124: 49% runic_power
2.0/6: 33% rune		 unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:52.451 breath V obliterate Fluffy_Pillow 51.3/124: 41% runic_power
2.0/6: 33% rune		 unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:53.560 breath T howling_blast Fluffy_Pillow 58.3/124: 47% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:54.669 breath V obliterate Fluffy_Pillow 53.3/124: 43% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:55.778 breath T howling_blast Fluffy_Pillow 60.3/124: 49% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:56.888 breath V obliterate Fluffy_Pillow 50.3/124: 41% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:57.998 breath W obliterate Fluffy_Pillow 52.3/124: 42% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:59.108 Waiting     0.724s 54.3/124: 44% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:59.832 breath U horn_of_winter PR_Death_Knight_Frost 41.3/124: 33% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:01.185 high_prio_actions n remorseless_winter Fluffy_Pillow 35.3/124: 28% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:02.525 breath V obliterate Fluffy_Pillow 29.7/124: 24% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:03.864 breath T howling_blast Fluffy_Pillow 36.5/124: 29% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:05.203 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 16.6/124: 13% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
1:05.203 single_target s obliterate Fluffy_Pillow 16.6/124: 13% runic_power
6.0/6: 100% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
1:06.543 single_target q howling_blast Fluffy_Pillow 41.4/124: 33% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
1:07.882 single_target s obliterate Fluffy_Pillow 51.4/124: 41% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, rune_of_hysteria, icy_talons(3), gathering_storm(6), remorseless_winter, enduring_strength, unleashed_frenzy(3)
1:09.222 single_target s obliterate Fluffy_Pillow 88.6/124: 71% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, icy_talons(3), gathering_storm(8), remorseless_winter, unleashed_frenzy(3)
1:10.561 single_target o frost_strike Fluffy_Pillow 108.6/124: 88% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, icy_talons(3), gathering_storm(10), remorseless_winter, rime, unleashed_frenzy(3)
1:11.900 single_target q howling_blast Fluffy_Pillow 83.6/124: 67% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, icy_talons(3), gathering_storm(10), remorseless_winter, rime, unleashed_frenzy(3)
1:13.239 single_target v frost_strike Fluffy_Pillow 91.6/124: 74% runic_power
1.0/6: 17% rune		 icy_talons(3), gathering_storm(10), remorseless_winter, unleashed_frenzy(3)
1:14.578 single_target s obliterate Fluffy_Pillow 66.6/124: 54% runic_power
4.0/6: 67% rune		 icy_talons(3), gathering_storm(10), remorseless_winter, unleashed_frenzy(3)
1:15.917 single_target s obliterate Fluffy_Pillow 91.6/124: 74% runic_power
2.0/6: 33% rune		 icy_talons(3), unleashed_frenzy(3)
1:17.257 single_target o frost_strike Fluffy_Pillow 121.6/124: 98% runic_power
1.0/6: 17% rune		 icy_talons(3), rime, unleashed_frenzy(3)
1:18.597 single_target q howling_blast Fluffy_Pillow 91.6/124: 74% runic_power
2.0/6: 33% rune		 icy_talons(3), rime, unleashed_frenzy(3)
1:19.936 cooldowns i pillar_of_frost PR_Death_Knight_Frost 99.6/124: 80% runic_power
2.0/6: 33% rune		 icy_talons(3), killing_machine, unleashed_frenzy(3)
1:19.936 single_target p obliterate Fluffy_Pillow 99.6/124: 80% runic_power
2.0/6: 33% rune		 icy_talons(3), killing_machine, pillar_of_frost, unleashed_frenzy(3)
1:21.276 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:22.616 high_prio_actions n remorseless_winter Fluffy_Pillow 94.0/124: 76% runic_power
1.0/6: 17% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:23.956 single_target q howling_blast Fluffy_Pillow 104.0/124: 84% runic_power
2.0/6: 33% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:25.295 single_target o frost_strike Fluffy_Pillow 117.0/124: 94% runic_power
2.0/6: 33% rune		 icy_talons(3), gathering_storm, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:26.635 single_target s obliterate Fluffy_Pillow 87.0/124: 70% runic_power
4.0/6: 67% rune		 icy_talons(3), gathering_storm, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:27.975 single_target o frost_strike Fluffy_Pillow 107.0/124: 86% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:29.315 single_target s obliterate Fluffy_Pillow 77.0/124: 62% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:30.655 single_target v frost_strike Fluffy_Pillow 97.0/124: 78% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:31.993 single_target s obliterate Fluffy_Pillow 67.0/124: 54% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(5), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:33.332 single_target p obliterate Fluffy_Pillow 92.0/124: 74% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(7), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:34.672 single_target o frost_strike Fluffy_Pillow 117.0/124: 94% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), gathering_storm(9), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:36.012 single_target s obliterate Fluffy_Pillow 87.0/124: 70% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:37.352 single_target o frost_strike Fluffy_Pillow 107.0/124: 86% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:38.692 single_target v frost_strike Fluffy_Pillow 77.0/124: 62% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:40.031 single_target v frost_strike Fluffy_Pillow 47.0/124: 38% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:41.370 single_target p obliterate Fluffy_Pillow 22.0/124: 18% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:42.710 single_target v frost_strike Fluffy_Pillow 47.0/124: 38% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:44.050 high_prio_actions n remorseless_winter Fluffy_Pillow 17.0/124: 14% runic_power
1.0/6: 17% rune		 icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:45.390 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 27.0/124: 22% runic_power
1.0/6: 17% rune		 rune_of_hysteria, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:45.390 Waiting     0.823s 27.0/124: 22% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:46.213 single_target v frost_strike Fluffy_Pillow 33.2/124: 27% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:47.553 Waiting     2.266s 3.2/124: 3% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:49.819 single_target p obliterate Fluffy_Pillow 9.4/124: 8% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), killing_machine(2), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:51.158 single_target q howling_blast Fluffy_Pillow 34.2/124: 28% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:52.498 high_prio_actions m frost_strike Fluffy_Pillow 44.1/124: 36% runic_power
1.0/6: 17% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:53.838 cooldowns i pillar_of_frost PR_Death_Knight_Frost 20.3/124: 16% runic_power
3.0/6: 50% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), killing_machine(2), bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:53.838 single_target p obliterate Fluffy_Pillow 20.3/124: 16% runic_power
3.0/6: 50% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), killing_machine(2), pillar_of_frost, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:55.177 single_target v frost_strike Fluffy_Pillow 51.3/124: 41% runic_power
1.0/6: 17% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3)
1:56.517 single_target p obliterate Fluffy_Pillow 33.7/124: 27% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3)
1:57.856 single_target q howling_blast Fluffy_Pillow 58.5/124: 47% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3)
1:59.196 single_target p obliterate Fluffy_Pillow 68.4/124: 55% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3)
2:00.536 single_target v frost_strike Fluffy_Pillow 88.4/124: 71% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3)
2:01.875 cooldowns g abomination_limb Fluffy_Pillow 58.4/124: 47% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3)
2:03.215 cooldowns k raise_dead PR_Death_Knight_Frost 58.4/124: 47% runic_power
2.0/6: 33% rune		 unholy_strength, abomination_limb, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3)
2:03.215 single_target p obliterate Fluffy_Pillow 58.4/124: 47% runic_power
2.0/6: 33% rune		 unholy_strength, abomination_limb, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3)
2:04.554 single_target q howling_blast Fluffy_Pillow 83.4/124: 67% runic_power
0.0/6: 0% rune		 unholy_strength, abomination_limb, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3)
2:05.155 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 96.4/124: 78% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3)
2:05.893 cooldowns j breath_of_sindragosa Fluffy_Pillow 96.4/124: 78% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2)
2:05.893 high_prio_actions n remorseless_winter Fluffy_Pillow 96.4/124: 78% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2)
2:07.233 breath U horn_of_winter PR_Death_Knight_Frost 88.4/124: 71% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2)
2:08.573 breath T howling_blast Fluffy_Pillow 95.4/124: 77% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2)
2:09.913 breath W obliterate Fluffy_Pillow 67.4/124: 54% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:11.252 breath W obliterate Fluffy_Pillow 69.4/124: 56% runic_power
5.0/6: 83% rune		 rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:12.590 breath W obliterate Fluffy_Pillow 71.4/124: 58% runic_power
4.0/6: 67% rune		 abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:13.903 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 60.4/124: 49% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:13.929 breath T howling_blast Fluffy_Pillow 65.4/124: 53% runic_power
3.0/6: 50% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:15.093 breath W obliterate Fluffy_Pillow 60.4/124: 49% runic_power
4.0/6: 67% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:16.256 breath W obliterate Fluffy_Pillow 62.4/124: 50% runic_power
3.0/6: 50% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:17.421 breath X death_and_decay Fluffy_Pillow 74.4/124: 60% runic_power
1.0/6: 17% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:18.586 Waiting     0.379s 66.4/124: 54% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:18.965 breath V obliterate Fluffy_Pillow 54.6/124: 44% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:20.075 breath T howling_blast Fluffy_Pillow 61.4/124: 50% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:21.185 breath W obliterate Fluffy_Pillow 59.6/124: 48% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:22.295 breath T howling_blast Fluffy_Pillow 66.4/124: 54% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:23.405 breath V obliterate Fluffy_Pillow 58.3/124: 47% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:24.515 breath T howling_blast Fluffy_Pillow 71.3/124: 57% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:25.247 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 69.4/124: 56% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
2:25.625 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 69.4/124: 56% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), bonegrinder_crit(3), unleashed_frenzy(3), dragon_games_equipment, corrupting_rage
2:25.625 breath V obliterate Fluffy_Pillow 69.4/124: 56% runic_power
5.0/6: 83% rune		 antimagic_shell, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), bonegrinder_crit(3), unleashed_frenzy(3), dragon_games_equipment, corrupting_rage
2:26.735 high_prio_actions n remorseless_winter Fluffy_Pillow 76.2/124: 61% runic_power
5.0/6: 83% rune		 antimagic_shell, rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
2:27.845 cooldowns i pillar_of_frost PR_Death_Knight_Frost 70.6/124: 57% runic_power
5.0/6: 83% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
2:27.845 breath T howling_blast Fluffy_Pillow 70.6/124: 57% runic_power
5.0/6: 83% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
2:29.010 breath V obliterate Fluffy_Pillow 50.7/124: 41% runic_power
6.0/6: 100% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
2:30.175 breath T howling_blast Fluffy_Pillow 57.5/124: 46% runic_power
6.0/6: 100% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
2:31.340 breath V obliterate Fluffy_Pillow 55.6/124: 45% runic_power
6.0/6: 100% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
2:32.504 breath W obliterate Fluffy_Pillow 67.4/124: 54% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
2:33.669 breath T howling_blast Fluffy_Pillow 74.4/124: 60% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:34.833 breath W obliterate Fluffy_Pillow 69.4/124: 56% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:36.173 breath T howling_blast Fluffy_Pillow 58.4/124: 47% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:37.513 breath W obliterate Fluffy_Pillow 48.4/124: 39% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:38.852 breath T howling_blast Fluffy_Pillow 50.4/124: 41% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
2:40.192 breath W obliterate Fluffy_Pillow 22.4/124: 18% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:41.531 breath W obliterate Fluffy_Pillow 24.4/124: 20% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:42.871 breath X death_and_decay Fluffy_Pillow 26.4/124: 21% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:44.211 single_target s obliterate Fluffy_Pillow 0.4/124: 0% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:45.487 single_target u arcane_torrent PR_Death_Knight_Frost 25.4/124: 21% runic_power
1.0/6: 17% rune		 unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:46.763 high_prio_actions n remorseless_winter Fluffy_Pillow 45.4/124: 37% runic_power
2.0/6: 33% rune		 unholy_strength, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:48.039 single_target v frost_strike Fluffy_Pillow 55.4/124: 45% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:49.314 single_target p obliterate Fluffy_Pillow 25.4/124: 21% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), killing_machine(2), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:50.590 single_target q howling_blast Fluffy_Pillow 50.2/124: 41% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:51.866 single_target v frost_strike Fluffy_Pillow 60.2/124: 49% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:53.142 single_target p obliterate Fluffy_Pillow 30.2/124: 24% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:54.480 single_target q howling_blast Fluffy_Pillow 55.0/124: 44% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
2:55.819 single_target p obliterate Fluffy_Pillow 71.1/124: 57% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm(6), killing_machine(2), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
2:57.158 single_target t horn_of_winter PR_Death_Knight_Frost 91.1/124: 73% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), gathering_storm(8), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
2:58.498 high_prio_actions m frost_strike Fluffy_Pillow 116.1/124: 94% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), gathering_storm(8), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
2:59.835 single_target p obliterate Fluffy_Pillow 86.1/124: 69% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), killing_machine(2), bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:01.175 single_target o frost_strike Fluffy_Pillow 106.1/124: 86% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
3:02.515 single_target p obliterate Fluffy_Pillow 82.3/124: 66% runic_power
5.0/6: 83% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
3:03.854 cooldowns i pillar_of_frost PR_Death_Knight_Frost 107.1/124: 86% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
3:03.854 single_target o frost_strike Fluffy_Pillow 107.1/124: 86% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
3:05.194 single_target s obliterate Fluffy_Pillow 77.1/124: 62% runic_power
5.0/6: 83% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
3:06.534 high_prio_actions n remorseless_winter Fluffy_Pillow 108.1/124: 87% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:08.103 single_target o frost_strike Fluffy_Pillow 120.5/124: 97% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:09.441 single_target p obliterate Fluffy_Pillow 95.5/124: 77% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:10.780 single_target o frost_strike Fluffy_Pillow 115.5/124: 93% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:12.120 single_target q howling_blast Fluffy_Pillow 85.5/124: 69% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:13.460 single_target s obliterate Fluffy_Pillow 98.5/124: 79% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:14.800 single_target o frost_strike Fluffy_Pillow 118.5/124: 96% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:16.140 single_target q howling_blast Fluffy_Pillow 88.5/124: 71% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(5), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:17.480 single_target p obliterate Fluffy_Pillow 101.5/124: 82% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(6), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:18.820 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:20.160 single_target s obliterate Fluffy_Pillow 94.0/124: 76% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:21.498 single_target o frost_strike Fluffy_Pillow 119.0/124: 96% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:22.838 single_target q howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:24.178 single_target o frost_strike Fluffy_Pillow 107.0/124: 86% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:25.518 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 77.0/124: 62% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:25.518 single_target s obliterate Fluffy_Pillow 77.0/124: 62% runic_power
5.0/6: 83% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:26.858 high_prio_actions n remorseless_winter Fluffy_Pillow 108.0/124: 87% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
3:28.198 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, rune_of_hysteria, icy_talons(3), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
3:29.538 single_target o frost_strike Fluffy_Pillow 100.2/124: 81% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, rune_of_hysteria, icy_talons(3), remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
3:30.878 single_target p obliterate Fluffy_Pillow 70.2/124: 57% runic_power
5.0/6: 83% rune		 antimagic_shell, rune_of_hysteria, icy_talons(3), killing_machine, remorseless_winter, rime, unleashed_frenzy(3), corrupting_rage
3:32.217 single_target q howling_blast Fluffy_Pillow 101.2/124: 82% runic_power
3.0/6: 50% rune		 antimagic_shell, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
3:33.556 single_target o frost_strike Fluffy_Pillow 109.2/124: 88% runic_power
3.0/6: 50% rune		 icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
3:34.896 cooldowns i pillar_of_frost PR_Death_Knight_Frost 84.2/124: 68% runic_power
5.0/6: 83% rune		 icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
3:34.896 single_target p obliterate Fluffy_Pillow 84.2/124: 68% runic_power
5.0/6: 83% rune		 icy_talons(3), gathering_storm(3), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
3:36.236 single_target o frost_strike Fluffy_Pillow 114.2/124: 92% runic_power
3.0/6: 50% rune		 icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:37.576 single_target q howling_blast Fluffy_Pillow 84.2/124: 68% runic_power
4.0/6: 67% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:38.916 single_target r frost_strike Fluffy_Pillow 102.2/124: 82% runic_power
4.0/6: 67% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:40.255 single_target s obliterate Fluffy_Pillow 72.2/124: 58% runic_power
5.0/6: 83% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:41.595 single_target s obliterate Fluffy_Pillow 92.2/124: 74% runic_power
3.0/6: 50% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:42.934 single_target o frost_strike Fluffy_Pillow 112.2/124: 90% runic_power
1.0/6: 17% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:44.274 single_target q howling_blast Fluffy_Pillow 87.2/124: 70% runic_power
3.0/6: 50% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3)
3:45.614 single_target s obliterate Fluffy_Pillow 95.2/124: 77% runic_power
3.0/6: 50% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), enduring_strength_builder, unleashed_frenzy(3)
3:46.954 high_prio_actions n remorseless_winter Fluffy_Pillow 120.2/124: 97% runic_power
1.0/6: 17% rune		 icy_talons(3), killing_machine, rime, enduring_strength, unleashed_frenzy(3)
3:48.294 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune		 icy_talons(3), killing_machine, remorseless_winter, rime, enduring_strength, unleashed_frenzy(3)
3:49.632 single_target p obliterate Fluffy_Pillow 94.0/124: 76% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), killing_machine, remorseless_winter, rime, enduring_strength, unleashed_frenzy(3)
3:50.972 single_target o frost_strike Fluffy_Pillow 114.0/124: 92% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
3:52.311 single_target p obliterate Fluffy_Pillow 84.0/124: 68% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
3:53.651 single_target o frost_strike Fluffy_Pillow 109.0/124: 88% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:54.991 single_target q howling_blast Fluffy_Pillow 79.0/124: 64% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:56.331 single_target p obliterate Fluffy_Pillow 92.0/124: 74% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:57.671 single_target o frost_strike Fluffy_Pillow 112.0/124: 90% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3)
3:59.010 single_target s obliterate Fluffy_Pillow 82.0/124: 66% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:00.350 single_target o frost_strike Fluffy_Pillow 112.0/124: 90% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:01.689 cooldowns g abomination_limb Fluffy_Pillow 87.0/124: 70% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:03.215 cooldowns k raise_dead PR_Death_Knight_Frost 87.0/124: 70% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:03.215 single_target q howling_blast Fluffy_Pillow 87.0/124: 70% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:04.553 single_target r frost_strike Fluffy_Pillow 96.9/124: 78% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:05.893 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 79.3/124: 64% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:05.893 cooldowns j breath_of_sindragosa Fluffy_Pillow 79.3/124: 64% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:05.893 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 79.3/124: 64% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:05.893 breath V obliterate Fluffy_Pillow 79.3/124: 64% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
4:07.233 high_prio_actions n remorseless_winter Fluffy_Pillow 86.1/124: 69% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:08.573 breath T howling_blast Fluffy_Pillow 86.7/124: 70% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:09.913 cooldowns i pillar_of_frost PR_Death_Knight_Frost 60.6/124: 49% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:09.913 breath V obliterate Fluffy_Pillow 60.6/124: 49% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:11.253 breath W obliterate Fluffy_Pillow 72.6/124: 59% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:12.593 breath T howling_blast Fluffy_Pillow 74.6/124: 60% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:13.933 breath W obliterate Fluffy_Pillow 51.6/124: 42% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:14.927 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 58.6/124: 47% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:15.273 breath T howling_blast Fluffy_Pillow 68.6/124: 55% runic_power
3.0/6: 50% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:16.437 breath W obliterate Fluffy_Pillow 58.6/124: 47% runic_power
3.0/6: 50% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:17.601 breath T howling_blast Fluffy_Pillow 65.6/124: 53% runic_power
2.0/6: 33% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:18.765 breath V obliterate Fluffy_Pillow 55.6/124: 45% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:19.930 breath T howling_blast Fluffy_Pillow 45.8/124: 37% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:21.095 breath V obliterate Fluffy_Pillow 37.8/124: 30% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:22.260 breath T howling_blast Fluffy_Pillow 44.6/124: 36% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:23.424 breath V obliterate Fluffy_Pillow 36.5/124: 29% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:24.589 breath T howling_blast Fluffy_Pillow 49.5/124: 40% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:25.753 breath W obliterate Fluffy_Pillow 47.6/124: 38% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:25.947 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 54.4/124: 44% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:26.918 breath W obliterate Fluffy_Pillow 42.6/124: 34% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:28.083 high_prio_actions n remorseless_winter Fluffy_Pillow 49.4/124: 40% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:29.248 breath T howling_blast Fluffy_Pillow 50.0/124: 40% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:30.413 breath V obliterate Fluffy_Pillow 48.1/124: 39% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine(2), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:31.577 breath V obliterate Fluffy_Pillow 54.9/124: 44% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:32.742 breath T howling_blast Fluffy_Pillow 74.1/124: 60% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:33.907 breath U horn_of_winter PR_Death_Knight_Frost 46.1/124: 37% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:35.072 breath V obliterate Fluffy_Pillow 58.1/124: 47% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:36.412 breath V obliterate Fluffy_Pillow 60.1/124: 48% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(8), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:37.751 breath W obliterate Fluffy_Pillow 67.1/124: 54% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:39.091 breath T howling_blast Fluffy_Pillow 51.1/124: 41% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:40.431 breath W obliterate Fluffy_Pillow 41.1/124: 33% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:41.770 cooldowns i pillar_of_frost PR_Death_Knight_Frost 53.1/124: 43% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:41.770 breath X death_and_decay Fluffy_Pillow 53.1/124: 43% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:43.109 Waiting     0.837s 27.1/124: 22% runic_power
0.0/6: 0% rune		 unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:43.946 single_target s obliterate Fluffy_Pillow 9.1/124: 7% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:45.222 single_target q howling_blast Fluffy_Pillow 29.1/124: 23% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:46.498 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 37.1/124: 30% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), unleashed_frenzy(3), corrupting_rage
4:46.498 single_target s obliterate Fluffy_Pillow 37.1/124: 30% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), unleashed_frenzy(3), corrupting_rage
4:47.774 single_target q howling_blast Fluffy_Pillow 62.1/124: 50% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
4:49.050 high_prio_actions n remorseless_winter Fluffy_Pillow 75.1/124: 61% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
4:50.326 high_prio_actions m frost_strike Fluffy_Pillow 90.1/124: 73% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
4:51.602 single_target u arcane_torrent PR_Death_Knight_Frost 60.1/124: 48% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
4:52.877 single_target p obliterate Fluffy_Pillow 84.9/124: 68% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
4:54.217 single_target o frost_strike Fluffy_Pillow 109.7/124: 88% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:55.557 single_target q howling_blast Fluffy_Pillow 85.9/124: 69% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:56.896 single_target r frost_strike Fluffy_Pillow 95.8/124: 77% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:58.236 single_target s obliterate Fluffy_Pillow 65.8/124: 53% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:59.574 single_target v frost_strike Fluffy_Pillow 96.8/124: 78% runic_power
1.0/6: 17% rune		 icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5690 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3848 0 16538 15751 9278
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 330760 315020 0
Runic Power 124 124 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 30.85% 24.64% 2995
Haste 12.25% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 5974 5598 0
Mastery 46.03% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +923 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +111 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +519 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Talents

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowFrost Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=sizzling_seafood_medley
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
actions.precombat+=/variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h
# Protects Breath from starving itself on ERW charges depending on anticipated resource gains. More resources enable more aggressive use.
actions.precombat+=/variable,name=erw_pooling_time,op=setif,value=30,value_else=45,condition=death_knight.ams_absorb_percent>0.59

# Executed every time the actor is available.
actions=auto_attack
# Choose Action list to run
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/frostscythe,if=!death_and_decay.ticking&equipped.fyralath_the_dreamrender&(cooldown.rage_of_fyralath_417131.remains<3|!dot.mark_of_fyralath.ticking)
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=howling_blast,if=variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&(buff.killing_machine.react|runic_power>45)
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up
actions.breath+=/remorseless_winter,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/death_and_decay,if=talent.unholy_ground&!death_and_decay.ticking&runic_power.deficit>=10|runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/howling_blast,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=set_bonus.tier31_2pc&buff.chilling_rage.remains<3
actions.cooldowns+=/chill_streak,if=!set_bonus.tier31_2pc&active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react&rune>2|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>50|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
actions.high_prio_actions=invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions.high_prio_actions+=/mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40&death_knight.first_ams_cast<time
actions.high_prio_actions+=/antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.ready|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up))
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions.high_prio_actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&((!talent.obliteration|talent.obliteration&(!cooldown.pillar_of_frost.ready|buff.pillar_of_frost.up&!buff.killing_machine.react))|(equipped.fyralath_the_dreamrender&!dot.mark_of_fyralath.ticking))
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/remorseless_winter,if=variable.rw_buffs|variable.adds_remain

# Obliteration Active Rotation
actions.obliteration=howling_blast,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&buff.rime.react
actions.obliteration+=/frost_strike,if=(active_enemies<=1|!talent.glacial_advance)&buff.killing_machine.react<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/glacial_advance,if=buff.killing_machine.react<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&(variable.frostscythe_priority|active_enemies>3&!death_and_decay.ticking&equipped.fyralath_the_dreamrender&(cooldown.rage_of_fyralath_417131.remains<3|!dot.mark_of_fyralath.ticking))
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&(!dot.frost_fever.ticking|buff.rime.react&set_bonus.tier30_2pc&!variable.rp_buffs)
actions.obliteration+=/glacial_advance,if=!buff.killing_machine.react&(!death_knight.runeforge.razorice&(!talent.avalanche|debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)|((variable.rp_buffs|rune<2)&active_enemies>1))
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(rune<2|variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<30
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<30
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=frost_strike,if=buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
actions.single_target+=/howling_blast,if=buff.rime.react&set_bonus.tier30_2pc&buff.killing_machine.stack<2
actions.single_target+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets
actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.pillar_of_frost.up&!buff.empower_rune_weapon.up&!death_and_decay.ticking&(active_enemies<2|dot.frost_fever.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&((variable.damage_trinket_priority=1|trinket.2.cooldown.remains)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&((variable.damage_trinket_priority=2|trinket.1.cooldown.remains)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions.variables+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions.variables+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions.variables+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
actions.variables+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains>10|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up
actions.variables+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>8|!death_and_decay.ticking&active_enemies>4))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions.variables+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions.variables+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions.variables+=/variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions.variables+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=9278
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 56945 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
56944.8 56944.8 44.8 / 0.079% 7485.9 / 13.1% 4133.6
APS APS Error APS Range APR
163.2 3.9 / 2.364% 437.6 / 268.2% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.7 7.8 Runic Power 1.38% 52.9 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 56945
Apocalypse 241 (8134) 0.4% (14.3%) 6.8 46.27s 357203 291449 Direct 6.8 (537.8) 8831 17622 10612 20.3% (20.3%)

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.82 6.82 0.00 0.00 0.00 1.2256 0.0000 72357.99 72357.99 0.00% 291449.38 291449.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.74% 5.44 1 8 8831.11 6384 13297 8827.77 6910 11234 48020 48020 0.00%
crit 20.26% 1.38 0 6 17622.45 13821 26594 13812.28 0 26343 24338 24338 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for {$?a134735=false}[every {$s3=2} Festering {$=}LWound:Wounds;][each Festering Wound] you burst. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [U]:5.82
  • if_expr:variable.st_planning&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [Y]:1.00
  • if_expr:debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell CooldownArmy of the Damned2768373ADD-45000.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
    main_hand 9474  / 4172 7.3% 258.7 4.33s 4828 3207 Direct 258.7 4014 8030 4828 20.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 258.72 258.72 0.00 0.00 0.00 1.5054 0.0000 1249165.77 1784568.03 30.00% 3207.21 3207.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.72% 206.24 138 277 4013.50 1930 6543 4018.95 3583 4428 827754 1182536 30.00%
crit 20.28% 52.48 24 85 8030.37 3859 13085 8040.23 6932 9677 421411 602032 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 2263  / 997 1.8% 189.9 5.97s 1572 1572 Direct 189.9 1307 2615 1572 20.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 189.87 189.87 0.00 0.00 0.00 1.0000 0.0000 298566.62 426534.61 30.00% 1572.48 1572.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.67% 151.26 101 203 1306.52 645 2186 1307.88 1188 1439 197630 282336 30.00%
crit 20.33% 38.61 13 71 2614.56 1290 4372 2617.29 2264 3146 100936 144199 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:47.47
    default
    [ ]:47.47
    default
    [ ]:47.47
    default
    [ ]:47.47
    Frostbolt 1476  / 650 1.1% 19.8 14.91s 9827 6222 Direct 19.8 8177 16339 9833 20.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.83 19.82 0.00 0.00 0.00 1.5795 0.0000 194866.98 194866.98 0.00% 6221.61 6221.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.71% 15.80 6 24 8176.90 4455 13856 8184.29 7081 9923 129175 129175 0.00%
crit 20.29% 4.02 0 12 16339.47 9221 27711 16140.63 0 27711 65692 65692 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:19.93
    Shadow Bolt 4709  / 2074 3.6% 62.6 4.53s 9908 6593 Direct 62.6 8233 16481 9913 20.4%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.64 62.61 0.00 0.00 0.00 1.5029 0.0000 620685.14 620685.14 0.00% 6592.72 6592.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.63% 49.86 30 69 8232.55 3952 13580 8241.68 7343 9179 410447 410447 0.00%
crit 20.37% 12.76 1 26 16480.85 8966 26794 16499.96 13132 21952 210238 210238 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:69.36
Army of the Dead 0 (6245) 0.0% (10.9%) 2.0 0.00s 924940 1403551

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6590 0.4688 0.00 0.00 0.00% 209784.63 1403551.49

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    high_prio_actions
    [h]:1.00
  • if_expr:talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
    main_hand 17202  / 3884 6.8% 333.7 0.74s 3447 2666 Direct 333.7 2864 5720 3447 20.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 333.74 333.74 0.00 0.00 0.00 1.2933 0.0000 1150541.98 1643673.31 30.00% 2665.65 2665.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.56% 265.53 225 304 2863.64 1231 4230 2862.84 2351 3147 760373 1086275 30.00%
crit 20.44% 68.22 40 102 5719.51 2461 8459 5717.31 4508 6541 390169 557399 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 3322  / 750 1.3% 204.4 1.32s 1087 1087 Direct 204.4 903 1801 1087 20.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 204.45 204.45 0.00 0.00 0.00 1.0000 0.0000 222202.44 317440.15 30.00% 1086.85 1086.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.56% 162.65 130 188 903.39 411 1413 903.22 752 1010 146935 209913 30.00%
crit 20.44% 41.80 19 70 1800.69 822 2827 1799.80 1356 2078 75267 107527 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:26.38
    default
    [ ]:26.25
    default
    [ ]:25.95
    default
    [ ]:26.62
    default
    [ ]:24.89
    default
    [ ]:24.91
    default
    [ ]:25.11
    default
    [ ]:24.34
    Frostbolt 1421  / 288 0.5% 8.0 30.89s 10661 7477 Direct 8.0 8829 17594 10661 20.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.00 1.4258 0.0000 85286.75 85286.75 0.00% 7477.36 7477.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.10% 6.33 1 8 8828.81 4203 14050 8829.17 4896 11358 55869 55869 0.00%
crit 20.90% 1.67 0 7 17593.86 8406 28100 14880.70 0 27711 29418 29418 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:8.00
    Shadow Bolt 6531  / 1323 2.3% 35.8 6.28s 10946 8311 Direct 35.8 9091 18156 10945 20.5%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.80 35.80 0.00 0.00 0.00 1.3170 0.0000 391849.70 391849.70 0.00% 8310.88 8310.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.54% 28.48 19 36 9091.07 3952 13580 9087.67 6928 10149 258875 258875 0.00%
crit 20.46% 7.32 0 17 18155.57 7905 26794 18147.79 0 24964 132974 132974 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:37.80
auto_attack_mh 2710 4.8% 147.1 2.46s 5524 2262 Direct 147.1 4590 9180 5524 20.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 147.08 147.08 0.00 0.00 0.00 2.4419 0.0000 812515.12 1160765.49 30.00% 2262.25 2262.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 117.14 79 161 4589.79 3685 6722 4589.37 4350 4792 537672 768122 30.00%
crit 20.35% 29.94 12 52 9180.18 7371 13443 9179.10 8435 10116 274843 392643 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 96 0.2% 2.0 179.79s 14251 0 Direct 2.0 11785 23540 14251 21.0%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 28507.89 28507.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.02% 1.58 0 3 11785.09 10403 14825 11234.59 0 14825 18629 18629 0.00%
crit 20.98% 0.42 0 2 23540.05 20806 29650 8773.28 0 29650 9879 9879 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Clawing Shadows 7913 13.9% 71.0 4.10s 33360 28058 Direct 71.0 27720 55338 33361 20.4%

Stats Details: Clawing Shadows

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 71.05 71.05 0.00 0.00 0.00 1.1890 0.0000 2370215.71 2370215.71 0.00% 28057.53 28057.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.58% 56.54 35 80 27720.01 13112 53483 27748.83 22970 31876 1567256 1567256 0.00%
crit 20.42% 14.51 3 31 55337.86 27828 106966 55390.89 35655 74250 802960 802960 0.00%

Action Details: Clawing Shadows

  • id:207311
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207311
  • name:Clawing Shadows
  • school:shadow
  • tooltip:
  • description:Deals {$s2=0} Shadow damage and causes 1 Festering Wound to burst.

Action Priority List

    st
    [n]:70.82
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    st
    [q]:0.22
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Rotten Touch39027610.500
Dark Transformation 0 (212) 0.0% (0.4%) 6.9 46.16s 9145 7245

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.94 0.00 0.00 0.00 0.00 1.2623 0.0000 0.00 0.00 0.00% 7244.66 7244.66

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [T]:5.94
  • if_expr:cooldown.apocalypse.remains<5
    garg_setup
    [d]:1.00
  • if_expr:talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownUnholy Command3169411ADD-15000.000
    Dark Transformation (_damage) 212 0.4% 0.0 0.00s 0 0 Direct 6.9 7574 15144 9145 20.8%

Stats Details: Dark Transformation Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 6.94 0.00 0.00 0.00 0.0000 0.0000 63470.47 63470.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.25% 5.50 1 8 7573.79 6182 11078 7569.44 6480 8981 41659 41659 0.00%
crit 20.75% 1.44 0 6 15144.41 12364 22504 12043.34 0 22156 21811 21811 0.00%

Action Details: Dark Transformation Damage

  • id:344955
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344955
  • name:Dark Transformation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc63560=Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Death and Decay 271 0.5% 8.5 36.66s 9600 8076 Periodic 91.9 734 1467 884 20.4% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.45 0.00 0.00 91.87 0.00 1.1888 0.0000 81170.02 81170.02 0.00% 8075.82 8075.82
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.59% 73.12 41 112 733.90 460 1234 734.63 657 821 53664 53664 0.00%
crit 20.41% 18.75 4 37 1467.21 960 2467 1468.53 1175 1799 27506 27506 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    garg_setup
    [Z]:1.00
  • if_expr:!death_and_decay.ticking&debuff.festering_wound.stack>1
    st
    [m]:7.46
  • if_expr:!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Death Coil 7334 (9495) 12.9% (16.7%) 96.4 3.08s 29510 24438 Direct 96.4 (233.4) 18951 37873 22803 20.4% (20.4%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.41 96.36 0.00 0.00 0.00 1.2075 0.0000 2197388.58 2197388.58 0.00% 24438.18 24438.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.64% 76.75 48 104 18950.79 11754 32580 18960.21 17785 20448 1454424 1454424 0.00%
crit 20.36% 19.62 6 40 37873.08 24384 64560 37887.89 31224 46481 742965 742965 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Details: Death Coil Damage

  • id:47632
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47632
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fire a blast of unholy energy, causing Shadow damage to an enemy target or healing a friendly Undead target.

Action Priority List

    high_prio_actions
    [i]:6.95
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
    st
    [l]:81.39
  • if_expr:!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
    st
    [p]:8.07

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Death Coil3775801PCT0.300
Spell TargetsImproved Death Coil3775802ADD1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Percent Cost Sudden Doom813401-1.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
    Coil of Devastation 2161 3.8% 0.0 0.00s 0 0 Periodic 137.0 4726 0 4726 0.0% 91.3%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 137.01 137.01 81.94 0.0000 2.0000 647558.02 647558.02 0.00% 2363.16 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 137.01 105 170 4726.31 1776 21340 4733.36 3972 5631 647558 647558 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 929 1.6% 6.8 46.65s 40870 0 Direct 6.8 33985 67955 40901 20.4%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.83 6.83 0.00 0.00 0.00 0.0000 0.0000 279256.42 398947.92 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.64% 5.44 0 9 33985.10 33373 35042 33992.45 0 35042 184786 263987 29.99%
crit 20.36% 1.39 0 6 67955.47 66746 70083 51940.96 0 70083 94470 134961 22.93%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1567 2.8% 22.7 13.19s 20672 17033 Direct 22.7 17170 34297 20671 20.4%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.73 22.73 0.00 0.00 0.00 1.2136 0.0000 469858.17 671243.08 30.00% 17033.10 17033.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.55% 18.08 9 28 17169.85 12164 30700 17156.62 14386 19387 310472 443543 30.00%
crit 20.45% 4.65 0 13 34297.33 24328 58812 34098.18 0 53272 159386 227700 29.85%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [e]:1.00
  • if_expr:debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
    st
    [o]:21.73
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack<4
  • target_if_expr:debuff.festering_wound.stack

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Festering Strike3168671PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Festering Wound 2520 4.4% 98.3 3.77s 7682 0 Direct 98.3 6384 12764 7682 20.4%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 98.32 98.32 0.00 0.00 0.00 0.0000 0.0000 755335.70 755335.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 78.31 48 106 6383.52 4298 11686 6385.23 5940 6869 499899 499899 0.00%
crit 20.35% 20.01 5 36 12763.73 9096 23371 12765.49 10795 16270 255437 255437 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Festering Strike3168671PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Outbreak 87 0.2% 11.6 27.01s 2253 1858 Direct 11.6 1868 3731 2253 20.7%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.2130 0.0000 26194.21 26194.21 0.00% 1857.75 1857.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.33% 9.22 3 14 1868.38 1269 3282 1868.94 1534 2220 17231 17231 0.00%
crit 20.67% 2.40 0 9 3731.45 2639 6563 3474.23 0 6563 8964 8964 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    high_prio_actions
    [j]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Raise Dead 0 (7927) 0.0% (13.9%) 1.0 0.00s 2373264 0

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
    auto_attack 5493  / 5493 9.7% 186.0 1.61s 8842 5498 Direct 186.0 7337 14713 8842 20.4%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 186.00 186.00 0.00 0.00 0.00 1.6084 0.0000 1644688.04 2349614.25 30.00% 5497.65 5497.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.59% 148.04 105 193 7337.04 2483 18961 7346.90 6498 8388 1086204 1551759 30.00%
crit 20.41% 37.96 16 62 14712.84 4965 37411 14730.65 9326 20016 558485 797855 30.00%

Action Details: Auto Attack

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:1.00
    Sweeping Claws 1999  / 1999 3.5% 62.9 4.66s 9505 9471 Direct 62.9 7893 15792 9505 20.4%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.94 62.94 0.00 0.00 0.00 1.0036 0.0000 598279.19 598279.19 0.00% 9471.09 9471.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.59% 50.09 31 69 7893.23 5506 14018 7896.69 7239 8636 395397 395397 0.00%
crit 20.41% 12.85 2 26 15791.69 11012 27658 15800.04 12789 22308 202882 202882 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:62.94
    Claw 432  / 432 0.8% 39.3 7.75s 3303 3291 Direct 39.3 2743 5485 3303 20.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.32 39.32 0.00 0.00 0.00 1.0036 0.0000 129874.75 185540.09 30.00% 3290.72 3290.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.58% 31.30 16 48 2742.70 2234 9128 2740.90 2518 2972 85837 122627 30.00%
crit 20.42% 8.03 0 21 5485.08 4469 20059 5480.35 0 8097 44038 62913 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:39.32
  • if_expr:energy>70
    Gnaw 1  / 1 0.0% 3.7 90.13s 113 113 Direct 3.7 94 188 113 20.5%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0036 0.0000 422.22 603.18 30.00% 112.80 112.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.50% 2.97 0 4 93.92 79 124 93.64 0 111 279 398 29.91%
crit 20.50% 0.76 0 4 187.85 158 240 108.84 0 240 144 205 17.38%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:3.73
Soul Reaper 731 (4123) 1.3% (7.3%) 15.4 6.96s 80460 63624 Direct 15.4 (30.8) 11861 23736 14277 20.4% (20.4%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.40 15.40 0.00 0.00 0.00 1.2647 0.0000 219861.38 219861.38 0.00% 63624.03 63624.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 12.27 5 19 11860.72 7133 18449 11871.26 10265 13505 145475 145475 0.00%
crit 20.35% 3.13 0 10 23736.14 14266 36373 22953.76 0 35851 74387 74387 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [X]:15.40
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370075PCT0.150
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
    Soul Reaper (_execute) 3391 6.0% 15.4 6.96s 66186 0 Direct 15.4 54961 110071 66186 20.4%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.40 15.40 0.00 0.00 0.00 0.0000 0.0000 1019152.89 1019152.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.63% 12.26 5 19 54960.51 41667 84650 55034.23 48247 62775 673911 673911 0.00%
crit 20.37% 3.14 0 11 110070.95 85095 169301 106334.76 0 164495 345242 345242 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370075PCT0.150
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Summon Gargoyle 0 (3054) 0.0% (5.3%) 2.0 185.21s 452272 0

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [S]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead
    garg_setup
    [a]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
    Gargoyle Strike 18091  / 3054 5.3% 27.1 7.85s 33352 21263 Direct 27.1 27716 55218 33351 20.5%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.12 27.12 0.00 0.00 0.00 1.5686 0.0000 904543.54 904543.54 0.00% 21263.36 21263.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.51% 21.56 12 28 27716.14 8289 59959 27715.26 21636 33823 597666 597666 0.00%
crit 20.49% 5.56 0 15 55218.03 17208 125056 55122.26 0 107569 306878 306878 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.
Unholy Assault 391 0.7% 3.6 91.72s 32251 28313 Direct 3.6 26757 53685 32252 20.4%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.64 3.64 0.00 0.00 0.00 1.1393 0.0000 117328.99 117328.99 0.00% 28312.98 28312.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.60% 2.90 0 4 26757.06 21163 36265 26705.98 0 34483 77482 77482 0.00%
crit 20.40% 0.74 0 4 53685.40 40748 72529 30222.04 0 71845 39847 39847 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Damage increased by {$s4=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing all damage done by {$s4=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [W]:3.34
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [c]:0.30
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Virulent Plague 1271 2.2% 11.6 27.01s 32795 0 Periodic 99.5 3185 6362 3832 20.4% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.50 99.50 10.62 0.0000 3.0000 381224.65 381224.65 0.00% 1277.18 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.64% 79.24 53 106 3184.67 2273 6070 3185.10 2998 3373 252357 252357 0.00%
crit 20.36% 20.26 6 39 6361.94 4493 12139 6362.05 5410 7627 128868 128868 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.172500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Tick Time Plaguebringer3901781-0.500Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 0
Anti-Magic Shell 164 100.8% 7.0 45.42s 7063 0 Direct 3.1 15824 0 15824 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.96 3.11 0.00 0.00 0.00 0.0000 0.0000 49183.01 49183.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.11 0 15 15823.90 15824 15824 13416.23 0 15824 49183 49183 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [f]:6.96
  • if_expr:runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownAnti-Magic Barrier2057271ADD-20000.000
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Algeth'ar Puzzle (_box_channel) 2.0 0.00s

Stats Details: Algethar Puzzle Box Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 2.00 0.00 0.00 1.5530 1.5530 0.00 0.00 0.00% 0.00 0.00

Action Details: Algethar Puzzle Box Channel

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 185.59s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [k]:2.00
  • if_expr:(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
Empower Rune Weapon 2.4 168.45s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.39 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [V]:2.09
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
    garg_setup
    [b]:0.30
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929621SET1.000
Festering Wound (_application) 102.0 5.29s

Stats Details: Festering Wound Application

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 102.02 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Festering Wound Application

  • id:197147
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:197147
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:Festering Strike applies a pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$195757s1=3} Runic Power. Stacks up to {$194310u=6} times on any target.
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382154
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Outbreak (_aoe) 11.6 27.01s

Stats Details: Outbreak Aoe

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Outbreak Aoe

  • id:196780
  • school:shadow
  • range:200.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196780
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:{$@spelldesc77575=Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}}
Elemental Potion of Ultimate Power 1.5 303.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    high_prio_actions
    [g]:1.46
  • if_expr:(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Unholy Strength 20.7 14.15s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.68 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 181.8s 181.8s 30.0s 20.27% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1411.05

Trigger Details

  • interval_min/max:181.8s / 182.5s
  • trigger_min/max:181.8s / 182.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s
  • uptime_min/max:16.67% / 25.00%

Stack Uptimes

  • algethar_puzzle_1:20.27%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Anti-Magic Shell 7.0 0.0 45.4s 45.4s 6.9s 16.12% 18.43% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.40
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 121.0s
  • trigger_min/max:40.0s / 121.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:10.43% / 17.78%

Stack Uptimes

  • antimagic_shell_1:16.12%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Berserking 2.0 0.0 185.6s 185.6s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 195.0s
  • trigger_min/max:180.9s / 195.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Commander of the Dead 6.9 0.0 46.2s 46.2s 28.6s 66.11% 87.69% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 57.4s
  • trigger_min/max:45.0s / 57.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:61.99% / 69.05%

Stack Uptimes

  • commander_of_the_dead_1:66.11%

Spelldata

  • id:390260
  • name:Commander of the Dead
  • tooltip:Your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead ghouls deal {$390264s1=35}% increased damage.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.2s 58.9s 50.3s 80.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 340.0s
  • trigger_min/max:15.0s / 296.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 343.1s
  • uptime_min/max:40.34% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.24%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Transformation 6.9 0.0 46.2s 46.2s 21.9s 50.65% 55.04% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 57.4s
  • trigger_min/max:45.0s / 57.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.0s
  • uptime_min/max:45.08% / 56.83%

Stack Uptimes

  • dark_transformation_1:50.65%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Dragon Games Equipment 2.7 0.0 120.0s 120.0s 0.8s 0.69% 0.00% 6.8 (6.8) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.60
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.2s
  • trigger_min/max:120.0s / 120.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.9s
  • uptime_min/max:0.44% / 1.01%

Stack Uptimes

  • dragon_games_equipment_1:0.69%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 303.0s 303.0s 27.4s 13.09% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 326.8s
  • trigger_min/max:300.0s / 326.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.83% / 17.94%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.09%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 168.5s 168.5s 19.3s 15.32% 0.00% 6.9 (6.9) 2.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 195.7s
  • trigger_min/max:120.0s / 195.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:12.60% / 18.18%

Stack Uptimes

  • empower_rune_weapon_1:15.32%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Festermight 13.1 64.8 23.3s 3.8s 19.2s 83.81% 0.00% 0.0 (0.0) 12.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 45.8s
  • trigger_min/max:0.8s / 30.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:72.98% / 91.90%

Stack Uptimes

  • festermight_1:7.96%
  • festermight_2:8.06%
  • festermight_3:8.37%
  • festermight_4:16.14%
  • festermight_5:11.31%
  • festermight_6:10.00%
  • festermight_7:8.09%
  • festermight_8:5.71%
  • festermight_9:3.71%
  • festermight_10:1.90%
  • festermight_11:0.85%
  • festermight_12:0.63%
  • festermight_13:0.57%
  • festermight_14:0.40%
  • festermight_15:0.11%
  • festermight_16:0.01%
  • festermight_17:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 95.4 166.8s 3.1s 293.3s 98.53% 0.00% 93.4 (93.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.4s / 288.6s
  • trigger_min/max:0.8s / 14.2s
  • trigger_pct:100.00%
  • duration_min/max:5.6s / 355.6s
  • uptime_min/max:96.77% / 98.80%

Stack Uptimes

  • icy_talons_1:0.33%
  • icy_talons_2:0.33%
  • icy_talons_3:97.86%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 11.9 7.7 24.9s 14.8s 10.5s 41.98% 0.00% 7.7 (7.7) 11.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 184.9s
  • trigger_min/max:0.8s / 183.2s
  • trigger_pct:15.01%
  • duration_min/max:0.0s / 62.4s
  • uptime_min/max:14.11% / 71.57%

Stack Uptimes

  • rune_mastery_1:41.98%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 39.7 6.6 7.5s 6.4s 2.8s 36.96% 0.00% 6.6 (6.6) 39.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 89.3s
  • trigger_min/max:0.8s / 89.3s
  • trigger_pct:47.99%
  • duration_min/max:0.0s / 23.7s
  • uptime_min/max:20.59% / 53.91%

Stack Uptimes

  • runic_corruption_1:36.96%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 19.6 0.6 14.9s 14.5s 1.4s 9.26% 0.00% 0.6 (0.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.6s / 56.3s
  • trigger_min/max:1.6s / 56.3s
  • trigger_pct:14.14%
  • duration_min/max:0.0s / 9.9s
  • uptime_min/max:2.03% / 21.82%

Stack Uptimes

  • sudden_doom_1:9.26%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.6 0.0 91.7s 91.7s 19.6s 23.70% 29.04% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.9s
  • trigger_min/max:90.0s / 98.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.91% / 26.78%

Stack Uptimes

  • unholy_assault_1:23.70%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Damage increased by {$s4=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing all damage done by {$s4=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Ground 8.5 0.0 36.6s 36.6s 9.9s 27.84% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 131.9s
  • trigger_min/max:10.0s / 131.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.8s
  • uptime_min/max:18.87% / 38.06%

Stack Uptimes

  • unholy_ground_1:27.84%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 12.2 35.8s 14.1s 23.8s 67.71% 0.00% 12.2 (12.2) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 170.3s
  • trigger_min/max:0.0s / 58.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.8s
  • uptime_min/max:42.53% / 89.22%

Stack Uptimes

  • unholy_strength_1:67.71%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 184.3s 184.3s 24.5s 98.06% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.4s / 194.2s
  • trigger_min/max:180.4s / 194.2s
  • trigger_pct:100.00%
  • duration_min/max:21.2s / 25.0s
  • uptime_min/max:90.49% / 98.07%

Stack Uptimes

  • dark_empowerment_1:98.06%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (sizzling_seafood_medley)

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sizzling_seafood_medley
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382154
  • name:Well Fed
  • tooltip:Haste and mastery increased by {$=}w1.
  • description:Increases Haste and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 24.6 9.0 47.0 11.9s 1.6s 156.8s
Rune ready 151.2 117.0 190.0 2.1s 0.0s 13.6s
Runic Corruption from Runic Power Spent 46.3 22.0 71.0 6.4s 0.8s 89.3s
Festering Wound from Festering Strike 56.8 37.0 84.0 13.2s 1.1s 80.1s
Festering Wound from Infected Claws 30.6 13.0 52.0 9.7s 1.0s 95.1s
Festering Wound from Unholy Assault 14.6 12.0 16.0 91.7s 90.0s 98.9s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.00% 0.00% 8.92% 1.5s 0.0s 12.2s
ghoul - Energy Cap 0.31% 0.03% 1.63% 0.1s 0.0s 1.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Raise Dead0.0000.0000.000300.000240.015359.992
Army of the Dead5.6430.000141.18011.2790.000141.180
Summon Gargoyle4.3021.36115.1478.6054.74518.533
Apocalypse2.2470.00016.79715.4758.84530.503
Unholy Assault3.5330.0009.19712.8597.25422.197
Dark Transformation1.4830.00012.35310.3254.77223.298
Empower Rune Weapon31.6850.00075.72175.77968.402100.724
Death and Decay6.6260.00082.32960.0952.371138.008
Soul Reaper13.3300.000234.163207.688162.272255.816
Anti-Magic Shell5.6090.00081.01239.79326.346117.248

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=342210)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1272.030 / 1.3216.29023.008
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
33.50760.15292.613 / 91.410129.916203.126

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
Anti-Magic ShellRunic Power3.1115.400.66%4.950.140.90%
ApocalypseRune13.6412.398.19%0.911.259.17%
Empower Rune WeaponRunic Power11.4756.132.41%4.891.222.13%
Empower Rune WeaponRune11.4710.546.97%0.920.928.06%
Festering WoundRunic Power98.32292.8112.56%2.982.160.73%
Rune RegenerationRune128.25128.2584.83%1.000.000.00%
Runic AttenuationRunic Power71.69351.0115.05%4.907.462.08%
Army of the DeadRunic Power2.0019.700.84%9.850.301.49%
Clawing ShadowsRunic Power71.05710.4830.46%10.000.000.00%
Death and DecayRunic Power8.4684.553.63%10.000.000.00%
Festering StrikeRunic Power22.73454.5919.49%20.000.000.00%
OutbreakRunic Power11.62112.394.82%9.673.853.31%
Soul ReaperRunic Power15.40147.756.34%9.596.244.05%
Summon GargoyleRunic Power2.0087.323.74%43.6612.6812.68%
pet - ghoul
Dark TransformationEnergy6.94312.227.76%44.98381.8555.02%
Energy RegenEnergy1345.873710.3692.24%2.7619.800.53%
pet - army_ghoul
Energy RegenEnergy838.636823.12100.00%8.14544.717.39%
pet - apoc_ghoul
Energy RegenEnergy674.335251.80100.00%7.791550.1022.79%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.30%1.001.00924940.43
Clawing ShadowsRune 71.0571.0546.14%1.001.0033360.71
Death and DecayRune 8.468.465.49%1.001.009600.23
Death CoilRunic Power 96.412306.24100.00%23.9223.921233.59
Festering StrikeRune 22.7345.4629.52%2.002.0010335.81
OutbreakRune 11.6211.627.55%1.001.002253.37
Soul ReaperRune 15.4015.4010.00%1.001.0080459.23
pet - ghoul
ClawEnergy 39.321572.9838.45%40.0040.0082.57
Sweeping ClawsEnergy 62.942517.6361.55%40.0040.00237.64
pet - army_ghoul
ClawEnergy 204.448177.72100.00%40.0040.0027.17
pet - apoc_ghoul
ClawEnergy 189.877594.89100.00%40.0040.0039.31
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 327940.0 757.91 873.39 260932.5 293296.4 -37499.6 327940.0
Runic Power 8.0 7.77 7.69 34.1 23.9 0.0 87.0
Rune 5.0 0.50 0.51 0.0 3.2 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 56944.84
Minimum 50211.68
Maximum 64619.13
Spread ( max - min ) 14407.45
Range [ ( max - min ) / 2 * 100% ] 12.65%
Standard Deviation 1977.5060
5th Percentile 54001.91
95th Percentile 60463.28
( 95th Percentile - 5th Percentile ) 6461.37
Mean Distribution
Standard Deviation 22.8358
95.00% Confidence Interval ( 56900.08 - 56989.59 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4633
0.1 Scale Factor Error with Delta=300 33383
0.05 Scale Factor Error with Delta=300 133531
0.01 Scale Factor Error with Delta=300 3338254
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 56944.84
Minimum 50211.68
Maximum 64619.13
Spread ( max - min ) 14407.45
Range [ ( max - min ) / 2 * 100% ] 12.65%
Standard Deviation 1977.5060
5th Percentile 54001.91
95th Percentile 60463.28
( 95th Percentile - 5th Percentile ) 6461.37
Mean Distribution
Standard Deviation 22.8358
95.00% Confidence Interval ( 56900.08 - 56989.59 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4633
0.1 Scale Factor Error with Delta=300 33383
0.05 Scale Factor Error with Delta=300 133531
0.01 Scale Factor Error with Delta=300 3338254
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 56944.84
Minimum 50211.68
Maximum 64619.13
Spread ( max - min ) 14407.45
Range [ ( max - min ) / 2 * 100% ] 12.65%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 9541396.21
Minimum 7236697.27
Maximum 12077390.88
Spread ( max - min ) 4840693.60
Range [ ( max - min ) / 2 * 100% ] 25.37%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 872.62
Minimum 0.00
Maximum 2460.40
Spread ( max - min ) 2460.40
Range [ ( max - min ) / 2 * 100% ] 140.98%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 755.74
Minimum 0.00
Maximum 1776.23
Spread ( max - min ) 1776.23
Range [ ( max - min ) / 2 * 100% ] 117.52%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2,if=!equipped.fyralath_the_dreamrender|raid_event.adds.exists
6 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
7 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
A 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
B 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
E 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
F 0.00 variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
Default action list Executed every time the actor is available.
# count action,conditions
G 1.00 auto_attack
H 0.00 call_action_list,name=variables
Call Action Lists
I 0.00 call_action_list,name=high_prio_actions
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=racials
L 0.00 run_action_list,name=garg_setup,if=variable.garg_setup_complete=0
M 0.00 call_action_list,name=cooldowns,if=variable.st_planning
N 0.00 call_action_list,name=aoe_cooldowns,if=variable.adds_remain
O 0.00 call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
P 0.00 call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
Q 0.00 call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
R 0.00 call_action_list,name=st,if=active_enemies<=3
actions.cooldowns
# count action,conditions
S 1.00 summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
ST/Cleave Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
T 5.94 dark_transformation,if=cooldown.apocalypse.remains<5
U 5.82 apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
V 2.09 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 abomination_limb,if=rune<3&variable.st_planning
W 3.34 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
X 15.40 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.garg_setup
# count action,conditions
Y 1.00 apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)
Garg Setup
0.00 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
Z 1.00 any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>1
a 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
b 0.30 empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=23
c 0.30 unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=23
d 1.00 dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
e 1.00 festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
0.00 death_coil,if=rune<=1
actions.high_prio_actions
# count action,conditions
0.00 mind_freeze,if=target.debuff.casting.react
Priority Actions
f 6.96 antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
0.00 antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle))
0.00 antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
0.00 invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=22|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.army_ghoul.remains<=18|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+10>cooldown.invoke_external_buff_power_infusion.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
g 1.46 potion,if=(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
h 1.00 army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
i 6.95 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|cooldown.unholy_assault.ready|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains|!talent.summon_gargoyle)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
j 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd&time>15|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration+3
k 2.00 berserking,if=(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(18>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=18|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|active_enemies>=2&death_and_decay.ticking)|fight_remains<=18
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration+3
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.st
# count action,conditions
l 81.39 death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
Single Target
0.00 epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
m 7.46 any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)
n 70.82 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
o 21.73 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4
p 8.07 death_coil
q 0.22 wound_spender,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack>=4
actions.trinkets
# count action,conditions
0.00 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&(active_enemies<5|active_enemies>21|fight_remains<4)&(debuff.festering_wound.stack>=2|time>15)
Trinkets
r 2.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<16|!talent.summon_gargoyle&pet.army_ghoul.active&pet.army_ghoul.remains<16)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(variable.damage_trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
s 2.74 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(variable.damage_trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGjreZdagiifibcYlnlnnkmolnnlnojllnlnollnlnolslnnlnnlollnlolfjTlnmUnolnlllnnonlpnjllolnnpnnfplponTnpWUjllmnlolnllnnlnnlonlnfjlnnppnoTpmpUlolnsoljnnppnnlnnnllponnlplorhjTSiiifUVWXlmknllXlnlnnXljlnnXlnlnXlollXnnopfTXjUllXlmlnXonnllXnlnpXjllnXlosflXnTlXWUmlXnjllXnlno

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 4 raise_dead PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 5 army_of_the_dead PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 6 trinket_1_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat 7 trinket_2_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat A trinket_1_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat B trinket_2_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat E trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat F damage_trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
0:00.000 default G auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
0:00.000 high_prio_actions j outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 bloodlust, corrupting_rage
0:00.000 trinkets r use_item_algethar_puzzle_box Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, corrupting_rage
0:01.354 garg_setup e festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, algethar_puzzle, corrupting_rage
0:02.371 garg_setup Z death_and_decay Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, algethar_puzzle, corrupting_rage
0:03.388 garg_setup d dark_transformation PR_Death_Knight_Unholy 53.0/100: 53% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_ground, algethar_puzzle, corrupting_rage
0:03.388 garg_setup a summon_gargoyle PR_Death_Knight_Unholy 53.0/100: 53% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:04.356 high_prio_actions g potion Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:04.356 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:05.323 high_prio_actions i death_coil Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_ground, icy_talons, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.290 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 45.0/100: 45% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_ground, icy_talons(2), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.290 high_prio_actions i death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_ground, icy_talons(2), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.257 garg_setup b empower_rune_weapon PR_Death_Knight_Unholy 15.0/100: 15% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.257 garg_setup c unholy_assault Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:08.100 garg_setup Y apocalypse Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:08.942 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.785 st n clawing_shadows Fluffy_Pillow 2.0/100: 2% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:10.628 st l death_coil Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:11.471 st n clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:12.313 st n clawing_shadows Fluffy_Pillow 43.0/100: 43% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.156 racials k berserking PR_Death_Knight_Unholy 56.0/100: 56% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.156 st m death_and_decay Fluffy_Pillow 56.0/100: 56% runic_power
4.0/6: 67% rune		 bloodlust, berserking, antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.960 st o festering_strike Fluffy_Pillow 66.0/100: 66% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:14.725 st l death_coil Fluffy_Pillow 86.0/100: 86% runic_power
1.0/6: 17% rune		 bloodlust, berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:15.491 st n clawing_shadows Fluffy_Pillow 56.0/100: 56% runic_power
1.0/6: 17% rune		 bloodlust, berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:16.257 st n clawing_shadows Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune		 bloodlust, berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:17.023 st l death_coil Fluffy_Pillow 87.0/100: 87% runic_power
2.0/6: 33% rune		 bloodlust, berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:17.788 st n clawing_shadows Fluffy_Pillow 62.0/100: 62% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:18.554 st o festering_strike Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:19.319 high_prio_actions j outbreak Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:20.085 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:20.850 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:21.615 st n clawing_shadows Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:22.381 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:23.147 st n clawing_shadows Fluffy_Pillow 63.0/100: 63% runic_power
5.0/6: 83% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:23.912 st o festering_strike Fluffy_Pillow 76.0/100: 76% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:24.716 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:25.520 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:26.405 st n clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:27.290 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(13), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:28.306 st n clawing_shadows Fluffy_Pillow 58.0/100: 58% runic_power
6.0/6: 100% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:29.322 st o festering_strike Fluffy_Pillow 71.0/100: 71% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:30.339 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:31.355 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 91.0/100: 91% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, corrupting_rage, elemental_potion_of_ultimate_power
0:31.355 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, dragon_games_equipment, corrupting_rage, elemental_potion_of_ultimate_power
0:32.372 st n clawing_shadows Fluffy_Pillow 66.0/100: 66% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, corrupting_rage, elemental_potion_of_ultimate_power
0:33.388 st n clawing_shadows Fluffy_Pillow 79.0/100: 79% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage, elemental_potion_of_ultimate_power
0:34.405 st l death_coil Fluffy_Pillow 92.0/100: 92% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, icy_talons(3), festermight(3), corrupting_rage
0:35.422 st n clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
0:36.439 st n clawing_shadows Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, icy_talons(3), festermight(4), corrupting_rage
0:37.456 st l death_coil Fluffy_Pillow 98.0/100: 98% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, icy_talons(3), festermight(5), corrupting_rage
0:38.473 st o festering_strike Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
0:39.489 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, icy_talons(3), festermight(5), corrupting_rage
0:40.505 st l death_coil Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune		 icy_talons(3), runic_corruption, festermight(5), corrupting_rage
0:41.825 st n clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune		 icy_talons(3), festermight(5)
0:43.146 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(6)
0:44.466 st o festering_strike Fluffy_Pillow 11.0/100: 11% runic_power
5.0/6: 83% rune		 rune_mastery, icy_talons(3), runic_corruption, festermight(6)
0:45.787 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), festermight(6)
0:47.108 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 6.0/100: 6% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), runic_corruption, festermight(6)
0:47.108 high_prio_actions j outbreak Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, icy_talons(3), runic_corruption, festermight(6)
0:48.428 cooldowns T dark_transformation PR_Death_Knight_Unholy 16.0/100: 16% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, icy_talons(3)
0:49.748 st l death_coil Fluffy_Pillow 21.0/100: 21% runic_power
5.0/6: 83% rune		 antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead
0:51.069 st n clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
5.0/6: 83% rune		 antimagic_shell, icy_talons(3), dark_transformation, commander_of_the_dead
0:52.388 st m death_and_decay Fluffy_Pillow 39.0/100: 39% runic_power
4.0/6: 67% rune		 antimagic_shell, icy_talons(3), dark_transformation, festermight, commander_of_the_dead
0:53.709 cooldowns U apocalypse Fluffy_Pillow 54.0/100: 54% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, festermight, commander_of_the_dead
0:54.966 st n clawing_shadows Fluffy_Pillow 66.0/100: 66% runic_power
5.0/6: 83% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead
0:56.224 st o festering_strike Fluffy_Pillow 79.0/100: 79% runic_power
5.0/6: 83% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
0:57.480 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
0:58.737 st n clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
0:59.995 st l death_coil Fluffy_Pillow 83.0/100: 83% runic_power
2.0/6: 33% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
1:01.253 st l death_coil Fluffy_Pillow 53.0/100: 53% runic_power
2.0/6: 33% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
1:02.511 st l death_coil Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(7), commander_of_the_dead, corrupting_rage
1:03.831 st n clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
1:05.152 st n clawing_shadows Fluffy_Pillow 46.0/100: 46% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, corrupting_rage
1:06.472 st o festering_strike Fluffy_Pillow 59.0/100: 59% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, corrupting_rage
1:07.793 st n clawing_shadows Fluffy_Pillow 79.0/100: 79% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, corrupting_rage
1:09.114 st l death_coil Fluffy_Pillow 92.0/100: 92% runic_power
0.0/6: 0% rune		 icy_talons(3), festermight(10), commander_of_the_dead, corrupting_rage
1:10.435 st p death_coil Fluffy_Pillow 67.0/100: 67% runic_power
0.0/6: 0% rune		 icy_talons(3), runic_corruption, festermight(10), commander_of_the_dead, corrupting_rage
1:11.756 st n clawing_shadows Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune		 icy_talons(3), commander_of_the_dead, corrupting_rage
1:13.077 high_prio_actions j outbreak Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
1:14.397 st l death_coil Fluffy_Pillow 60.0/100: 60% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
1:15.718 st l death_coil Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
1:17.039 st o festering_strike Fluffy_Pillow 0.0/100: 0% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight, commander_of_the_dead, corrupting_rage
1:18.360 st l death_coil Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight, commander_of_the_dead, corrupting_rage
1:19.680 st n clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight, corrupting_rage
1:21.001 st n clawing_shadows Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
1:22.322 st p death_coil Fluffy_Pillow 51.0/100: 51% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(3), corrupting_rage
1:23.643 Waiting     0.844s 26.0/100: 26% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(3)
1:24.487 st n clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3)
1:25.808 st n clawing_shadows Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(4)
1:27.128 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 57.0/100: 57% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(5)
1:27.128 st p death_coil Fluffy_Pillow 57.0/100: 57% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(5)
1:28.448 Waiting     0.075s 27.0/100: 27% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(5)
1:28.523 st l death_coil Fluffy_Pillow 27.0/100: 27% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(5)
1:29.844 st p death_coil Fluffy_Pillow 32.0/100: 32% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(5)
1:31.164 Waiting     0.443s 2.0/100: 2% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(5)
1:31.607 st o festering_strike Fluffy_Pillow 2.0/100: 2% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(5)
1:32.927 st n clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3)
1:34.246 cooldowns T dark_transformation PR_Death_Knight_Unholy 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight
1:35.567 st n clawing_shadows Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight, commander_of_the_dead
1:36.888 st p death_coil Fluffy_Pillow 63.0/100: 63% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(2), commander_of_the_dead
1:38.209 cooldowns W unholy_assault Fluffy_Pillow 63.0/100: 63% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(2), commander_of_the_dead, corrupting_rage
1:39.530 cooldowns U apocalypse Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
1:40.851 high_prio_actions j outbreak Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
1:42.170 st l death_coil Fluffy_Pillow 90.0/100: 90% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
1:43.490 st l death_coil Fluffy_Pillow 90.0/100: 90% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
1:44.811 st m death_and_decay Fluffy_Pillow 65.0/100: 65% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
1:46.132 st n clawing_shadows Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
1:47.389 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:48.646 st o festering_strike Fluffy_Pillow 63.0/100: 63% runic_power
4.0/6: 67% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:49.903 st l death_coil Fluffy_Pillow 83.0/100: 83% runic_power
2.0/6: 33% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:51.160 st n clawing_shadows Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:52.417 st l death_coil Fluffy_Pillow 66.0/100: 66% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, corrupting_rage
1:53.672 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
1:54.929 st n clawing_shadows Fluffy_Pillow 11.0/100: 11% runic_power
4.0/6: 67% rune		 icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
1:56.249 st n clawing_shadows Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), unholy_assault, festermight, commander_of_the_dead, corrupting_rage
1:57.569 st l death_coil Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
1:58.890 st n clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), festermight(2), commander_of_the_dead, corrupting_rage
2:00.211 st n clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(3), commander_of_the_dead, corrupting_rage
2:01.532 st l death_coil Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(4), commander_of_the_dead, corrupting_rage
2:02.852 st o festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(4), commander_of_the_dead, corrupting_rage
2:04.172 st n clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(4), commander_of_the_dead, corrupting_rage
2:05.492 st l death_coil Fluffy_Pillow 46.0/100: 46% runic_power
0.0/6: 0% rune		 icy_talons(3), festermight(5), corrupting_rage
2:06.813 st n clawing_shadows Fluffy_Pillow 16.0/100: 16% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(5), corrupting_rage
2:08.134 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 29.0/100: 29% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(6), corrupting_rage
2:08.134 Waiting     1.366s 29.0/100: 29% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
2:09.500 high_prio_actions j outbreak Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
2:10.820 st l death_coil Fluffy_Pillow 39.0/100: 39% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), sudden_doom, festermight(6), corrupting_rage
2:12.141 st n clawing_shadows Fluffy_Pillow 39.0/100: 39% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(6), corrupting_rage
2:13.462 st n clawing_shadows Fluffy_Pillow 52.0/100: 52% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(7), corrupting_rage
2:14.783 st p death_coil Fluffy_Pillow 70.0/100: 70% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), sudden_doom, festermight(8), corrupting_rage
2:16.104 st p death_coil Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, corrupting_rage
2:17.425 st n clawing_shadows Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, corrupting_rage
2:18.746 st o festering_strike Fluffy_Pillow 58.0/100: 58% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight, corrupting_rage
2:20.067 cooldowns T dark_transformation PR_Death_Knight_Unholy 78.0/100: 78% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight, corrupting_rage
2:21.388 st p death_coil Fluffy_Pillow 78.0/100: 78% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, corrupting_rage
2:22.708 st m death_and_decay Fluffy_Pillow 48.0/100: 48% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, corrupting_rage
2:24.029 st p death_coil Fluffy_Pillow 58.0/100: 58% runic_power
2.0/6: 33% rune		 unholy_ground, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, corrupting_rage
2:25.287 cooldowns U apocalypse Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, corrupting_rage
2:26.545 st l death_coil Fluffy_Pillow 45.0/100: 45% runic_power
5.0/6: 83% rune		 unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:27.802 st o festering_strike Fluffy_Pillow 15.0/100: 15% runic_power
5.0/6: 83% rune		 unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(5), commander_of_the_dead, corrupting_rage
2:29.060 st l death_coil Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:30.318 st n clawing_shadows Fluffy_Pillow 5.0/100: 5% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:31.355 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:31.576 st o festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, dragon_games_equipment, corrupting_rage
2:32.834 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, corrupting_rage
2:34.155 high_prio_actions j outbreak Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:35.476 st n clawing_shadows Fluffy_Pillow 53.0/100: 53% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:36.797 st n clawing_shadows Fluffy_Pillow 66.0/100: 66% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
2:38.117 st p death_coil Fluffy_Pillow 79.0/100: 79% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
2:39.438 st p death_coil Fluffy_Pillow 49.0/100: 49% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
2:40.759 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, commander_of_the_dead, corrupting_rage
2:42.079 st n clawing_shadows Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight, commander_of_the_dead, corrupting_rage
2:43.400 st l death_coil Fluffy_Pillow 50.0/100: 50% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(2), commander_of_the_dead, corrupting_rage
2:44.721 st n clawing_shadows Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(2), commander_of_the_dead, corrupting_rage
2:46.042 st n clawing_shadows Fluffy_Pillow 63.0/100: 63% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(3), commander_of_the_dead, corrupting_rage
2:47.362 st n clawing_shadows Fluffy_Pillow 76.0/100: 76% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(4), commander_of_the_dead, corrupting_rage
2:48.683 st l death_coil Fluffy_Pillow 89.0/100: 89% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(5), commander_of_the_dead, corrupting_rage
2:50.004 st l death_coil Fluffy_Pillow 89.0/100: 89% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(5), commander_of_the_dead, corrupting_rage
2:51.325 st p death_coil Fluffy_Pillow 64.0/100: 64% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(5), corrupting_rage
2:52.646 st o festering_strike Fluffy_Pillow 34.0/100: 34% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
2:53.967 st n clawing_shadows Fluffy_Pillow 59.0/100: 59% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(5), corrupting_rage
2:55.287 st n clawing_shadows Fluffy_Pillow 72.0/100: 72% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(6), corrupting_rage
2:56.608 st l death_coil Fluffy_Pillow 90.0/100: 90% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(7), corrupting_rage
2:57.928 st p death_coil Fluffy_Pillow 60.0/100: 60% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(7), corrupting_rage
2:59.249 st l death_coil Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), runic_corruption, festermight(7), corrupting_rage
3:00.570 st o festering_strike Fluffy_Pillow 0.0/100: 0% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), festermight(7)
3:01.386 trinkets r use_item_algethar_puzzle_box Fluffy_Pillow 20.0/100: 20% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3)
3:03.146 high_prio_actions h army_of_the_dead PR_Death_Knight_Unholy 20.0/100: 20% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), algethar_puzzle
3:04.465 high_prio_actions j outbreak Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune		 icy_talons(3), algethar_puzzle
3:05.786 cooldowns T dark_transformation PR_Death_Knight_Unholy 45.0/100: 45% runic_power
0.0/6: 0% rune		 icy_talons(3), algethar_puzzle
3:07.106 cooldowns S summon_gargoyle PR_Death_Knight_Unholy 50.0/100: 50% runic_power
0.0/6: 0% rune		 icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle
3:07.106 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune		 icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle
3:08.427 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle
3:09.748 high_prio_actions i death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle
3:11.069 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 40.0/100: 40% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle
3:11.069 cooldowns U apocalypse Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 antimagic_shell, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle
3:12.390 cooldowns V empower_rune_weapon PR_Death_Knight_Unholy 62.0/100: 62% runic_power
5.0/6: 83% rune		 antimagic_shell, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead, algethar_puzzle
3:12.390 cooldowns W unholy_assault Fluffy_Pillow 67.0/100: 67% runic_power
6.0/6: 100% rune		 antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead, algethar_puzzle
3:13.539 cooldowns X soul_reaper Fluffy_Pillow 67.0/100: 67% runic_power
6.0/6: 100% rune		 antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:14.688 st l death_coil Fluffy_Pillow 82.0/100: 82% runic_power
5.0/6: 83% rune		 antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:15.837 st m death_and_decay Fluffy_Pillow 57.0/100: 57% runic_power
5.0/6: 83% rune		 antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:16.986 racials k berserking PR_Death_Knight_Unholy 67.0/100: 67% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:16.986 st n clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
4.0/6: 67% rune		 berserking, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:17.981 st l death_coil Fluffy_Pillow 85.0/100: 85% runic_power
5.0/6: 83% rune		 berserking, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:18.976 st l death_coil Fluffy_Pillow 60.0/100: 60% runic_power
5.0/6: 83% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:19.971 cooldowns X soul_reaper Fluffy_Pillow 30.0/100: 30% runic_power
5.0/6: 83% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:20.966 st l death_coil Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:21.960 st n clawing_shadows Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:22.954 st l death_coil Fluffy_Pillow 33.0/100: 33% runic_power
5.0/6: 83% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:23.949 st n clawing_shadows Fluffy_Pillow 3.0/100: 3% runic_power
5.0/6: 83% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:24.944 st n clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:25.938 cooldowns X soul_reaper Fluffy_Pillow 34.0/100: 34% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:27.016 st l death_coil Fluffy_Pillow 49.0/100: 49% runic_power
3.0/6: 50% rune		 berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:28.061 high_prio_actions j outbreak Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:29.106 st l death_coil Fluffy_Pillow 39.0/100: 39% runic_power
3.0/6: 50% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:30.255 st n clawing_shadows Fluffy_Pillow 9.0/100: 9% runic_power
3.0/6: 50% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:31.403 st n clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:32.552 cooldowns X soul_reaper Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:33.873 st l death_coil Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
3:35.193 st n clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
3:36.514 st l death_coil Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
3:37.834 st n clawing_shadows Fluffy_Pillow 13.0/100: 13% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
3:39.154 cooldowns X soul_reaper Fluffy_Pillow 31.0/100: 31% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:40.474 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:41.795 st o festering_strike Fluffy_Pillow 16.0/100: 16% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
3:43.115 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(3), corrupting_rage
3:44.435 st l death_coil Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), sudden_doom, festermight(3), corrupting_rage
3:45.755 cooldowns X soul_reaper Fluffy_Pillow 11.0/100: 11% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
3:47.075 st n clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), festermight(3), corrupting_rage
3:48.396 st n clawing_shadows Fluffy_Pillow 39.0/100: 39% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), festermight(4), corrupting_rage
3:49.716 st o festering_strike Fluffy_Pillow 52.0/100: 52% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), festermight(5), corrupting_rage
3:51.037 st p death_coil Fluffy_Pillow 77.0/100: 77% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(5), corrupting_rage
3:52.357 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 47.0/100: 47% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), corrupting_rage
3:52.357 cooldowns T dark_transformation PR_Death_Knight_Unholy 47.0/100: 47% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, icy_talons(3), corrupting_rage
3:53.677 cooldowns X soul_reaper Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:54.998 high_prio_actions j outbreak Fluffy_Pillow 62.0/100: 62% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:56.318 cooldowns U apocalypse Fluffy_Pillow 72.0/100: 72% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:57.638 st l death_coil Fluffy_Pillow 84.0/100: 84% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
3:58.959 st l death_coil Fluffy_Pillow 54.0/100: 54% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:00.279 cooldowns X soul_reaper Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:01.599 st l death_coil Fluffy_Pillow 39.0/100: 39% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:02.920 st m death_and_decay Fluffy_Pillow 9.0/100: 9% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead, corrupting_rage
4:04.241 st l death_coil Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(4), commander_of_the_dead, corrupting_rage
4:05.499 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:06.757 cooldowns X soul_reaper Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:08.014 st o festering_strike Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:09.272 st n clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
1.0/6: 17% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:10.529 st n clawing_shadows Fluffy_Pillow 80.0/100: 80% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
4:11.786 st l death_coil Fluffy_Pillow 98.0/100: 98% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_ground, icy_talons(3), sudden_doom, festermight(7), commander_of_the_dead, corrupting_rage
4:13.044 st l death_coil Fluffy_Pillow 98.0/100: 98% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(7), commander_of_the_dead, corrupting_rage
4:14.365 cooldowns X soul_reaper Fluffy_Pillow 68.0/100: 68% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(7), commander_of_the_dead, corrupting_rage
4:15.686 st n clawing_shadows Fluffy_Pillow 78.0/100: 78% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(7), commander_of_the_dead, corrupting_rage
4:17.007 st l death_coil Fluffy_Pillow 96.0/100: 96% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
4:18.327 st n clawing_shadows Fluffy_Pillow 66.0/100: 66% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, commander_of_the_dead, corrupting_rage
4:19.647 st p death_coil Fluffy_Pillow 79.0/100: 79% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
4:20.967 cooldowns X soul_reaper Fluffy_Pillow 49.0/100: 49% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
4:22.288 high_prio_actions j outbreak Fluffy_Pillow 59.0/100: 59% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
4:23.607 st l death_coil Fluffy_Pillow 69.0/100: 69% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight, corrupting_rage
4:24.928 st l death_coil Fluffy_Pillow 39.0/100: 39% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight, corrupting_rage
4:26.249 st n clawing_shadows Fluffy_Pillow 9.0/100: 9% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight, corrupting_rage
4:27.570 cooldowns X soul_reaper Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
4:28.891 st l death_coil Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
4:30.211 Waiting     0.699s 7.0/100: 7% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
4:30.910 st o festering_strike Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
4:31.355 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 27.0/100: 27% runic_power
0.0/6: 0% rune		 icy_talons(3), festermight(2), corrupting_rage
4:32.231 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 32.0/100: 32% runic_power
0.0/6: 0% rune		 icy_talons(3), festermight(2), corrupting_rage
4:32.357 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
0.0/6: 0% rune		 antimagic_shell, icy_talons(3), festermight(2), corrupting_rage
4:33.677 Waiting     1.384s 2.0/100: 2% runic_power
0.0/6: 0% rune		 antimagic_shell, icy_talons(3), festermight(2), corrupting_rage
4:35.061 cooldowns X soul_reaper Fluffy_Pillow 2.0/100: 2% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), festermight(2), corrupting_rage
4:36.381 st n clawing_shadows Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, icy_talons(3), festermight(2), corrupting_rage
4:37.701 cooldowns T dark_transformation PR_Death_Knight_Unholy 30.0/100: 30% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, icy_talons(3), festermight(3), corrupting_rage
4:39.022 st l death_coil Fluffy_Pillow 30.0/100: 30% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
4:40.343 Waiting     0.544s 0.0/100: 0% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, corrupting_rage
4:40.887 cooldowns X soul_reaper Fluffy_Pillow 0.0/100: 0% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, corrupting_rage
4:42.381 cooldowns W unholy_assault Fluffy_Pillow 10.0/100: 10% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
4:43.711 cooldowns U apocalypse Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:45.032 st m death_and_decay Fluffy_Pillow 22.0/100: 22% runic_power
4.0/6: 67% rune		 icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:46.353 st l death_coil Fluffy_Pillow 37.0/100: 37% runic_power
4.0/6: 67% rune		 unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:47.611 cooldowns X soul_reaper Fluffy_Pillow 37.0/100: 37% runic_power
4.0/6: 67% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:48.869 st n clawing_shadows Fluffy_Pillow 52.0/100: 52% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:50.127 high_prio_actions j outbreak Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:51.385 st l death_coil Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:52.643 st l death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:53.899 cooldowns X soul_reaper Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:55.157 st n clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:56.478 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
4:57.799 st n clawing_shadows Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
4:59.120 st o festering_strike Fluffy_Pillow 26.0/100: 26% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6014 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3848 0 16397 15616 9166
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 327940 312320 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 21.57% 15.36% 1504
Haste 13.88% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6315 5922 0
Mastery 44.93% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +923 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +923 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Talents

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowUnholy Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=sizzling_seafood_medley
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2,if=!equipped.fyralath_the_dreamrender|raid_event.adds.exists
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
actions.precombat+=/variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl

# Executed every time the actor is available.
actions=auto_attack
# Call Action Lists
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup_complete=0
actions+=/call_action_list,name=cooldowns,if=variable.st_planning
actions+=/call_action_list,name=aoe_cooldowns,if=variable.adds_remain
actions+=/call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
actions+=/call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
actions+=/call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
actions+=/call_action_list,name=st,if=active_enemies<=3

# Generic AoE
actions.aoe=epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# AoE Burst
actions.aoe_burst=epidemic,if=(rune<1|talent.bursting_sores&death_knight.fwounded_targets=0|!talent.bursting_sores)&!variable.pooling_runic_power&(active_enemies>=6|runic_power.deficit<30|buff.festermight.stack=20)
actions.aoe_burst+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=1
actions.aoe_burst+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_burst+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe_burst+=/wound_spender

# AoE Cooldowns
actions.aoe_cooldowns=vile_contagion,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.aoe_cooldowns+=/summon_gargoyle
actions.aoe_cooldowns+=/abomination_limb,if=rune<2|buff.festermight.stack>10|!talent.festermight|buff.festermight.up&buff.festermight.remains<12
actions.aoe_cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=talent.bursting_sores&debuff.festering_wound.up&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
actions.aoe_cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=!talent.bursting_sores&debuff.festering_wound.stack>=4|set_bonus.tier31_2pc&debuff.festering_wound.stack>=1
actions.aoe_cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.stack<=2|buff.dark_transformation.up
actions.aoe_cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.aoe_cooldowns+=/dark_transformation,if=(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.aoe_cooldowns+=/empower_rune_weapon,if=buff.dark_transformation.up
actions.aoe_cooldowns+=/sacrificial_pact,if=!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# AoE Setup
actions.aoe_setup=any_dnd,if=(!talent.bursting_sores|death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets>=8|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5)
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies&talent.bursting_sores
actions.aoe_setup+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies
actions.aoe_setup+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=cooldown.apocalypse.remains<variable.apoc_timing&debuff.festering_wound.stack<4
actions.aoe_setup+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# ST/Cleave Cooldowns
actions.cooldowns=summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=cooldown.apocalypse.remains<5
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)

# Garg Setup
actions.garg_setup=apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.garg_setup+=/any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>1
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
actions.garg_setup+=/empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=23
actions.garg_setup+=/unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=23
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
actions.garg_setup+=/festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
actions.garg_setup+=/death_coil,if=rune<=1

# Priority Actions
actions.high_prio_actions=mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
actions.high_prio_actions+=/antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle))
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
actions.high_prio_actions+=/invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=22|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.army_ghoul.remains<=18|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+10>cooldown.invoke_external_buff_power_infusion.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))
actions.high_prio_actions+=/potion,if=(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
actions.high_prio_actions+=/army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
actions.high_prio_actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|cooldown.unholy_assault.ready|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
actions.high_prio_actions+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains|!talent.summon_gargoyle)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
actions.high_prio_actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd&time>15|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration+3
actions.racials+=/berserking,if=(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(18>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=18|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|active_enemies>=2&death_and_decay.ticking)|fight_remains<=18
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration+3
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Single Target
actions.st=death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
actions.st+=/epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
actions.st+=/any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)
actions.st+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.st+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4
actions.st+=/death_coil
actions.st+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack>=4

# Trinkets
actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&(active_enemies<5|active_enemies>21|fight_remains<4)&(debuff.festering_wound.stack>=2|time>15)
actions.trinkets+=/use_item,use_off_gcd=1,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<16|!talent.summon_gargoyle&pet.army_ghoul.active&pet.army_ghoul.remains<16)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(variable.damage_trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(variable.damage_trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
actions.variables+=/variable,name=garg_setup_complete,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&(cooldown.apocalypse.remains>1|!talent.apocalypse)|!talent.summon_gargoyle|time>20
actions.variables+=/variable,name=apoc_timing,op=setif,value=7,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
actions.variables+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
actions.variables+=/variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4|set_bonus.tier31_4pc&(pet.apoc_magus.active|pet.army_magus.active)&debuff.festering_wound.stack>=1)|fight_remains<5&debuff.festering_wound.stack>=1
actions.variables+=/variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions.variables+=/variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies=1&(!raid_event.adds.exists|raid_event.adds.in>15)
actions.variables+=/variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
actions.variables+=/variable,name=spend_rp,op=setif,value=1,value_else=0,condition=(!talent.rotten_touch|talent.rotten_touch&!debuff.rotten_touch.up|runic_power.deficit<20)&(!set_bonus.tier31_4pc|set_bonus.tier31_4pc&!(pet.apoc_magus.active|pet.army_magus.active)|runic_power.deficit<20|rune<3)&((talent.improved_death_coil&(active_enemies=2|talent.coil_of_devastation)|rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3|!variable.pop_wounds&debuff.festering_wound.stack>=4))

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=9166
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 18218 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
18218.0 18218.0 10.9 / 0.060% 1873.6 / 10.3% 176.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
100.4 99.8 Mana 0.00% 51.8 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 18218
Devouring Plague 4394 24.1% 20.9 14.28s 62833 53976 Direct 20.9 25039 50181 28380 13.3%
Periodic 65.0 9798 19583 11109 13.4% 41.4%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.95 20.95 64.97 64.97 0.00 1.1641 1.9094 1316309.64 1316309.64 0.00% 8867.02 53975.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.71% 18.17 10 25 25039.10 23608 34132 25043.62 23885 26535 454847 454847 0.00%
crit 13.29% 2.78 0 10 50180.65 47215 68264 47634.43 0 68264 139696 139696 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.61% 56.27 37 75 9797.74 2435 16211 9800.25 9083 10562 551340 551340 0.00%
crit 13.39% 8.70 0 21 19582.96 4870 32421 19582.30 0 29473 170427 170427 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.912450
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.06

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.908300
  • base_td:0.00
  • base_td_mult:1.06
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 191.2%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [K]:20.95
  • if_expr:remains<=gcd.max|insanity.deficit<=16
  • target_if_expr:!talent.distorted_reality|active_enemies=1|remains<=gcd.max

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Percent Cost Mind Devourer3732041-1.000Spell Data
Mind Blast 2681 14.7% 35.8 8.44s 22448 19174 Direct 35.8 19806 39691 22449 13.3%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.81 35.81 0.00 0.00 0.00 1.1707 0.0000 803843.32 803843.32 0.00% 19174.28 19174.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.71% 31.05 19 42 19805.97 18267 28539 19810.91 19144 20739 614988 614988 0.00%
crit 13.29% 4.76 0 14 39691.44 36535 57078 39429.61 0 52047 188855 188855 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:625.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.16

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage{$?s424509=false}[ and increases your spell damage to the target by {$424509s1=10}% for {$214621d=9 seconds}.][.]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s2=0}/100} Insanity.|r][]

Action Priority List

    main
    [M]:35.95
  • if_expr:(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703313PCT0.490
Spell Direct AmountShadow Priest13703322PCT0.370
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Mind Spike 6680 36.7% 176.8 1.68s 11327 9679 Direct 176.8 9998 20025 11327 13.3%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 176.77 176.77 0.00 0.00 0.00 1.1703 0.0000 2002322.34 2002322.34 0.00% 9679.18 9679.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.74% 153.34 110 195 9997.61 9238 14432 10000.33 9727 10440 1532988 1532988 0.00%
crit 13.26% 23.44 8 44 20025.04 18476 28864 20030.82 18578 21705 469335 469335 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.808652
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.06

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage. |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity.|r

Action Priority List

    filler
    [H]:177.42
  • target_if_expr:dot.devouring_plague.remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Shadow Weaving 61 0.3% 33.0 6.42s 546 0 Direct 33.0 546 0 546 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.00 33.00 0.00 0.00 0.00 0.0000 0.0000 18003.69 18003.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 33.00 33 33 545.56 326 1603 545.57 472 679 18004 18004 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:325.81
  • base_dd_max:325.81
  • base_dd_mult:1.06

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Shadow Word: Death 855 4.7% 6.2 10.33s 41334 34130 Direct 6.2 36286 73094 41335 13.7%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.20 6.20 0.00 0.00 0.00 1.2112 0.0000 256114.47 256114.47 0.00% 34130.39 34130.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.28% 5.35 1 8 36285.79 31539 49273 36312.76 31539 44930 193994 193994 0.00%
crit 13.72% 0.85 0 5 73094.24 63077 98545 43088.73 0 98545 62121 62121 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.98

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to your target. If your target is not killed by Shadow Word: Death, you take backlash damage equal to {$s5=8}% of your maximum health.{$?=}A364675[ Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][ Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s4=0}/100} Insanity.|r][]

Action Priority List

    filler
    [G]:6.21
  • target_if_expr:target.health.pct<20|(buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703315PCT0.600
Spell Direct AmountShadow Priest13703320PCT-0.420
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Soulseeker Arrow 1041 5.7% 7.0 37.97s 44470 0 Periodic 79.7 3916 0 3916 0.0% 37.6%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.02 0.00 79.71 79.71 2.34 0.0000 1.4164 312123.70 312123.70 0.00% 2764.68 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 79.71 14 162 3915.94 121 4407 3912.00 3803 4119 312124 312124 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3629.20
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1730}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 2010 11.0% 13.5 21.05s 44677 37953 Periodic 127.8 4160 8333 4713 13.3% 99.4%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.48 0.00 127.82 127.82 13.48 1.1772 2.3335 602461.01 602461.01 0.00% 1917.83 37952.69
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.73% 110.86 79 143 4159.63 9 5947 4160.72 4009 4338 461133 461133 0.00%
crit 13.27% 16.96 4 36 8333.38 19 11895 8335.93 7192 9459 141328 141328 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.59
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [L]:13.48
  • if_expr:refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
  • target_if_expr:remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Periodic AmountShadow Priest1370334PCT0.500
Spell Direct AmountShadow Priest1370335PCT0.500
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
pet - shadowfiend 4197 / 496
melee 4197 2.7% 33.0 6.42s 4451 4303 Direct 33.0 3937 7871 4451 13.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.00 33.00 0.00 0.00 0.00 1.0344 0.0000 146892.08 146892.08 0.00% 4303.39 4303.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.93% 28.69 20 33 3936.89 3718 4573 3936.74 3815 4271 112932 112932 0.00%
crit 13.07% 4.31 0 13 7870.98 7435 9147 7808.86 0 9147 33960 33960 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 1.0 0.00s

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    cds
    [E]:1.00
  • if_expr:buff.power_infusion.up|fight_remains<=15
Devouring Plague (_heal) 85.9 3.41s

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 85.92 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 191.2%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Percent Cost Mind Devourer3732041-1.000Spell Data
Phial of Static Empowerment 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [D]:1.00
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Shadowfiend 2.0 0.00s

Stats Details: Shadowfiend

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0791 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowfiend

  • id:34433
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:343726
  • description:Summons a shadowy fiend to attack the target for {$d=15 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$262485s1=200}/100} Insanity each time the Shadowfiend attacks.|r][ |cFFFFFFFFGenerates {$=}{{$s4=5}/10}.1% Mana each time the Shadowfiend attacks.|r]

Action Priority List

    main
    [J]:2.00
  • if_expr:variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
Shadowform 1.0 0.00s

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 1.0 0.00s

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 127.8 2.33s

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 127.82 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Periodic AmountShadow Priest1370334PCT0.500
Spell Direct AmountShadow Priest1370335PCT0.500
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 1.0 0.0 0.0s 0.0s 14.4s 4.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.5s / 15.0s
  • uptime_min/max:3.80% / 6.24%

Stack Uptimes

  • blood_fury_1:4.86%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Devoured Pride 1.0 0.0 0.0s 0.0s 15.0s 5.07% 5.84% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s
  • uptime_min/max:4.17% / 6.25%

Stack Uptimes

  • devoured_pride_1:5.07%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0s 0.0s 29.4s 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.5s / 30.0s
  • uptime_min/max:8.00% / 12.49%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0s 0.0s 300.0s 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 61.0s 46.0s 16.5s 23.63% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 219.9s
  • trigger_min/max:0.0s / 207.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.6s
  • uptime_min/max:5.06% / 57.47%

Stack Uptimes

  • sophic_devotion_1:23.63%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.2 0.0 0.0s 0.0s 19.4s 1.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.29%

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:1.62%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.3 0.0 0.0s 0.0s 19.4s 1.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.30%

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:1.67%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.2 0.0 0.0s 0.0s 19.4s 1.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.32%

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:1.60%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.3 0.0 0.0s 0.0s 19.4s 1.66% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.31%

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:1.66%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0s 0.0s 300.0s 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:Primary stat is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Idol of Y'Shaarj Devoured Violence procs 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 85.32% 83.20% 87.10% 6.3s 0.0s 9.1s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Shadow Word: Death39.1800.000289.267242.786192.887294.315
Shadowfiend0.3500.0000.7280.7000.6690.728
Mind Blast0.253-0.0001.9039.1907.82312.984

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Mana RegenMana716.0729954.61100.00%41.83736822.1796.09%
ShadowfiendInsanity33.0066.006.16%2.000.000.00%
Mind BlastInsanity35.81214.8520.07%6.000.000.00%
Mind SpikeInsanity176.77707.0966.04%4.000.000.00%
Shadow Word: DeathInsanity6.2024.782.31%4.000.000.00%
Vampiric TouchInsanity14.4857.945.41%4.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 20.951047.47100.00%50.0050.001256.66
Mind BlastMana 35.8122380.5274.29%625.00625.0035.92
Shadow Word: DeathMana 6.207745.1325.71%1250.001249.9933.07
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 273300.0 362.97 431.19 466735.8 252832.6 224431.1 273300.0
Mana 250000.0 99.85 100.42 736821.9 249828.9 248130.1 250000.0
Insanity 4.0 3.57 3.49 0.0 23.2 0.0 52.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 18217.97
Minimum 16642.19
Maximum 20206.82
Spread ( max - min ) 3564.64
Range [ ( max - min ) / 2 * 100% ] 9.78%
Standard Deviation 479.7328
5th Percentile 17471.36
95th Percentile 19044.96
( 95th Percentile - 5th Percentile ) 1573.60
Mean Distribution
Standard Deviation 5.5398
95.00% Confidence Interval ( 18207.11 - 18228.82 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2664
0.1 Scale Factor Error with Delta=300 1965
0.05 Scale Factor Error with Delta=300 7859
0.01 Scale Factor Error with Delta=300 196464
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 18217.97
Minimum 16642.19
Maximum 20206.82
Spread ( max - min ) 3564.64
Range [ ( max - min ) / 2 * 100% ] 9.78%
Standard Deviation 479.7328
5th Percentile 17471.36
95th Percentile 19044.96
( 95th Percentile - 5th Percentile ) 1573.60
Mean Distribution
Standard Deviation 5.5398
95.00% Confidence Interval ( 18207.11 - 18228.82 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2664
0.1 Scale Factor Error with Delta=300 1965
0.05 Scale Factor Error with Delta=300 7859
0.01 Scale Factor Error with Delta=300 196464
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 18217.97
Minimum 16642.19
Maximum 20206.82
Spread ( max - min ) 3564.64
Range [ ( max - min ) / 2 * 100% ] 9.78%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 5311178.18
Minimum 4059390.26
Maximum 6674843.65
Spread ( max - min ) 2615453.39
Range [ ( max - min ) / 2 * 100% ] 24.62%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 431.14
Minimum 374.47
Maximum 489.70
Spread ( max - min ) 115.23
Range [ ( max - min ) / 2 * 100% ] 13.36%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 363.11
Minimum 286.12
Maximum 447.95
Spread ( max - min ) 161.84
Range [ ( max - min ) / 2 * 100% ] 22.28%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 shadowform,if=!buff.shadowform.up
5 0.00 arcane_torrent
6 0.00 shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(!set_bonus.tier31_4pc|spell_targets.shadow_crash>1)
7 0.00 vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice|set_bonus.tier31_4pc&spell_targets.shadow_crash=1
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=holding_crash,op=set,value=raid_event.adds.in<15
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
8 0.00 run_action_list,name=aoe,if=active_enemies>2
9 0.00 run_action_list,name=main
actions.cds
# count action,conditions
D 1.00 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
TODO: Check VE/DA enter conditions based on dots
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
E 1.00 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 use_item,name=nymues_unraveling_spindle,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<3+gcd.max|fight_remains<15)
Use Nymue's before we go into our cooldowns
0.00 use_item,name=belorrelos_the_suncaller,use_off_gcd=1,if=gcd.remains>0&(!raid_event.adds.exists&!prev_gcd.1.mindbender|raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)|fight_remains<20
Use Belor'relos, the Suncaller before we go into our cooldowns
0.00 divine_star,if=(raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)&equipped.belorrelos_the_suncaller&trinket.belorrelos_the_suncaller.cooldown.remains<=gcd.max
Fit in a Divine Star as you cast Belor's for the free GCD.
0.00 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
Sync Power Infusion with Voidform or Dark Ascension
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
0.00 dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
F 0.00 call_action_list,name=trinkets
0.00 desperate_prayer,if=health.pct<=75
Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.filler
# count action,conditions
0.00 vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
G 6.21 shadow_word_death,target_if=target.health.pct<20|(buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking
0.00 mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=dot.devouring_plague.remains>cast_time
0.00 mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up
0.00 mindgames,target_if=max:dot.devouring_plague.remains
0.00 shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
0.00 halo,if=spell_targets>1
Save up to 20s if adds are coming soon.
H 177.42 mind_spike,target_if=max:dot.devouring_plague.remains
0.00 mind_flay,target_if=max:dot.devouring_plague.remains,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 divine_star
0.00 shadow_crash,if=raid_event.adds.in>20&!set_bonus.tier31_4pc
Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 shadow_word_death,target_if=max:dot.devouring_plague.remains
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain,target_if=max:dot.devouring_plague.remains,if=set_bonus.tier31_4pc
Use Shadow Word: Pain while moving as a low-priority action with T31 4pc
0.00 shadow_word_pain,target_if=min:remains,if=!set_bonus.tier31_4pc
Use Shadow Word: Pain while moving as a low-priority action without T31 4pc
actions.main
# count action,conditions
0.00 variable,name=dots_up,op=set,value=active_dot.vampiric_touch=active_enemies|action.shadow_crash.in_flight&talent.whispering_shadows
I 0.00 call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
J 2.00 mindbender,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active and sync with Dark Ascension
K 20.95 devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=remains<=gcd.max|insanity.deficit<=16
0.00 shadow_word_death,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)&dot.devouring_plague.ticking
0.00 mind_blast,target_if=dot.devouring_plague.remains>execute_time&(cooldown.mind_blast.full_recharge_time<=gcd.max+execute_time)|pet.fiend.remains<=execute_time+gcd.max,if=pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>execute_time&active_enemies<=7
High priority Mind Blast action when using Inescapable Torment
0.00 shadow_word_death,target_if=dot.devouring_plague.ticking&pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
0.00 void_bolt,if=variable.dots_up
0.00 devouring_plague,if=fight_remains<=duration+4
Spend your Insanity on Devouring Plague at will if the fight will end in less than 10s
0.00 devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=(remains<=gcd.max|remains<3&cooldown.void_torrent.up)|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2|buff.mind_devourer.up&pmultiplier<1.2
Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
0.00 shadow_word_death,if=set_bonus.tier31_2pc
0.00 shadow_crash,if=!variable.holding_crash&(dot.vampiric_touch.refreshable|buff.deaths_torment.stack>9&set_bonus.tier31_4pc)
Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
0.00 shadow_word_pain,if=buff.deaths_torment.stack>9&set_bonus.tier31_4pc&(!variable.holding_crash|!talent.shadow_crash)
Consume T31 4pc SWPs
0.00 shadow_word_death,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
L 13.48 vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
M 35.95 mind_blast,if=(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
0.00 void_torrent,if=!variable.holding_crash,target_if=dot.devouring_plague.remains>=2.5,interrupt_if=cooldown.shadow_word_death.ready&pet.fiend.active&set_bonus.tier31_2pc
Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
N 0.00 call_action_list,name=filler
Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=(buff.power_infusion.up|fight_remains<20)&equipped.voidmenders_shadowgem
0.00 use_item,name=iridal_the_earths_master,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
0.00 use_item,name=dreambinder_loom_of_the_great_cycle,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno,if=equipped.darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime,if=equipped.darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance,if=equipped.darkmoon_deck_box_dance
0.00 use_item,name=erupting_spear_fragment,if=(buff.power_infusion.up|raid_event.adds.up|fight_remains<20)&equipped.erupting_spear_fragment
Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
0.00 use_item,name=beacon_to_the_beyond,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20)&equipped.beacon_to_the_beyond
Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
O 1.00 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex,if=equipped.desperate_invokers_codex

Sample Sequence

01247JMHHHHHHKMHHHHHHLKMHHHHHHMHHHKHHMHHHHHHLMHKHHHHMHHHHHHMKHLHHHMHHHHHKMHHHHHLMHHHHKHMHHHHHHMHLKHHHMHHHHHHMHKHHLHMHHHHHHMKHHHHHMHLHHHKMHHHHHHMHHHHKLMHHHHHHMHHKHHJMLHHHHHKMHHHHHHKMHLHHHHMHHHHKHMHHHHHLMHHKHHHMHHHGHHMHKLHGHMHHHHHGMKHHHLHDMGHHHHKMHOGHHEHHMHHGHKHMHHH

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 4 shadowform PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 7 vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment
0:00.000 main J shadowfiend Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, static_empowerment
0:00.939 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment
0:01.877 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
16.0/100: 16% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(2)
0:02.816 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(3)
0:03.755 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(4)
0:04.694 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:05.633 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:06.572 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:07.511 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:08.450 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:09.388 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
12.0/100: 12% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:10.327 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:11.266 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:12.205 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:13.143 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:14.082 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:15.021 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:15.960 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:16.899 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:17.838 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:18.777 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:19.716 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:20.655 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:21.593 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:22.532 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:23.471 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:24.409 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
38.0/100: 38% insanity		 bloodlust, shadowform, static_empowerment(5)
0:25.348 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, static_empowerment(5)
0:26.286 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 bloodlust, shadowform, static_empowerment(5)
0:27.224 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 bloodlust, shadowform, static_empowerment(5)
0:28.163 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 bloodlust, shadowform, static_empowerment(5)
0:29.102 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, static_empowerment(5)
0:30.041 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, static_empowerment(5)
0:30.980 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
14.0/100: 14% insanity		 bloodlust, shadowform, static_empowerment(5)
0:31.919 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 bloodlust, shadowform, static_empowerment(5)
0:32.857 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 bloodlust, shadowform, static_empowerment(5)
0:33.796 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 bloodlust, shadowform, static_empowerment(5)
0:34.735 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 bloodlust, shadowform, static_empowerment(5)
0:35.674 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 bloodlust, shadowform, static_empowerment(5)
0:36.613 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 bloodlust, shadowform, static_empowerment(5)
0:37.551 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, static_empowerment(5)
0:38.490 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
48.0/100: 48% insanity		 bloodlust, shadowform, static_empowerment(5)
0:39.429 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, static_empowerment(5)
0:40.368 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
0:41.588 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
0:42.808 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
0:44.027 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
0:45.247 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
0:46.548 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
0:47.768 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
0:48.987 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
0:50.207 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
0:51.427 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
0:52.646 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
0:53.866 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
0:55.085 main K devouring_plague Fluffy_Pillow 249382.7/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
0:56.305 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
0:57.525 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
0:58.744 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
0:59.964 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
1:01.184 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
1:02.404 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
1:03.623 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:04.843 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
1:06.062 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
1:07.282 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:08.502 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
1:09.722 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
1:10.941 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
1:12.160 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:13.380 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
1:14.600 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
1:15.820 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
1:17.040 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
1:18.260 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
1:19.480 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:20.699 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
1:21.918 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
1:23.138 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
1:24.358 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
1:25.578 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
1:26.798 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
1:28.018 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:29.237 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
1:30.457 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
1:31.677 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
1:32.897 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
1:34.117 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
1:35.336 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
1:36.556 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
1:37.775 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:38.994 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
1:40.214 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:41.433 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:42.653 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:43.873 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:45.093 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:46.312 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
18.0/100: 18% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:47.531 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:48.751 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:49.971 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:51.190 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:52.410 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:53.630 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:54.850 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
48.0/100: 48% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:56.069 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
1:57.289 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
1:58.509 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:59.729 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
2:00.948 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
2:02.167 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
2:03.386 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
2:04.606 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
2:05.826 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
2:07.046 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
2:08.265 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
2:09.484 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
2:10.704 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
2:11.923 main K devouring_plague Fluffy_Pillow 249382.7/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
2:13.143 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
2:14.361 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
2:15.581 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
2:16.800 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
2:18.019 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
2:19.238 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
2:20.458 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
2:21.678 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
2:22.897 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
2:24.116 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
2:25.336 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
2:26.556 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
2:27.775 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
2:28.994 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
2:30.214 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
2:31.434 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
2:32.653 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
2:33.873 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
2:35.093 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:36.313 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:37.531 filler H mind_spike Fluffy_Pillow 249380.1/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:38.751 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:39.969 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:41.189 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:42.409 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:43.629 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:44.849 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:46.069 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:47.289 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:48.509 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:49.729 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:50.949 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:52.168 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:53.387 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:54.606 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
42.0/100: 42% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:55.826 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:57.045 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:58.265 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
2:59.484 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
3:00.704 main J shadowfiend Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
3:01.924 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
3:03.144 main L vampiric_touch Fluffy_Pillow 249385.2/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
3:04.363 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
3:05.583 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
3:06.803 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
3:08.022 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
3:09.241 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
3:10.460 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
3:11.680 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:12.899 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
3:14.119 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
3:15.338 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
3:16.558 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
3:17.776 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
3:18.996 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
3:20.216 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
3:21.435 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
3:22.655 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:23.875 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
3:25.094 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
3:26.313 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
3:27.533 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
3:28.752 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
3:29.972 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
3:31.192 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
3:32.412 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
3:33.632 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
3:34.851 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
3:36.071 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
3:37.291 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
3:38.510 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:39.730 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
3:40.950 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
3:42.170 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
3:43.389 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
3:44.609 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
3:45.829 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:47.048 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:48.268 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
42.0/100: 42% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:49.488 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:50.708 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:51.928 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:53.148 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:54.368 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:55.588 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:56.808 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
18.0/100: 18% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:58.028 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:59.247 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:00.467 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:01.686 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
4:02.905 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
4:04.125 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
4:05.345 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
4:06.565 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
4:07.785 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
4:09.005 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
4:10.225 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
4:11.687 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
4:12.906 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
4:14.126 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
4:15.346 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
4:16.566 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
4:17.786 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
4:19.006 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
4:20.226 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
4:21.687 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
4:22.907 main K devouring_plague Fluffy_Pillow 249385.2/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
4:24.127 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
4:25.347 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
4:26.566 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
4:27.786 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
4:29.006 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
4:30.226 cds D potion Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
4:30.226 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:31.445 filler G shadow_word_death Fluffy_Pillow 249382.7/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:32.665 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:33.885 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:35.105 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:36.324 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:37.543 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:38.763 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:39.983 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:41.202 trinkets O use_items Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:41.202 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:42.665 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:43.885 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.105 cds E blood_fury PR_Priest_Shadow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.105 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:46.325 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:47.545 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:48.765 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:49.984 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:51.202 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:52.665 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:53.885 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:55.105 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:56.325 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:57.545 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:58.764 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:59.984 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3848 1 13665 13015 9166
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 273300 260300 0
Mana 250000 250000 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 2560 2560 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +923 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +692 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +923 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +923 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +111 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +692 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +519 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +519 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +923 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Talents

RowPriest Talents [1]
1
2
3
4
5
6
7
8
9
10
RowShadow Talents [2]
1
2
3
4
5
6
7
8
9
10

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(!set_bonus.tier31_4pc|spell_targets.shadow_crash>1)
actions.precombat+=/vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice|set_bonus.tier31_4pc&spell_targets.shadow_crash=1

# Executed every time the actor is available.
actions=variable,name=holding_crash,op=set,value=raid_event.adds.in<15
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
actions+=/run_action_list,name=aoe,if=active_enemies>2
actions+=/run_action_list,name=main

actions.aoe=call_action_list,name=aoe_variables
# High Priority action to put out Vampiric Touch on enemies that will live at least 18 seconds, up to 12 targets manually while prepping AoE
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.dots_up),if=variable.max_vts>0&!variable.manual_vts_applied&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Crash to apply Vampiric Touch to as many adds as possible while being efficient with Vampiric Touch refresh windows
actions.aoe+=/shadow_crash,if=!variable.holding_crash,target_if=dot.vampiric_touch.refreshable|dot.vampiric_touch.remains<=target.time_to_die&!buff.voidform.up&(raid_event.adds.in-dot.vampiric_touch.remains)<15
actions.aoe+=/call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend or Mindbender on cooldown if DoTs are active and sync with Dark Ascension
actions.aoe+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.dots_up|action.shadow_crash.in_flight&talent.whispering_shadows)&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
actions.aoe+=/devouring_plague,target_if=max:target.time_to_die*(!dot.devouring_plague.ticking),if=talent.distorted_reality&(active_dot.devouring_plague=0|insanity.deficit<=20)
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff or if Inescapable Torment is talented with Mindbender active. Only use when facing 3-7 targets.
actions.aoe+=/mind_blast,target_if=max:dot.devouring_plague.remains,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&active_enemies<=7&!buff.mind_devourer.up&dot.devouring_plague.remains>execute_time
# High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
actions.aoe+=/void_bolt,target_if=max:target.time_to_die
# Use Devouring Plague on enemies that will live the longest with distorted reality.
actions.aoe+=/devouring_plague,target_if=max:target.time_to_die*(!dot.devouring_plague.ticking),if=talent.distorted_reality
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.aoe+=/devouring_plague,if=(remains<=gcd.max&!variable.pool_for_cds|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2)&!talent.distorted_reality
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.dots_up),if=variable.max_vts>0&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash)&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
# High Priority Mind Spike: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up&variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# # Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.aoe+=/mind_blast,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent action list for AoE
actions.aoe+=/void_torrent,target_if=max:dot.devouring_plague.remains,if=(!variable.holding_crash|raid_event.adds.count%(active_dot.vampiric_touch+raid_event.adds.count)<1.5)&(dot.devouring_plague.remains>=2.5|buff.voidform.up)
# High priority action for Mind Flay: Insanity to fish for Idol of C'Thun procs, cancel as soon as something else is more important and most of the channel has completed
actions.aoe+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up&talent.idol_of_cthun,interrupt_if=ticks>=2,interrupt_immediate=1
actions.aoe+=/call_action_list,name=filler

actions.aoe_variables=variable,name=max_vts,op=set,default=12,value=spell_targets.vampiric_touch>?12
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
# TODO: Revamp to fix undesired behaviour with unstacked fights
actions.aoe_variables+=/variable,name=dots_up,op=set,value=(active_dot.vampiric_touch+8*(action.shadow_crash.in_flight&talent.whispering_shadows))>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=holding_crash,op=set,value=(variable.max_vts-active_dot.vampiric_touch)<4|raid_event.adds.in<10&raid_event.adds.count>(variable.max_vts-active_dot.vampiric_touch),if=variable.holding_crash&talent.whispering_shadows
actions.aoe_variables+=/variable,name=manual_vts_applied,op=set,value=(active_dot.vampiric_touch+8*!variable.holding_crash)>=variable.max_vts|!variable.is_vt_possible

# TODO: Check VE/DA enter conditions based on dots
actions.cds=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
actions.cds+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions.cds+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions.cds+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions.cds+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
# Use Nymue's before we go into our cooldowns
actions.cds+=/use_item,name=nymues_unraveling_spindle,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<3+gcd.max|fight_remains<15)
# Use Belor'relos, the Suncaller before we go into our cooldowns
actions.cds+=/use_item,name=belorrelos_the_suncaller,use_off_gcd=1,if=gcd.remains>0&(!raid_event.adds.exists&!prev_gcd.1.mindbender|raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)|fight_remains<20
# Fit in a Divine Star as you cast Belor's for the free GCD.
actions.cds+=/divine_star,if=(raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)&equipped.belorrelos_the_suncaller&trinket.belorrelos_the_suncaller.cooldown.remains<=gcd.max
# Sync Power Infusion with Voidform or Dark Ascension
actions.cds+=/power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
# Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
# Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
actions.cds+=/call_action_list,name=trinkets
# Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.cds+=/desperate_prayer,if=health.pct<=75

# Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
actions.filler=vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
actions.filler+=/shadow_word_death,target_if=target.health.pct<20|(buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking
actions.filler+=/mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=dot.devouring_plague.remains>cast_time
actions.filler+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up
actions.filler+=/mindgames,target_if=max:dot.devouring_plague.remains
actions.filler+=/shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
# Save up to 20s if adds are coming soon.
actions.filler+=/halo,if=spell_targets>1
actions.filler+=/mind_spike,target_if=max:dot.devouring_plague.remains
actions.filler+=/mind_flay,target_if=max:dot.devouring_plague.remains,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
actions.filler+=/divine_star
# Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
actions.filler+=/shadow_crash,if=raid_event.adds.in>20&!set_bonus.tier31_4pc
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.filler+=/shadow_word_death,target_if=target.health.pct<20
# Use Shadow Word: Death while moving as a low-priority action
actions.filler+=/shadow_word_death,target_if=max:dot.devouring_plague.remains
# Use Shadow Word: Pain while moving as a low-priority action with T31 4pc
actions.filler+=/shadow_word_pain,target_if=max:dot.devouring_plague.remains,if=set_bonus.tier31_4pc
# Use Shadow Word: Pain while moving as a low-priority action without T31 4pc
actions.filler+=/shadow_word_pain,target_if=min:remains,if=!set_bonus.tier31_4pc

actions.main=variable,name=dots_up,op=set,value=active_dot.vampiric_touch=active_enemies|action.shadow_crash.in_flight&talent.whispering_shadows
actions.main+=/call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active and sync with Dark Ascension
actions.main+=/mindbender,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
actions.main+=/devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=remains<=gcd.max|insanity.deficit<=16
actions.main+=/shadow_word_death,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)&dot.devouring_plague.ticking
# High priority Mind Blast action when using Inescapable Torment
actions.main+=/mind_blast,target_if=dot.devouring_plague.remains>execute_time&(cooldown.mind_blast.full_recharge_time<=gcd.max+execute_time)|pet.fiend.remains<=execute_time+gcd.max,if=pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>execute_time&active_enemies<=7
# High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
actions.main+=/shadow_word_death,target_if=dot.devouring_plague.ticking&pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
actions.main+=/void_bolt,if=variable.dots_up
# Spend your Insanity on Devouring Plague at will if the fight will end in less than 10s
actions.main+=/devouring_plague,if=fight_remains<=duration+4
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.main+=/devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=(remains<=gcd.max|remains<3&cooldown.void_torrent.up)|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2|buff.mind_devourer.up&pmultiplier<1.2
actions.main+=/shadow_word_death,if=set_bonus.tier31_2pc
# Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
actions.main+=/shadow_crash,if=!variable.holding_crash&(dot.vampiric_touch.refreshable|buff.deaths_torment.stack>9&set_bonus.tier31_4pc)
# Consume T31 4pc SWPs
actions.main+=/shadow_word_pain,if=buff.deaths_torment.stack>9&set_bonus.tier31_4pc&(!variable.holding_crash|!talent.shadow_crash)
# Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
actions.main+=/shadow_word_death,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
# Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
actions.main+=/vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
# Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.main+=/mind_blast,if=(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
actions.main+=/void_torrent,if=!variable.holding_crash,target_if=dot.devouring_plague.remains>=2.5,interrupt_if=cooldown.shadow_word_death.ready&pet.fiend.active&set_bonus.tier31_2pc
# Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.main+=/call_action_list,name=filler

actions.trinkets=use_item,name=voidmenders_shadowgem,if=(buff.power_infusion.up|fight_remains<20)&equipped.voidmenders_shadowgem
actions.trinkets+=/use_item,name=iridal_the_earths_master,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
actions.trinkets+=/use_item,name=dreambinder_loom_of_the_great_cycle,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno,if=equipped.darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime,if=equipped.darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance,if=equipped.darkmoon_deck_box_dance
# Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
actions.trinkets+=/use_item,name=erupting_spear_fragment,if=(buff.power_infusion.up|raid_event.adds.up|fight_remains<20)&equipped.erupting_spear_fragment
# Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
actions.trinkets+=/use_item,name=beacon_to_the_beyond,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20)&equipped.beacon_to_the_beyond
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
actions.trinkets+=/use_item,name=desperate_invokers_codex,if=equipped.desperate_invokers_codex

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=9166
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 49831 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
49831.3 49831.3 51.6 / 0.104% 8833.8 / 17.7% 68.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
677.9 676.2 Mana 0.90% 52.1 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQJJSIAAAAAAAAAAAAgSESCJkioQSDAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 49831
Doom Winds 101 0.2% 3.7 90.41s 8075 7291 Direct 3.7 6666 13365 8075 21.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.1077 0.0000 30134.38 43050.21 30.00% 7291.16 7291.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.97% 2.95 0 4 6665.86 3768 12982 6659.40 0 9816 19645 28065 29.90%
crit 21.03% 0.78 0 4 13364.83 7535 25668 7793.59 0 23492 10489 14985 17.49%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.73
  • if_expr:raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Flame Shock 1532 3.1% 29.6 10.01s 15524 40850 Direct 29.6 2749 5500 3312 20.5% 0.0%
Periodic 184.2 1627 3254 1962 20.6% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.59 29.59 184.24 184.24 28.00 0.3801 1.5777 459403.49 459403.49 0.00% 1521.66 40850.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.53% 23.54 11 37 2748.97 2332 4450 2748.75 2442 3171 64699 64699 0.00%
crit 20.47% 6.06 0 16 5499.69 4664 8831 5490.15 0 8196 33311 33311 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.43% 146.33 102 195 1626.85 1 2603 1626.53 1504 1836 238061 238061 0.00%
crit 20.57% 37.90 16 67 3253.94 2 5206 3253.28 2832 3719 123333 123333 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Volcanic damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Volcanic damage and then an additional {$=}o2 Volcanic damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Volcanic damage and knocking them into the air.]

Action Priority List

    single
    [O]:1.59
  • if_expr:!ticking
    single
    [W]:7.97

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Spell Periodic AmountFire and Ice3828862PCT0.030
Flametongue Weapon 0 (1371) 0.0% (2.8%) 1.0 0.00s 410731 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFire and Ice3828861PCT0.030
    Flametongue Attack 1371 2.8% 992.9 0.68s 414 0 Direct 992.9 343 686 414 20.6% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 992.85 992.85 0.00 0.00 0.00 0.0000 0.0000 410730.96 410730.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 787.86 532 1060 342.77 285 550 342.85 319 377 270055 270055 0.00%
crit 20.65% 204.99 123 298 686.26 569 1100 686.44 624 759 140676 140676 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Forgestorm Ignited (_damage) 1229 2.5% 28.3 7.74s 13044 0 Direct 28.3 10807 21620 13044 20.7% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.28 28.28 0.00 0.00 0.00 0.0000 0.0000 368833.88 368833.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.31% 22.43 1 60 10807.14 10705 11241 10798.86 10705 11181 242378 242378 0.00%
crit 20.69% 5.85 0 21 21619.91 21411 22481 21340.39 0 22481 126456 126456 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 970 1.9% 14.3 19.45s 20385 17046 Direct 14.3 16919 33838 20385 20.5% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.27 14.27 0.00 0.00 0.00 1.1959 0.0000 290952.27 290952.27 0.00% 17045.65 17045.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.51% 11.35 2 22 16918.66 7534 29687 16964.24 11740 21493 192008 192008 0.00%
crit 20.49% 2.92 0 10 33838.22 15068 59374 32295.04 0 58696 98945 98945 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [U]:14.27

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownEnhancement Shaman1370417ADD6000.000
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Ice Strike 1881 3.8% 21.6 13.77s 26154 22058 Direct 21.6 21703 43408 26154 20.5% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.56 21.56 0.00 0.00 0.00 1.1857 0.0000 563896.44 563896.44 0.00% 22058.22 22058.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.49% 17.14 7 26 21702.86 17718 34907 21701.24 19174 24888 371983 371983 0.00%
crit 20.51% 4.42 0 13 43407.87 35436 69815 43037.01 0 66231 191913 191913 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [P]:20.52
  • if_expr:!buff.ice_strike.up
    single
    [R]:1.04

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Lava Lash 1762 3.5% 20.0 14.72s 26385 22185 Direct 20.0 21884 43743 26385 20.6% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.03 20.03 0.00 0.00 0.00 1.1893 0.0000 528355.42 528355.42 0.00% 22184.89 22184.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.41% 15.90 7 24 21883.96 18660 35012 21876.82 19524 25009 348000 348000 0.00%
crit 20.59% 4.12 0 13 43743.21 37319 70023 43230.71 0 63047 180356 180356 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [Q]:20.02

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownMolten Assault3340331ADD-3000.000
Spell Direct AmountFire and Ice3828861PCT0.030
Lightning Bolt 13788 27.7% 68.1 4.37s 60681 51313 Direct 68.1 50287 100589 60681 20.7% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.14 68.14 0.00 0.00 0.00 1.1826 0.0000 4134658.37 4134658.37 0.00% 51313.13 51313.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.34% 54.06 33 81 50287.12 34015 101174 50291.89 41676 57405 2718460 2718460 0.00%
crit 20.66% 14.08 3 32 100588.99 68031 200376 100605.10 76410 135888 1416199 1416199 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.09

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [N]:68.14
  • if_expr:((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
Spell Direct AmountThorim's Invocation3844442PCT0.200
main_hand 1792 3.6% 193.5 1.81s 2777 1558 Direct 193.5 2661 5325 2777 20.7% 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.45 193.45 0.00 0.00 0.00 1.7822 0.0000 537242.15 767508.35 30.00% 1558.29 1558.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.02% 121.90 76 172 2661.29 2257 4294 2661.47 2463 2961 324419 463468 30.00%
crit 20.66% 39.97 17 64 5325.03 4513 8506 5324.27 4751 5993 212823 304040 30.00%
miss 16.33% 31.58 13 59 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 897 1.8% 193.5 1.80s 1390 779 Direct 193.5 1332 2666 1390 20.6% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.54 193.54 0.00 0.00 0.00 1.7837 0.0000 268987.54 384277.72 30.00% 779.20 779.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.05% 122.02 83 171 1332.40 1128 2122 1332.37 1224 1482 162585 232271 30.00%
crit 20.62% 39.91 16 68 2665.93 2257 4244 2666.04 2412 3113 106402 152007 30.00%
miss 16.33% 31.60 13 60 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (9724) 0.0% (19.5%) 90.8 3.29s 32099 27354

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.78 0.00 0.00 0.00 0.00 1.1735 0.0000 0.00 0.00 0.00% 27353.88 27353.88

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:57.29
  • if_expr:buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
    single
    [S]:33.49

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
    Stormstrike (_mh) 5270 (6483) 10.6% (13.0%) 121.0 2.46s 16059 0 Direct 121.0 (173.5) 10817 21686 13056 20.6% (14.4%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.97 120.97 0.00 0.00 0.00 0.0000 0.0000 1579344.55 2256264.03 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.40% 96.05 54 149 10816.88 3255 27104 10838.19 9095 12727 1038966 1484275 30.00%
crit 20.60% 24.92 7 49 21686.30 6510 56083 21723.40 15527 30334 540379 771989 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
        Stormblast (_stormstrike_mh) 1213 2.4% 52.6 5.63s 6912 0 Direct 52.6 6912 0 6912 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.57 52.57 0.00 0.00 0.00 0.0000 0.0000 363354.07 363354.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 52.57 23 93 6911.50 3572 24570 6915.02 5499 8719 363354 363354 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2635 (3241) 5.3% (6.5%) 121.0 2.46s 8029 0 Direct 121.0 (173.5) 5408 10843 6527 20.6% (14.3%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.97 120.97 0.00 0.00 0.00 0.0000 0.0000 789569.48 1127985.16 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.42% 96.07 55 145 5408.48 1628 14021 5419.23 4642 6394 519586 742284 30.00%
crit 20.58% 24.90 7 49 10842.88 3255 27104 10861.31 7709 14425 269984 385701 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
        Stormblast (_stormstrike_offhand) 606 1.2% 52.6 5.63s 3456 0 Direct 52.6 3456 0 3456 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.57 52.57 0.00 0.00 0.00 0.0000 0.0000 181713.44 181713.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 52.57 23 93 3456.43 1786 12285 3457.44 2791 4407 181713 181713 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 973 2.0% 6.0 50.61s 48486 40783 Direct 6.0 40277 80724 48488 20.3% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 6.02 0.00 0.00 0.00 1.1889 0.0000 291682.49 291682.49 0.00% 40783.35 40783.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.70% 4.79 0 8 40277.40 26249 83395 40280.13 0 57750 193125 193125 0.00%
crit 20.30% 1.22 0 6 80724.21 52498 163506 59980.38 0 163506 98557 98557 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [T]:6.02
  • if_expr:raid_event.adds.in>=action.sundering.cooldown

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Tempest Strikes 3782 7.6% 162.5 1.84s 6975 0 Direct 162.5 5782 11568 6975 20.6% 0.0%

Stats Details: Tempest Strikes

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 162.54 162.54 0.00 0.00 0.00 0.0000 0.0000 1133660.06 1133660.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.38% 129.02 80 184 5781.60 4848 9379 5781.90 5335 6379 745968 745968 0.00%
crit 20.62% 33.51 14 63 11568.18 9695 18577 11569.92 10255 13366 387692 387692 0.00%

Action Details: Tempest Strikes

  • id:428078
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:428078
  • name:Tempest Strikes
  • school:nature
  • tooltip:
  • description:{$@spelldesc428071=Stormstrike, Ice Strike, and Lava Lash have a {$h=100}% chance to discharge electricity at your target, dealing {$428078s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Windfury Weapon 0 (6910) 0.0% (13.8%) 1.0 0.00s 2068484 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6910 13.8% 375.8 2.49s 5505 0 Direct 375.8 4558 9141 5505 20.7% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 375.78 375.78 0.00 0.00 0.00 0.0000 0.0000 2068483.73 2955052.10 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 298.16 176 433 4557.98 1878 11728 4558.73 3960 5370 1359021 1941508 30.00%
crit 20.65% 77.61 38 142 9141.22 3756 22934 9142.19 7349 11273 709463 1013544 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
pet - greater_earth_elemental 431 / 89
melee 431 0.2% 38.9 2.23s 682 438 Direct 38.9 566 1131 682 20.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.88 38.88 0.00 0.00 0.00 1.5580 0.0000 26512.98 37876.66 30.00% 437.68 437.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.48% 30.90 12 57 566.11 488 915 565.26 488 724 17495 24993 30.00%
crit 20.52% 7.98 0 23 1130.56 976 1831 1129.18 0 1563 9018 12884 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4094 / 3031
melee 4094 6.1% 383.4 1.56s 2368 2040 Direct 383.4 1962 3929 2368 20.7% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 383.43 383.43 0.00 0.00 0.00 1.1608 0.0000 908112.26 1297336.30 30.00% 2040.40 2040.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 304.24 212 435 1962.19 1630 3124 1962.55 1799 2187 596986 852859 30.00%
crit 20.65% 79.18 44 128 3929.13 3260 6247 3930.19 3520 4414 311126 444477 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.1 308.89s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.11 0.00 0.00 0.00 0.00 1.0404 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [V]:1.11
Feral Spirit 15.5 20.41s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.50 0.00 0.00 0.00 0.00 1.1690 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:15.50

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 302.12s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 3.1 113.81s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.09 0.00 0.00 0.00 0.00 0.5582 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Action Priority List

    single
    [M]:1.49
  • if_expr:!buff.windfury_totem.up
    single
    [X]:0.60
  • if_expr:buff.windfury_totem.remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.4s 50.0s 80.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 345.0s
  • trigger_min/max:15.0s / 312.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.9s
  • uptime_min/max:47.04% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.14%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Crumbling Power 2.0 0.0 180.4s 5.4s 18.4s 12.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.3s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s
  • uptime_min/max:10.24% / 15.40%

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.36%
  • crumbling_power_3:0.73%
  • crumbling_power_4:0.75%
  • crumbling_power_5:0.74%
  • crumbling_power_6:0.71%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.67%
  • crumbling_power_19:0.70%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4s 90.4s 7.9s 9.88% 12.55% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.4s
  • trigger_min/max:90.0s / 92.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:8.75% / 11.45%

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 15.5 0.0 22.2s 19.9s 16.9s 74.04% 100.00% 0.0 (0.0) 12.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 91.2s
  • trigger_min/max:4.3s / 39.2s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 81.7s
  • uptime_min/max:61.82% / 88.64%

Stack Uptimes

  • earthen_weapon_2:72.30%
  • earthen_weapon_4:1.74%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 301.2s 302.1s 27.5s 13.45% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 317.8s
  • trigger_min/max:300.0s / 317.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.98% / 18.13%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.45%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 13.1 2.4 23.7s 20.4s 16.9s 74.05% 0.00% 62.3 (62.3) 12.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 91.1s
  • trigger_min/max:4.3s / 39.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 81.7s
  • uptime_min/max:61.83% / 88.64%

Stack Uptimes

  • feral_spirit_1:74.05%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 36.9 446.4 8.2s 0.6s 7.2s 88.17% 92.39% 446.4 (1083.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 85.4s
  • trigger_min/max:0.0s / 15.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 83.1s
  • uptime_min/max:76.02% / 96.04%

Stack Uptimes

  • flurry_1:18.98%
  • flurry_2:35.99%
  • flurry_3:33.19%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 108.1 17.9s 2.4s 14.6s 83.73% 100.00% 48.0 (48.0) 16.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 45.7s
  • trigger_min/max:0.0s / 39.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:67.98% / 93.63%

Stack Uptimes

  • forceful_winds_1:16.12%
  • forceful_winds_2:14.95%
  • forceful_winds_3:13.15%
  • forceful_winds_4:10.63%
  • forceful_winds_5:28.89%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=20}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.7s 46.6s 13.0s 19.40% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 210.2s
  • trigger_min/max:0.2s / 210.2s
  • trigger_pct:98.82%
  • duration_min/max:0.0s / 49.2s
  • uptime_min/max:3.62% / 49.31%

Stack Uptimes

  • forgestorm_ignited_1:19.40%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.5 1.0 14.5s 13.8s 8.9s 60.95% 87.61% 1.0 (1.0) 7.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.7s / 62.5s
  • trigger_min/max:8.7s / 44.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.6s
  • uptime_min/max:40.12% / 78.25%

Stack Uptimes

  • ice_strike_1:60.95%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 25.1 23.6 12.0s 6.1s 8.1s 67.91% 100.00% 23.6 (23.6) 24.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 63.0s
  • trigger_min/max:0.9s / 30.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 61.0s
  • uptime_min/max:55.36% / 79.38%

Stack Uptimes

  • legacy_of_the_frost_witch_1:67.91%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your Physical and Frost abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 69.0 400.9 4.4s 0.6s 3.7s 83.96% 100.00% 59.0 (59.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 24.4s
  • trigger_min/max:0.0s / 7.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.5s
  • uptime_min/max:78.65% / 88.86%

Stack Uptimes

  • maelstrom_weapon_1:9.83%
  • maelstrom_weapon_2:10.48%
  • maelstrom_weapon_3:11.48%
  • maelstrom_weapon_4:12.00%
  • maelstrom_weapon_5:9.98%
  • maelstrom_weapon_6:7.26%
  • maelstrom_weapon_7:5.11%
  • maelstrom_weapon_8:3.75%
  • maelstrom_weapon_9:2.84%
  • maelstrom_weapon_10:11.24%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.4s 45.6s 16.6s 23.63% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 206.9s
  • trigger_min/max:0.0s / 206.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.4s
  • uptime_min/max:4.97% / 62.43%

Stack Uptimes

  • sophic_devotion_1:23.63%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.2s 45.4s 32.4s 38.53% 0.00% 26.1 (26.1) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 241.6s
  • trigger_min/max:0.0s / 201.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 165.9s
  • uptime_min/max:8.25% / 86.00%

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:18.04%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Stormbringer 52.8 15.1 5.6s 4.4s 1.1s 19.44% 57.69% 15.1 (15.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 90.1s
  • trigger_min/max:0.0s / 90.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s
  • uptime_min/max:9.00% / 32.00%

Stack Uptimes

  • stormbringer_1:19.44%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.5 36.0 66.0 17.9s 15.0s 45.7s
Windfury-ForcefulWinds: 2 50.6 33.0 66.0 18.2s 0.1s 64.1s
Windfury-ForcefulWinds: 3 48.4 27.0 66.0 19.0s 1.1s 87.9s
Windfury-ForcefulWinds: 4 43.9 18.0 63.0 20.9s 1.0s 91.7s
Windfury-ForcefulWinds: 5 181.4 75.0 306.0 5.0s 0.0s 89.5s
Windfury (Main Hand) 26.8 9.0 50.0 10.9s 1.3s 115.6s
Windfury (Off Hand) 26.8 9.0 53.0 10.9s 1.3s 120.1s
Windfury: Unruly Winds 125.3 72.0 178.0 2.5s 0.0s 39.4s
Stormflurry 30.2 7.0 63.0 9.5s 0.0s 176.6s
Flametongue: Windfury Attack 375.8 216.0 534.0 2.5s 0.0s 39.4s
Stormbringer: Windfury Attack 38.3 14.0 72.0 8.6s 0.0s 106.9s
Flametongue: main_hand 161.9 112.0 226.0 2.2s 1.3s 17.2s
Windfury: main_hand 61.2 35.0 105.0 5.3s 1.3s 76.9s
Flametongue: offhand 161.9 112.0 219.0 2.2s 1.3s 15.4s
Flametongue: Doom Winds 3.7 3.0 4.0 90.4s 90.0s 92.4s
Windfury: Doom Winds 3.7 3.0 4.0 90.4s 90.0s 92.4s
Flametongue: Lava Lash 20.0 13.0 27.0 14.7s 8.7s 55.3s
Stormbringer: Lava Lash 2.0 0.0 10.0 78.1s 8.8s 342.4s
Flametongue: Sundering 6.0 2.0 8.0 50.6s 40.0s 174.5s
Stormbringer: Sundering 0.6 0.0 5.0 111.0s 40.0s 322.5s
Windfury: Sundering 1.9 0.0 7.0 95.4s 40.0s 333.6s
Flametongue: Ice Strike 21.6 15.0 28.0 13.8s 8.7s 44.8s
Stormbringer: Ice Strike 2.2 0.0 9.0 75.6s 8.7s 337.2s
Windfury: Ice Strike 7.2 0.0 17.0 38.6s 8.7s 304.7s
Flametongue: Stormstrike 121.0 73.0 181.0 2.5s 0.0s 20.6s
Stormbringer: Stormstrike 12.3 1.0 30.0 22.3s 0.1s 239.0s
Windfury: Stormstrike 51.3 26.0 85.0 5.8s 0.0s 84.4s
Flametongue: Stormstrike Off-Hand 121.0 73.0 181.0 2.5s 0.0s 20.6s
Stormbringer: Stormstrike Off-Hand 12.3 2.0 29.0 22.4s 0.0s 267.7s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 36.03% 23.45% 45.26% 0.6s 0.0s 5.8s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike
Stormstrike		1.3230.0008.614120.64268.298179.578
Feral Spirit0.7870.0001.46912.2163.46120.268
Doom Winds0.5330.0002.4331.9910.8645.899
Lava Lash3.2670.00042.94566.16927.044123.901
Sundering12.0610.000134.47275.18515.114200.801
Ice Strike2.2470.00032.43648.83817.46294.396
Frost Shock15.3840.000185.401232.305156.224319.646
Flame Shock24.2490.000253.096255.316178.541338.253
Earth Elemental31.9840.000226.09737.12710.386226.097

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack73.916.514.91%27.98%
main_hand34.64.26.99%7.14%
offhand34.44.46.94%7.50%
Feral Spirit76.19.315.36%15.85%
Doom Winds0.80.10.17%0.10%
Lightning Bolt98.20.019.82%0.00%
Lava Lash24.80.05.01%0.00%
Sundering1.50.00.30%0.00%
Ice Strike26.80.05.41%0.00%
Stormstrike75.815.015.30%25.36%
Stormstrike (_mh)24.44.64.92%7.85%
Stormstrike Off-Hand24.14.94.87%8.22%
Overflow Stacks0.059.00.00%10.64%
Actual Stacks495.50.089.36%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt491.4100.00%
Total Spent491.4100.00%
Casts per Maelstrom Weapon Stack Consumed
Ability 0 1 2 3 4 5 6 7 8 9 10
Lightning Bolt          18.44 13.40 9.07 6.26 4.50 16.47
Total           18.44
(27.06%)		 13.40
(19.67%)		 9.07
(13.31%)		 6.26
(9.19%)		 4.50
(6.61%)		 16.47
(24.17%)

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
Mana RegenMana652.72202873.09100.00%310.81564165.3673.55%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 270980.0 0.00 875.18 0.0 8425.0 -406434.9 270980.0
Mana 250000.0 676.24 677.87 564165.2 249513.3 247000.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.001000.000.49%1000.001000.000.00
Flame ShockMana 9.577175.043.53%750.00242.4664.03
Frost ShockMana 14.277136.523.51%500.00500.0040.77
Ice StrikeMana 21.5635575.6417.49%1650.001650.0015.85
Lava LashMana 20.028009.973.94%400.00400.0065.96
Lightning BoltMana 68.1434069.1216.75%500.00500.01121.36
StormstrikeMana 90.7890780.5644.64%1000.001000.0032.10
SunderingMana 6.0218047.598.87%3000.003000.0016.16
Windfury TotemMana 3.091565.190.77%507.04507.040.00

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 49831.26
Minimum 41869.17
Maximum 58898.75
Spread ( max - min ) 17029.58
Range [ ( max - min ) / 2 * 100% ] 17.09%
Standard Deviation 2281.9189
5th Percentile 46305.15
95th Percentile 53742.24
( 95th Percentile - 5th Percentile ) 7437.09
Mean Distribution
Standard Deviation 26.3511
95.00% Confidence Interval ( 49779.62 - 49882.91 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8056
0.1 Scale Factor Error with Delta=300 44452
0.05 Scale Factor Error with Delta=300 177806
0.01 Scale Factor Error with Delta=300 4445127
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 49831.26
Minimum 41869.17
Maximum 58898.75
Spread ( max - min ) 17029.58
Range [ ( max - min ) / 2 * 100% ] 17.09%
Standard Deviation 2281.9189
5th Percentile 46305.15
95th Percentile 53742.24
( 95th Percentile - 5th Percentile ) 7437.09
Mean Distribution
Standard Deviation 26.3511
95.00% Confidence Interval ( 49779.62 - 49882.91 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8056
0.1 Scale Factor Error with Delta=300 44452
0.05 Scale Factor Error with Delta=300 177806
0.01 Scale Factor Error with Delta=300 4445127
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 49831.26
Minimum 41869.17
Maximum 58898.75
Spread ( max - min ) 17029.58
Range [ ( max - min ) / 2 * 100% ] 17.09%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 14001002.72
Minimum 10018166.01
Maximum 18546282.96
Spread ( max - min ) 8528116.95
Range [ ( max - min ) / 2 * 100% ] 30.46%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 874.81
Minimum 0.00
Maximum 2301.90
Spread ( max - min ) 2301.90
Range [ ( max - min ) / 2 * 100% ] 131.57%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
0.00 primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
G 15.50 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
H 3.73 doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
J 0.00 call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
K 0.00 call_action_list,name=funnel,if=active_enemies>1&rotation.funnel
actions.single
# count action,conditions
0.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
L 57.29 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
0.00 lava_lash,if=buff.hot_hand.up
M 1.49 windfury_totem,if=!buff.windfury_totem.up
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
N 68.14 lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
0.00 primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
O 1.59 flame_shock,if=!ticking
0.00 ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
0.00 lava_lash,if=talent.lashing_flames.enabled
P 20.52 ice_strike,if=!buff.ice_strike.up
0.00 frost_shock,if=buff.hailstorm.up
Q 20.02 lava_lash
R 1.04 ice_strike
0.00 windstrike
S 33.49 stormstrike
T 6.02 sundering,if=raid_event.adds.in>=action.sundering.cooldown
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
0.00 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
U 14.27 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
V 1.11 earth_elemental
W 7.97 flame_shock
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
X 0.60 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGHLLLNLLLNLNOPQSNSGTUVSLNNPQNSLLNGSUPNQLUWNSUPNQSUWNNSUPGLNQLNTUWPNSLNQSNSUPGNNSQLLNHLPNGLLNQNSTLLNPLUQNGSLMNNPSNQUWSNSUPNWQGNSUTWPNSLLNQSNNPSUWGNQSLLLNPSLEFNHLNLGLNPLQNSTUWNSLLNNPNQGSLLLNSPUNQNSLNNGPSLLNNQMSNGNNNNPSNGLNQTUSNPSLLLNNHGLLLLLLLNOPQNSGLLNSUPN

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 250000.0/250000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 2 augmentation PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 3 windfury_weapon PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 4 flametongue_weapon PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 6 windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana corrupting_rage
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
0:00.000 default B bloodlust Fluffy_Pillow 250000.0/250000: 100% mana corrupting_rage
0:00.000 default C potion Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, corrupting_rage
0:00.000 default D auto_attack Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, forceful_winds, maelstrom_weapon, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default F berserking PR_Shaman_Enhancement 249000.0/250000: 100% mana bloodlust, flurry(3), forceful_winds, stormbringer, maelstrom_weapon, crumbling_power(20), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, berserking, flurry(3), forceful_winds, stormbringer, maelstrom_weapon, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:00.866 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:01.732 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, crumbling_power(18), corrupting_rage, elemental_potion_of_ultimate_power
0:02.598 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(5), doom_winds, crumbling_power(17), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:03.463 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds, crumbling_power(16), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:04.329 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(15), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:05.193 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), doom_winds, legacy_of_the_frost_witch, crumbling_power(14), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:06.058 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), doom_winds, legacy_of_the_frost_witch, crumbling_power(13), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:06.924 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds, legacy_of_the_frost_witch, crumbling_power(12), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:07.789 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, crumbling_power(11), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:08.655 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), doom_winds, legacy_of_the_frost_witch, crumbling_power(10), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:09.520 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, crumbling_power(9), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:10.386 single O flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power(8), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:11.252 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power(7), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:12.117 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:13.070 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, crumbling_power(5), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:14.023 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, crumbling_power(4), corrupting_rage, elemental_potion_of_ultimate_power
0:14.976 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), corrupting_rage, elemental_potion_of_ultimate_power
0:15.929 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(2), corrupting_rage, elemental_potion_of_ultimate_power
0:16.881 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:17.834 single U frost_shock Fluffy_Pillow 249439.7/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:18.786 single V earth_elemental Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:19.739 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:20.691 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:21.643 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:22.596 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:23.548 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:24.500 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:25.452 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:26.404 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:27.357 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:28.309 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:29.262 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.215 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
0:31.167 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
0:32.119 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
0:33.072 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
0:34.024 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
0:34.976 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
0:35.929 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
0:36.882 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
0:37.835 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
0:38.787 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
0:39.740 Waiting     0.942s 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, sophic_devotion, corrupting_rage
0:40.682 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, sophic_devotion, corrupting_rage
0:42.115 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), sophic_devotion, corrupting_rage
0:43.353 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), corrupting_rage
0:44.590 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), ice_strike, corrupting_rage
0:45.828 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:47.066 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
0:48.304 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
0:49.541 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(5), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
0:50.779 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(5), forgestorm_ignited, corrupting_rage
0:52.016 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(5), forgestorm_ignited, corrupting_rage
0:53.254 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
0:54.492 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
0:55.730 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
0:56.968 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
0:58.205 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, corrupting_rage
0:59.442 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), ice_strike, corrupting_rage
1:00.679 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:01.917 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:03.154 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:04.392 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:05.629 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, corrupting_rage
1:06.866 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), corrupting_rage
1:08.103 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), corrupting_rage
1:09.341 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, corrupting_rage
1:10.578 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:11.816 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:13.052 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:14.289 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:15.526 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:16.764 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(4), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:18.002 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:19.240 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:20.478 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:21.716 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:22.953 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, forgestorm_ignited, corrupting_rage
1:24.191 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, forgestorm_ignited, corrupting_rage
1:25.427 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:26.665 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:27.902 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:29.140 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:30.378 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, forgestorm_ignited, corrupting_rage
1:31.616 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:32.852 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), doom_winds, legacy_of_the_frost_witch, corrupting_rage
1:34.090 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch, corrupting_rage
1:35.327 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:36.564 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:37.802 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:39.040 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:40.278 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:41.516 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:42.753 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:43.990 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:45.228 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:46.466 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), forgestorm_ignited, corrupting_rage
1:47.702 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(6), forgestorm_ignited, corrupting_rage
1:48.939 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), forgestorm_ignited, corrupting_rage
1:50.177 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch
1:51.414 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch
1:52.652 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch
1:53.890 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(5), maelstrom_weapon(4), legacy_of_the_frost_witch
1:55.127 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(5), maelstrom_weapon(6)
1:56.365 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch
1:57.603 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch
1:58.840 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch
2:00.078 single M windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch
2:00.903 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), forgestorm_ignited
2:02.141 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, forgestorm_ignited
2:03.379 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited
2:04.616 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
2:05.854 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
2:07.091 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
2:08.328 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, forgestorm_ignited, corrupting_rage
2:09.566 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), forgestorm_ignited, corrupting_rage
2:10.803 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), forgestorm_ignited, corrupting_rage
2:12.040 Waiting     0.549s 250000.0/250000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(4), forgestorm_ignited, corrupting_rage
2:12.589 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(3), maelstrom_weapon(5), corrupting_rage
2:13.827 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
2:15.065 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
2:16.303 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(4), legacy_of_the_frost_witch, corrupting_rage
2:17.541 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
2:18.778 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ice_strike, sophic_devotion, forgestorm_ignited, corrupting_rage
2:20.016 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ice_strike, sophic_devotion, forgestorm_ignited, corrupting_rage
2:21.254 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(2), maelstrom_weapon(3), ice_strike, sophic_devotion, forgestorm_ignited, corrupting_rage
2:22.492 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, sophic_devotion, forgestorm_ignited, corrupting_rage
2:23.730 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, corrupting_rage
2:24.968 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion, forgestorm_ignited, corrupting_rage
2:26.205 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, forgestorm_ignited, corrupting_rage
2:27.443 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, forgestorm_ignited, corrupting_rage
2:28.680 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(3), sophic_devotion, forgestorm_ignited, corrupting_rage
2:29.918 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(4), sophic_devotion, corrupting_rage
2:31.156 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, spiraling_winds(4), sophic_devotion, corrupting_rage
2:32.394 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, spiraling_winds(5), sophic_devotion, corrupting_rage
2:33.632 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, spiraling_winds(5), corrupting_rage
2:34.870 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, spiraling_winds(6), corrupting_rage
2:36.108 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), corrupting_rage
2:37.345 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), corrupting_rage
2:38.582 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), corrupting_rage
2:39.818 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), corrupting_rage
2:41.055 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, legacy_of_the_frost_witch, spiraling_winds(9), corrupting_rage
2:42.293 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:43.531 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:44.769 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(3), maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
2:46.005 Waiting     1.080s 250000.0/250000: 100% mana forceful_winds(3), maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
2:47.085 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(3), maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
2:48.492 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), corrupting_rage
2:49.729 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
2:50.967 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
2:52.204 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, corrupting_rage
2:53.442 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, corrupting_rage
2:54.679 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), corrupting_rage
2:55.916 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), corrupting_rage
2:57.154 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
2:58.391 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
2:59.628 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
3:00.865 default E use_item_irideus_fragment Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), corrupting_rage
3:00.865 default F berserking PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, crumbling_power(20), spiraling_winds(2), corrupting_rage
3:00.865 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, crumbling_power(19), spiraling_winds(2), corrupting_rage
3:01.990 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(19), spiraling_winds(2), corrupting_rage
3:03.115 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), forceful_winds(4), maelstrom_weapon(6), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(18), spiraling_winds(3), corrupting_rage
3:04.239 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), forceful_winds(5), maelstrom_weapon(8), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(17), spiraling_winds(4), corrupting_rage
3:05.364 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), forceful_winds(5), maelstrom_weapon(2), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(16), spiraling_winds(4), corrupting_rage
3:06.488 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(5), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), spiraling_winds(5), corrupting_rage
3:07.613 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), spiraling_winds(5), corrupting_rage
3:08.738 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), spiraling_winds(6), sophic_devotion, corrupting_rage
3:09.863 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds, crumbling_power(12), spiraling_winds(7), sophic_devotion, corrupting_rage
3:10.988 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, crumbling_power(11), spiraling_winds(8), sophic_devotion, corrupting_rage
3:12.112 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, crumbling_power(10), spiraling_winds(8), sophic_devotion, corrupting_rage
3:13.237 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, crumbling_power(9), spiraling_winds(9), sophic_devotion, corrupting_rage
3:14.475 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(9), sophic_devotion, corrupting_rage
3:15.712 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(10), sophic_devotion, corrupting_rage
3:16.950 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(10), sophic_devotion, corrupting_rage
3:18.187 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(10), sophic_devotion, corrupting_rage
3:19.425 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), crumbling_power(4), spiraling_winds(10), sophic_devotion, corrupting_rage
3:20.663 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(3), spiraling_winds(10), sophic_devotion, corrupting_rage
3:21.901 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
3:23.139 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited, corrupting_rage
3:24.377 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:25.615 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(4), maelstrom_weapon(6), spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:26.853 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:28.091 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:29.329 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:30.567 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:31.805 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:33.043 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:34.280 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:35.518 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:36.756 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:37.993 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
3:39.230 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
3:40.468 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
3:41.705 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, corrupting_rage
3:42.942 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
3:44.180 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, corrupting_rage
3:45.418 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, corrupting_rage
3:46.655 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
3:47.893 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(5), corrupting_rage
3:49.130 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(2), maelstrom_weapon(5), legacy_of_the_frost_witch, corrupting_rage
3:50.368 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), legacy_of_the_frost_witch, corrupting_rage
3:51.805 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, corrupting_rage
3:53.043 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, corrupting_rage
3:54.281 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, corrupting_rage
3:55.519 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, corrupting_rage
3:56.757 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, corrupting_rage
3:57.995 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:59.233 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:00.471 single M windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:01.296 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:02.534 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:03.772 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:05.009 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(4), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:06.247 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:07.485 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:08.723 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:09.961 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:11.198 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:12.436 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:13.674 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion
4:15.009 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion
4:16.247 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(4), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited
4:17.484 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(4), maelstrom_weapon, ice_strike, sophic_devotion, forgestorm_ignited
4:18.722 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(4), maelstrom_weapon(2), ice_strike, sophic_devotion, forgestorm_ignited
4:19.960 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, sophic_devotion, forgestorm_ignited
4:21.198 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited
4:22.436 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), sophic_devotion, forgestorm_ignited
4:23.674 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited
4:24.910 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited
4:26.148 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited
4:27.385 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
4:28.623 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, corrupting_rage
4:29.861 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(10), ice_strike, corrupting_rage
4:31.098 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:32.336 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:33.574 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(4), doom_winds, ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:34.811 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(5), doom_winds, ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:36.049 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds, legacy_of_the_frost_witch, corrupting_rage
4:37.286 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, corrupting_rage
4:38.524 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, corrupting_rage
4:39.762 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, corrupting_rage
4:40.999 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), corrupting_rage
4:42.236 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), corrupting_rage
4:43.473 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), corrupting_rage
4:44.711 single O flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, corrupting_rage
4:45.949 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
4:47.187 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
4:48.424 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
4:49.662 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon, ice_strike, spiraling_winds(2), corrupting_rage
4:50.900 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(2), corrupting_rage
4:52.138 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, spiraling_winds(3), corrupting_rage
4:53.376 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(4), sophic_devotion, corrupting_rage
4:54.614 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(5), sophic_devotion, corrupting_rage
4:55.851 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, corrupting_rage
4:57.089 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, corrupting_rage
4:58.326 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage
4:59.564 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 250000 250000 0
Spell Power 6635 6149 0
Crit 21.84% 15.63% 1013
Haste 21.55% 21.55% 3663
Versatility 3.93% 0.93% 191
Mana Regen 2560 2560 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [16]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [29]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQJJSIAAAAAAAAAAAAgSESCJkioQSDAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
actions+=/primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
actions+=/call_action_list,name=funnel,if=active_enemies>1&rotation.funnel

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.funnel=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.funnel+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.funnel+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/windstrike,if=(talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1)|buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/stormstrike,if=buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&buff.crackling_thunder.up
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)|(talent.converging_storms.enabled&buff.converging_storms.stack<buff.converging_storms.max_stack)
actions.funnel+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.funnel+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.funnel+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.funnel+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.funnel+=/sundering
actions.funnel+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.funnel+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=3
actions.funnel+=/stormstrike,if=buff.crash_lightning.up&talent.deeply_rooted_elements.enabled
actions.funnel+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.funnel+=/windstrike
actions.funnel+=/stormstrike
actions.funnel+=/ice_strike
actions.funnel+=/lava_lash
actions.funnel+=/crash_lightning
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=2
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5
actions.funnel+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.funnel+=/flame_shock,if=!ticking
actions.funnel+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
actions.single+=/primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
actions.single+=/lava_lash,if=talent.lashing_flames.enabled
actions.single+=/ice_strike,if=!buff.ice_strike.up
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/ice_strike
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=action.sundering.cooldown
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Ele : 59308 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
59308.3 59308.3 55.8 / 0.094% 9624.1 / 16.2% 107.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
525.6 524.4 Mana 0.32% 53.7 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkESSSDlEAAAAAAAAAAAAAKRIJkQKiCJNAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Ele 59308
Elemental Blast 11377 19.2% 24.8 12.23s 137648 120308 Direct 24.8 113455 226964 137709 21.4% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.78 24.77 0.00 0.00 0.00 1.1441 0.0000 3410624.42 3410624.42 0.00% 120308.46 120308.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.64% 19.48 8 29 113455.42 46821 264053 113467.85 94405 137599 2209653 2209653 0.00%
crit 21.36% 5.29 0 14 226964.13 93643 520221 226436.69 0 384828 1200971 1200971 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:0.29
  • if_expr:buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
    single
    [O]:6.41
  • if_expr:buff.maelstrom_weapon.stack>=5&charges=max_charges
    single
    [Q]:18.08
  • if_expr:buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Resource Cost 2Enhancement Shaman13704112PCT-1.000
Spell Direct AmountEnhancement Shaman13704122PCT-0.090
Spell Direct AmountEnhancement Shaman13704123PCT0.100
Spell Direct AmountFire and Ice3828861PCT0.030
Flame Shock 5866 9.9% 90.4 3.31s 19446 152691 Direct 90.4 7003 14023 8524 21.7% 0.0%
Periodic 196.0 4140 8290 5038 21.7% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.41 90.41 195.98 195.98 89.41 0.1274 1.5215 1758083.98 1758083.98 0.00% 5677.04 152690.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.33% 70.81 38 105 7003.23 3928 17452 7004.12 6009 8178 495932 495932 0.00%
crit 21.67% 19.59 5 42 14022.89 7856 35294 14021.72 10902 18019 274764 274764 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 78.34% 153.53 111 199 4139.50 2271 10498 4139.88 3658 4745 635559 635559 0.00%
crit 21.66% 42.44 17 74 8289.88 4542 20007 8290.78 6946 10029 351829 351829 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Volcanic damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Volcanic damage and then an additional {$=}o2 Volcanic damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Volcanic damage and knocking them into the air.]

Action Priority List

    single
    [a]:9.74

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Spell Periodic AmountFire and Ice3828862PCT0.030
Flametongue Weapon 0 (968) 0.0% (1.6%) 1.0 0.00s 290264 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFire and Ice3828861PCT0.030
    Flametongue Attack 968 1.6% 610.6 0.74s 475 0 Direct 610.6 391 782 475 21.6% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 610.56 610.56 0.00 0.00 0.00 0.0000 0.0000 290264.03 290264.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.37% 478.51 343 625 390.72 297 1076 390.75 337 449 186963 186963 0.00%
crit 21.63% 132.05 79 200 782.29 594 2124 782.34 685 918 103301 103301 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Forgestorm Ignited (_damage) 1264 2.1% 28.9 7.55s 13135 0 Direct 28.9 10808 21616 13135 21.5% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.88 28.88 0.00 0.00 0.00 0.0000 0.0000 379380.76 379380.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.47% 22.66 2 63 10807.74 10705 11241 10798.96 10705 11158 244945 244945 0.00%
crit 21.53% 6.22 0 20 21616.21 21411 22481 21402.50 0 22481 134436 134436 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 6484 10.9% 42.8 6.95s 45382 39789 Direct 42.8 37282 74662 45382 21.7% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.84 42.84 0.00 0.00 0.00 1.1406 0.0000 1944123.21 1944123.21 0.00% 39788.85 39788.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.33% 33.56 18 52 37282.08 7863 112719 37343.50 29615 47292 1251041 1251041 0.00%
crit 21.67% 9.28 0 23 74661.66 15726 228899 74775.32 0 146818 693083 693083 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [V]:42.57
  • if_expr:buff.hailstorm.up
    single
    [Y]:0.27

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownEnhancement Shaman1370417ADD6000.000
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Ice Strike 2402 4.0% 24.1 12.54s 29811 26145 Direct 24.1 24497 49033 29810 21.7% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.15 24.15 0.00 0.00 0.00 1.1402 0.0000 719837.05 719837.05 0.00% 26145.47 26145.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.34% 18.92 9 29 24496.53 18491 52323 24499.70 21002 29702 463402 463402 0.00%
crit 21.66% 5.23 0 13 49033.32 36982 104647 48951.35 0 92671 256435 256435 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [T]:24.15
  • if_expr:talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Lava Lash 12624 21.3% 73.7 4.04s 51347 45110 Direct 73.7 (73.7) 42182 84284 51347 21.8% (21.8%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 73.69 73.69 0.00 0.00 0.00 1.1383 0.0000 3783687.72 3783687.72 0.00% 45109.96 45109.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.23% 57.65 29 94 42181.75 21811 132542 42173.66 34996 51630 2431625 2431625 0.00%
crit 21.77% 16.04 3 34 84283.54 43621 216746 84274.11 66126 116616 1352063 1352063 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [M]:48.64
  • if_expr:buff.hot_hand.up
    single
    [U]:25.05
  • if_expr:talent.lashing_flames.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownMolten Assault3340331ADD-6000.000
Spell Direct AmountFire and Ice3828861PCT0.030
Lightning Bolt 6065 10.2% 28.7 10.37s 63361 53848 Direct 28.7 52021 104108 63360 21.8% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.69 28.69 0.00 0.00 0.00 1.1767 0.0000 1817579.60 1817579.60 0.00% 53847.83 53847.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.23% 22.44 11 36 52021.34 29583 152558 52070.81 42873 66689 1167434 1167434 0.00%
crit 21.77% 6.24 0 18 104107.92 59166 247965 104082.94 0 163245 650146 650146 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.91

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [P]:6.93
  • if_expr:buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [R]:12.51
  • if_expr:((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
    single
    [X]:9.25
  • if_expr:talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
main_hand 1811 3.1% 194.1 1.80s 2797 1606 Direct 194.1 2658 5317 2797 21.6% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 194.10 194.10 0.00 0.00 0.00 1.7416 0.0000 542886.20 775571.49 30.00% 1605.99 1605.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.02% 120.39 79 166 2657.60 2257 4294 2657.55 2451 2967 319940 457069 30.00%
crit 21.60% 41.93 15 68 5316.83 4513 8506 5317.19 4757 6002 222946 318503 30.00%
miss 16.37% 31.78 13 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 927 1.6% 198.2 1.76s 1403 807 Direct 198.2 1332 2666 1403 21.6% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 198.21 198.21 0.00 0.00 0.00 1.7386 0.0000 277990.92 397140.01 30.00% 806.68 806.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.00% 122.89 72 173 1332.02 1128 2151 1332.02 1222 1492 163699 233861 30.00%
crit 21.63% 42.87 22 74 2665.95 2257 4244 2666.24 2407 3012 114292 163279 30.00%
miss 16.37% 32.44 12 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 0 (3738) 0.0% (6.3%) 7.0 46.18s 160406 134227

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 0.00 0.00 0.00 0.00 1.1951 0.0000 0.00 0.00 0.00% 134226.62 134226.62

Action Details: Primordial Wave

  • id:375982
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:elemental
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:1.00
  • if_expr:!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
    single
    [S]:5.98
  • if_expr:raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
    Primordial Wave (_damage) 1104 1.9% 7.0 46.18s 47395 0 Direct 7.0 38923 78057 47395 21.6% 0.0%

Stats Details: Primordial Wave Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 0.00 0.0000 0.0000 330619.64 330619.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.35% 5.47 0 8 38922.82 31064 59522 38919.06 0 52874 212740 212740 0.00%
crit 21.65% 1.51 0 6 78056.50 62128 119044 62885.40 0 119044 117879 117879 0.00%

Action Details: Primordial Wave Damage

  • id:375984
  • school:elemental
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:6.00

Spelldata

  • id:375984
  • name:Primordial Wave
  • school:elemental
  • tooltip:
  • description:{$@spelldesc375982=Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman13704121PCT5.000
    Lightning Bolt (_pw) 2634 4.4% 6.9 45.77s 113805 0 Direct 6.9 93677 188148 113805 21.3% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 0.00 0.0000 0.0000 788696.13 788696.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.70% 5.45 1 8 93676.69 59166 189120 93720.51 69027 137383 510899 510899 0.00%
crit 21.30% 1.48 0 6 188147.72 118331 374994 152960.45 0 358396 277797 277797 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.91

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
Stormstrike 0 (1891) 0.0% (3.2%) 32.3 9.14s 17558 15359

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.28 0.00 0.00 0.00 0.00 1.1432 0.0000 0.00 0.00 0.00% 15359.35 15359.35

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [W]:32.28

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
    Stormstrike (_mh) 1261 2.1% 32.3 9.14s 11707 0 Direct 32.3 9622 19237 11707 21.7% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.28 32.28 0.00 0.00 0.00 0.0000 0.0000 377947.09 539938.18 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.32% 25.28 10 41 9622.18 8138 15312 9622.95 8516 11074 243280 347551 30.00%
crit 21.68% 7.00 0 18 19237.06 16276 30539 19228.03 0 27631 134667 192387 29.97%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
    Stormstrike Off-Hand 630 1.1% 32.3 9.14s 5851 0 Direct 32.3 4810 9627 5851 21.6% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.28 32.28 0.00 0.00 0.00 0.0000 0.0000 188904.95 269871.09 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.38% 25.30 9 43 4809.90 4069 7656 4809.87 4299 5684 121709 173874 30.00%
crit 21.62% 6.98 0 20 9627.17 8138 15282 9625.43 0 13601 67196 95997 29.98%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
Windfury Weapon 0 (903) 0.0% (1.5%) 1.0 0.00s 270739 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 903 1.5% 120.1 5.13s 2255 0 Direct 120.1 1853 3712 2255 21.6% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.07 120.07 0.00 0.00 0.00 0.0000 0.0000 270739.20 386780.15 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.39% 94.12 46 151 1853.20 1565 3022 1853.31 1664 2074 174421 249180 30.00%
crit 21.61% 25.95 7 50 3711.53 3130 6056 3711.37 3200 4567 96318 137600 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
pet - greater_earth_elemental 499 / 107
melee 499 0.2% 44.2 2.51s 720 507 Direct 44.2 592 1186 720 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.15 44.15 0.00 0.00 0.00 1.4206 0.0000 31791.44 45417.50 30.00% 506.87 506.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.39% 34.61 18 68 591.76 488 905 589.25 488 752 20481 29259 30.00%
crit 21.61% 9.54 1 30 1185.58 976 1810 1180.33 976 1570 11310 16158 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2460 / 958
melee 2460 1.6% 120.1 2.68s 2388 2139 Direct 120.1 1962 3929 2388 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.10 120.10 0.00 0.00 0.00 1.1160 0.0000 286756.71 409662.88 30.00% 2139.45 2139.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.38% 94.14 9 201 1962.43 1630 3124 1960.36 1630 2417 184737 263916 30.00%
crit 21.62% 25.97 1 65 3928.78 3260 6247 3924.99 3260 4967 102020 145747 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2468 / 965
melee 2468 1.6% 120.8 2.68s 2392 2144 Direct 120.8 1963 3934 2392 21.7% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.80 120.80 0.00 0.00 0.00 1.1157 0.0000 288914.48 412745.49 30.00% 2143.65 2143.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.26% 94.53 6 224 1963.15 1630 3160 1960.97 1630 2369 185583 265125 30.00%
crit 21.74% 26.27 2 74 3933.86 3260 6247 3927.83 3260 5256 103332 147621 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2462 / 959
melee 2462 1.6% 120.3 2.67s 2388 2140 Direct 120.3 1962 3929 2388 21.7% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.27 120.27 0.00 0.00 0.00 1.1160 0.0000 287261.05 410383.39 30.00% 2140.15 2140.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.31% 94.19 6 209 1961.71 1630 3160 1959.89 1630 2590 184767 263959 30.00%
crit 21.69% 26.09 1 64 3929.06 3260 6321 3923.99 3260 5114 102494 146424 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Ele
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.2 310.63s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.20 0.00 0.00 0.00 0.00 0.9294 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Z]:1.20
Feral Spirit 14.4 22.14s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.37 0.00 0.00 0.00 0.00 1.1340 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:14.37

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 303.46s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 3.0 116.81s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.05 0.00 0.00 0.00 0.00 0.5484 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Action Priority List

    single
    [N]:1.66
  • if_expr:!buff.windfury_totem.up
    single
    [b]:0.39
  • if_expr:buff.windfury_totem.remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 73.2 122.7 4.1s 1.5s 3.3s 80.02% 98.32% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 15.3s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.8s
  • uptime_min/max:70.85% / 87.12%

Stack Uptimes

  • ashen_catalyst_1:33.62%
  • ashen_catalyst_2:18.09%
  • ashen_catalyst_3:12.71%
  • ashen_catalyst_4:10.11%
  • ashen_catalyst_5:4.24%
  • ashen_catalyst_6:0.98%
  • ashen_catalyst_7:0.23%
  • ashen_catalyst_8:0.04%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.5s 58.6s 50.5s 80.35% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 335.0s
  • trigger_min/max:15.0s / 309.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.6s
  • uptime_min/max:40.12% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.35%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Crackling Surge 8.0 0.0 37.0s 36.7s 15.0s 39.09% 43.99% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.3s / 275.5s
  • trigger_min/max:11.3s / 275.5s
  • trigger_pct:84.56%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:5.17% / 70.21%

Stack Uptimes

  • crackling_surge_1:31.22%
  • crackling_surge_2:7.85%
  • crackling_surge_3:0.02%
  • crackling_surge_4:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases Nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4s 5.3s 17.8s 12.06% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 165.8s
  • trigger_pct:100.00%
  • duration_min/max:15.1s / 20.0s
  • uptime_min/max:9.82% / 15.06%

Stack Uptimes

  • crumbling_power_1:0.43%
  • crumbling_power_2:0.63%
  • crumbling_power_3:0.65%
  • crumbling_power_4:0.64%
  • crumbling_power_5:0.63%
  • crumbling_power_6:0.62%
  • crumbling_power_7:0.62%
  • crumbling_power_8:0.60%
  • crumbling_power_9:0.59%
  • crumbling_power_10:0.60%
  • crumbling_power_11:0.62%
  • crumbling_power_12:0.64%
  • crumbling_power_13:0.66%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.68%
  • crumbling_power_16:0.69%
  • crumbling_power_17:0.69%
  • crumbling_power_18:0.69%
  • crumbling_power_19:0.70%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Elemental Blast: Critical Strike 8.3 0.0 35.1s 35.1s 9.8s 27.14% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 218.7s
  • trigger_min/max:10.0s / 218.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.87% / 49.04%

Stack Uptimes

  • elemental_blast_critical_strike_1:27.14%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 8.2 0.0 35.3s 35.3s 9.8s 27.03% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 245.8s
  • trigger_min/max:10.0s / 245.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.46% / 49.43%

Stack Uptimes

  • elemental_blast_haste_1:27.03%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 8.3 0.0 35.2s 35.2s 9.8s 27.11% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 245.6s
  • trigger_min/max:10.0s / 245.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.60% / 49.81%

Stack Uptimes

  • elemental_blast_mastery_1:27.11%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.0s 303.5s 27.5s 13.45% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 315.3s
  • trigger_min/max:300.0s / 315.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.97% / 18.16%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.45%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 13.8 0.6 22.6s 22.1s 15.2s 70.03% 0.00% 56.7 (56.7) 13.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 45.5s
  • trigger_min/max:12.8s / 34.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:64.58% / 76.19%

Stack Uptimes

  • feral_spirit_1:70.03%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 44.5 282.2 6.8s 0.9s 5.6s 83.37% 89.82% 282.2 (619.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 68.7s
  • trigger_min/max:0.0s / 15.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.7s
  • uptime_min/max:72.24% / 93.06%

Stack Uptimes

  • flurry_1:21.75%
  • flurry_2:36.66%
  • flurry_3:24.97%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.3s 46.1s 13.0s 19.53% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 205.5s
  • trigger_min/max:0.2s / 204.0s
  • trigger_pct:98.93%
  • duration_min/max:0.0s / 60.6s
  • uptime_min/max:3.81% / 48.33%

Stack Uptimes

  • forgestorm_ignited_1:19.53%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 43.1 10.4 7.0s 5.6s 3.6s 51.96% 99.38% 10.3 (78.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 34.9s
  • trigger_min/max:1.0s / 19.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 32.4s
  • uptime_min/max:37.47% / 68.61%

Stack Uptimes

  • hailstorm_5:4.16%
  • hailstorm_6:3.86%
  • hailstorm_7:3.55%
  • hailstorm_8:10.56%
  • hailstorm_9:7.70%
  • hailstorm_10:22.13%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.7 5.7 27.4s 17.3s 9.9s 35.39% 86.47% 5.7 (5.7) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 178.2s
  • trigger_min/max:0.0s / 178.2s
  • trigger_pct:5.01%
  • duration_min/max:0.0s / 54.1s
  • uptime_min/max:8.31% / 66.41%

Stack Uptimes

  • hot_hand_1:35.39%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.1 0.0 12.6s 12.5s 3.5s 27.74% 55.49% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 30.1s
  • trigger_min/max:7.7s / 30.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.6s
  • uptime_min/max:16.36% / 41.60%

Stack Uptimes

  • ice_strike_1:27.74%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 8.0 0.0 37.1s 36.8s 15.0s 38.88% 100.00% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.7s / 242.6s
  • trigger_min/max:10.7s / 242.6s
  • trigger_pct:84.60%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:4.31% / 68.29%

Stack Uptimes

  • icy_edge_1:31.07%
  • icy_edge_2:7.79%
  • icy_edge_3:0.02%
  • icy_edge_4:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases Frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 54.3 379.2 5.6s 0.7s 4.6s 83.98% 100.00% 28.3 (41.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 19.0s
  • trigger_min/max:0.0s / 6.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.7s
  • uptime_min/max:79.48% / 88.89%

Stack Uptimes

  • maelstrom_weapon_1:9.71%
  • maelstrom_weapon_2:10.00%
  • maelstrom_weapon_3:10.17%
  • maelstrom_weapon_4:10.11%
  • maelstrom_weapon_5:9.05%
  • maelstrom_weapon_6:8.15%
  • maelstrom_weapon_7:7.24%
  • maelstrom_weapon_8:6.33%
  • maelstrom_weapon_9:4.14%
  • maelstrom_weapon_10:9.07%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 8.0 0.0 37.0s 36.6s 15.0s 38.95% 100.00% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.6s / 283.2s
  • trigger_min/max:10.6s / 283.2s
  • trigger_pct:84.57%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:5.99% / 71.45%

Stack Uptimes

  • molten_weapon_1:31.15%
  • molten_weapon_2:7.77%
  • molten_weapon_3:0.02%
  • molten_weapon_4:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases Fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Wave 7.0 0.0 46.2s 46.2s 2.7s 6.33% 24.26% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 57.3s
  • trigger_min/max:45.0s / 57.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:3.11% / 14.02%

Stack Uptimes

  • primordial_wave_1:6.33%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.1 60.6s 45.5s 16.5s 23.69% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 213.0s
  • trigger_min/max:0.0s / 206.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.9s
  • uptime_min/max:4.77% / 56.45%

Stack Uptimes

  • sophic_devotion_1:23.69%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.0s 45.6s 32.1s 38.22% 0.00% 25.6 (25.6) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 263.0s
  • trigger_min/max:0.1s / 210.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 184.5s
  • uptime_min/max:8.35% / 86.52%

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.30%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.22%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.76%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 6.9 0.0 45.8s 45.8s 11.8s 27.27% 31.06% 0.0 (0.0) 6.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:32.2s / 95.1s
  • trigger_min/max:32.2s / 95.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:22.23% / 29.88%

Stack Uptimes

  • splintered_elements_1:27.27%

Spelldata

  • id:382043
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc382042=Primordial Wave grants you {$s1=20}% Haste plus {$s2=4}% for each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave for {$382043d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 15.9 5.1 18.3s 13.7s 5.6s 29.60% 44.16% 5.1 (5.1) 1.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 178.5s
  • trigger_min/max:0.0s / 178.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.0s
  • uptime_min/max:6.76% / 57.38%

Stack Uptimes

  • stormbringer_1:29.60%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 27.0 9.0 51.0 10.9s 1.1s 119.4s
Windfury (Off Hand) 27.3 9.0 50.0 10.7s 1.1s 116.8s
Elemental Blast: Critical Strike 8.3 1.0 17.0 35.1s 10.0s 218.7s
Elemental Blast: Haste 8.2 1.0 18.0 35.3s 10.0s 245.8s
Elemental Blast: Mastery 8.3 1.0 16.0 35.2s 10.0s 245.6s
Maelstrom Weapon Swing Reset 6.9 5.0 8.0 45.8s 32.2s 95.1s
Flametongue: Windfury Attack 120.1 62.0 186.0 5.1s 0.0s 66.3s
Stormbringer: Windfury Attack 8.9 0.0 25.0 31.1s 0.0s 305.5s
Flametongue: main_hand 162.3 112.0 215.0 2.2s 1.1s 18.1s
Hot Hand: main_hand 8.1 0.0 21.0 32.8s 1.1s 287.8s
Windfury: main_hand 44.5 19.0 77.0 7.0s 1.1s 85.6s
Flametongue: offhand 165.8 114.0 219.0 2.2s 1.1s 18.1s
Hot Hand: offhand 8.3 0.0 21.0 32.3s 1.1s 296.4s
Flametongue: Lava Lash 73.7 41.0 112.0 4.0s 0.8s 15.4s
Stormbringer: Lava Lash 5.5 0.0 17.0 44.4s 0.8s 310.7s
Flametongue: Ice Strike 24.1 17.0 30.0 12.5s 7.7s 30.1s
Stormbringer: Ice Strike 1.8 0.0 9.0 81.7s 7.9s 344.5s
Windfury: Ice Strike 6.6 0.0 15.0 40.9s 7.9s 303.4s
Flametongue: Stormstrike 32.3 18.0 49.0 9.1s 0.8s 76.5s
Stormbringer: Stormstrike 2.4 0.0 10.0 68.3s 0.8s 335.9s
Windfury: Stormstrike 8.9 0.0 24.0 30.5s 0.8s 261.1s
Flametongue: Stormstrike Off-Hand 32.3 18.0 49.0 9.1s 0.8s 76.5s
Stormbringer: Stormstrike Off-Hand 2.4 0.0 10.0 69.2s 0.8s 340.1s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 42.53% 32.75% 50.39% 0.7s 0.0s 4.7s
Hot Hand 35.39% 8.31% 66.41% 9.9s 0.0s 54.1s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike
Stormstrike		3.8860.00056.353127.76056.679206.635
Primordial Wave1.1330.00012.2547.9401.37826.611
Feral Spirit0.7750.0001.50811.1553.21218.737
Lava Lash0.5720.0008.08642.25919.30467.139
Elemental Blast0.5050.00013.23912.5851.78540.612
Ice Strike1.1990.00017.64329.1168.29664.356
Frost Shock2.4250.00029.427104.87055.697167.302
Flame Shock23.8330.000292.163253.889168.753343.653
Earth Elemental19.3460.000230.15425.3816.148230.154

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack26.72.25.87%5.30%
main_hand35.73.47.85%8.13%
offhand36.53.38.03%7.84%
Primordial Wave50.219.611.05%46.83%
Feral Spirit76.66.416.86%15.29%
Lava Lash84.56.818.60%16.29%
Ice Strike54.00.111.89%0.17%
Frost Shock42.60.09.37%0.00%
Stormstrike32.20.17.09%0.15%
Stormstrike (_mh)7.70.01.70%0.00%
Stormstrike Off-Hand7.70.01.70%0.00%
Overflow Stacks0.041.80.00%8.42%
Actual Stacks454.50.091.58%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt234.652.09%
Elemental Blast215.847.91%
Total Spent450.4100.00%
Casts per Maelstrom Weapon Stack Consumed
Ability 0 1 2 3 4 5 6 7 8 9 10
Lightning Bolt          3.11 3.07 3.06 5.69 3.86 9.89
Elemental Blast          1.11 1.01 0.87 7.16 5.51 9.12
Total           4.22
(7.90%)		 4.08
(7.63%)		 3.93
(7.36%)		 12.85
(24.03%)		 9.37
(17.52%)		 19.02
(35.57%)

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Ele
Mana RegenMana631.67157323.88100.00%249.06609691.1779.49%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 270980.0 0.00 865.74 0.0 11259.0 -459565.5 270980.0
Mana 250000.0 524.41 525.59 609691.0 249647.7 248350.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement_Ele
BloodlustMana 1.001000.000.63%1000.001000.000.00
Flame ShockMana 9.747307.834.63%750.0080.83240.58
Frost ShockMana 42.8421419.6813.58%500.00500.0090.76
Ice StrikeMana 24.1539842.4125.27%1650.001650.0018.07
Lava LashMana 73.6929475.2718.69%400.00400.00128.37
Lightning BoltMana 28.6914343.159.10%500.00500.00126.72
Primordial WaveMana 6.9810467.006.64%1500.001500.00106.94
StormstrikeMana 32.2832283.8320.47%1000.001000.0117.56
Windfury TotemMana 3.051536.900.97%504.03504.030.00

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Ele Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Ele Damage Per Second
Count 7499
Mean 59308.34
Minimum 50112.67
Maximum 72152.67
Spread ( max - min ) 22040.00
Range [ ( max - min ) / 2 * 100% ] 18.58%
Standard Deviation 2467.5669
5th Percentile 55368.53
95th Percentile 63554.79
( 95th Percentile - 5th Percentile ) 8186.27
Mean Distribution
Standard Deviation 28.4949
95.00% Confidence Interval ( 59252.49 - 59364.19 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 67
0.1% Error 6650
0.1 Scale Factor Error with Delta=300 51979
0.05 Scale Factor Error with Delta=300 207913
0.01 Scale Factor Error with Delta=300 5197824
Priority Target DPS
PR_Shaman_Enhancement_Ele Priority Target Damage Per Second
Count 7499
Mean 59308.34
Minimum 50112.67
Maximum 72152.67
Spread ( max - min ) 22040.00
Range [ ( max - min ) / 2 * 100% ] 18.58%
Standard Deviation 2467.5669
5th Percentile 55368.53
95th Percentile 63554.79
( 95th Percentile - 5th Percentile ) 8186.27
Mean Distribution
Standard Deviation 28.4949
95.00% Confidence Interval ( 59252.49 - 59364.19 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 67
0.1% Error 6650
0.1 Scale Factor Error with Delta=300 51979
0.05 Scale Factor Error with Delta=300 207913
0.01 Scale Factor Error with Delta=300 5197824
DPS(e)
PR_Shaman_Enhancement_Ele Damage Per Second (Effective)
Count 7499
Mean 59308.34
Minimum 50112.67
Maximum 72152.67
Spread ( max - min ) 22040.00
Range [ ( max - min ) / 2 * 100% ] 18.58%
Damage
PR_Shaman_Enhancement_Ele Damage
Count 7499
Mean 16881364.92
Minimum 12347475.57
Maximum 21873593.67
Spread ( max - min ) 9526118.10
Range [ ( max - min ) / 2 * 100% ] 28.21%
DTPS
PR_Shaman_Enhancement_Ele Damage Taken Per Second
Count 7499
Mean 865.47
Minimum 0.00
Maximum 2651.18
Spread ( max - min ) 2651.18
Range [ ( max - min ) / 2 * 100% ] 153.16%
HPS
PR_Shaman_Enhancement_Ele Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Ele Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Ele Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Ele Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Ele Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_EleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Ele Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
0.00 primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
G 14.37 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
0.00 doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
I 0.00 call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
J 0.00 call_action_list,name=funnel,if=active_enemies>1&rotation.funnel
actions.single
# count action,conditions
K 1.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
L 0.29 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
0.00 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
M 48.64 lava_lash,if=buff.hot_hand.up
N 1.66 windfury_totem,if=!buff.windfury_totem.up
O 6.41 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
P 6.93 lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
Q 18.08 elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
R 12.51 lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
S 5.98 primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
0.00 flame_shock,if=!ticking
T 24.15 ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
U 25.05 lava_lash,if=talent.lashing_flames.enabled
0.00 ice_strike,if=!buff.ice_strike.up
V 42.57 frost_shock,if=buff.hailstorm.up
0.00 lava_lash
0.00 ice_strike
0.00 windstrike
W 32.28 stormstrike
0.00 sundering,if=raid_event.adds.in>=action.sundering.cooldown
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
X 9.25 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 0.27 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Z 1.20 earth_elemental
a 9.74 flame_shock
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
b 0.39 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGKMOMTMVMPMVWQUTVGMQMMVMRMMTMRMVMWMRMGTQUVWWQVUZTRSPUGVWXaTUVQWaVXUWTVRWUMGMOMTMVMQMVWMRMMSGMPMMTMOMVMQMVMTMMRMNMGMVTQWUVMXMVMRTMOMGMSPUVTWQVUXWVWRGTUOVWXaVUWQTEFVMRMVGMWMQMTSPMMVMQMGMQTMVMRMVMWQTVWRUGVWXWMTMQMVMRMNMSGMMMPMTMOMVWXUVWTRVUWGOVWXMTMMVMOMVWURSGPTUOV

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 2 augmentation PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 3 windfury_weapon PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 4 flametongue_weapon PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 6 windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana flurry(3), corrupting_rage
0:00.000 default B bloodlust Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), corrupting_rage
0:00.000 default C potion Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage
0:00.000 default D auto_attack Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(2), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default F berserking PR_Shaman_Enhancement_Ele 249000.0/250000: 100% mana bloodlust, flurry(2), crumbling_power(20), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, berserking, flurry(2), crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:00.894 single K primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, icy_edge, molten_weapon, maelstrom_weapon, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:01.788 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), primordial_wave, feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(10), crumbling_power(18), corrupting_rage, elemental_potion_of_ultimate_power
0:02.682 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(10), crumbling_power(17), corrupting_rage, elemental_potion_of_ultimate_power
0:03.576 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(10), crumbling_power(16), corrupting_rage, elemental_potion_of_ultimate_power
0:04.470 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(3), hailstorm(10), crumbling_power(15), corrupting_rage, elemental_potion_of_ultimate_power
0:05.364 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), ice_strike, crumbling_power(14), corrupting_rage, elemental_potion_of_ultimate_power
0:06.257 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(10), ice_strike, crumbling_power(13), corrupting_rage, elemental_potion_of_ultimate_power
0:07.151 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), crumbling_power(12), corrupting_rage, elemental_potion_of_ultimate_power
0:08.045 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(9), crumbling_power(11), corrupting_rage, elemental_potion_of_ultimate_power
0:08.938 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, hailstorm(9), crumbling_power(10), corrupting_rage, elemental_potion_of_ultimate_power
0:09.691 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, maelstrom_weapon(4), hailstorm(9), crumbling_power(9), corrupting_rage, elemental_potion_of_ultimate_power
0:10.445 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(6), crumbling_power(8), corrupting_rage, elemental_potion_of_ultimate_power
0:11.199 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(8), crumbling_power(7), corrupting_rage, elemental_potion_of_ultimate_power
0:11.953 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hailstorm(8), crumbling_power(6), corrupting_rage, elemental_potion_of_ultimate_power
0:12.909 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, maelstrom_weapon(4), hailstorm(8), crumbling_power(5), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:13.728 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(7), hailstorm(8), ice_strike, crumbling_power(4), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:14.547 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(9), crumbling_power(3), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:15.366 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), hot_hand, maelstrom_weapon(10), crumbling_power(2), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:16.185 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), hot_hand, maelstrom_weapon(10), crumbling_power, forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:17.004 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:17.823 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(10), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:18.641 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(10), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:19.459 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:20.278 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:21.261 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:22.244 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:23.226 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:24.209 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:25.192 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:26.175 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:27.158 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, crackling_surge(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:28.140 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:29.123 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power
0:30.106 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(9), forgestorm_ignited, corrupting_rage
0:31.088 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), hot_hand, maelstrom_weapon(10), forgestorm_ignited, corrupting_rage
0:32.071 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), corrupting_rage
0:33.054 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(4), hailstorm(10), corrupting_rage
0:34.037 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(6), hailstorm(10), corrupting_rage
0:35.020 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(8), hailstorm(10), ice_strike, corrupting_rage
0:36.003 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(2), hailstorm(10), ice_strike, corrupting_rage
0:36.986 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, corrupting_rage
0:37.968 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(5), corrupting_rage
0:38.951 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(7), corrupting_rage
0:39.934 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(9), corrupting_rage
0:40.916 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon, hailstorm(9), corrupting_rage
0:42.373 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(3), corrupting_rage
0:43.612 single Z earth_elemental Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), maelstrom_weapon(4), corrupting_rage
0:44.851 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(4), corrupting_rage
0:46.090 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(9), ice_strike, corrupting_rage
0:47.329 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(3), stormbringer, hailstorm(9), ice_strike, corrupting_rage
0:48.567 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, primordial_wave, ashen_catalyst(3), stormbringer, maelstrom_weapon(10), hailstorm(9), ice_strike, corrupting_rage
0:49.805 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst(4), stormbringer, hailstorm(10), ice_strike, corrupting_rage
0:50.927 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, corrupting_rage
0:52.117 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, corrupting_rage
0:53.181 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(5), corrupting_rage
0:54.245 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(7), corrupting_rage
0:55.309 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(4), hailstorm(7), corrupting_rage
0:56.373 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon, hailstorm(7), corrupting_rage
0:57.436 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(6), maelstrom_weapon(4), hailstorm(7), ice_strike, corrupting_rage
0:58.500 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(6), hailstorm(7), ice_strike, corrupting_rage
0:59.564 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(8), forgestorm_ignited, corrupting_rage
1:00.628 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon, hailstorm(8), forgestorm_ignited, corrupting_rage
1:01.904 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(3), hailstorm(8), forgestorm_ignited, corrupting_rage
1:03.178 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(5), hailstorm(8), forgestorm_ignited, corrupting_rage
1:04.454 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(6), forgestorm_ignited, corrupting_rage
1:05.729 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon, hailstorm(6), forgestorm_ignited, corrupting_rage
1:07.005 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, stormbringer, maelstrom_weapon(3), hailstorm(6), forgestorm_ignited, corrupting_rage
1:08.280 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), hailstorm(6), forgestorm_ignited, corrupting_rage
1:09.556 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), hailstorm(6), ice_strike, forgestorm_ignited, corrupting_rage
1:10.832 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(3), stormbringer, maelstrom_weapon(9), forgestorm_ignited
1:12.108 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst(4), stormbringer, hailstorm(9)
1:13.383 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon(2), hailstorm(9)
1:14.688 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), hot_hand, maelstrom_weapon(3), hailstorm(9)
1:15.964 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(9)
1:17.240 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(7), hailstorm(9), sophic_devotion
1:18.516 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(9), hailstorm(9), sophic_devotion
1:19.792 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), sophic_devotion
1:21.030 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), sophic_devotion
1:22.269 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(6), hailstorm(10), ice_strike, sophic_devotion
1:23.508 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), hailstorm(10), ice_strike, sophic_devotion
1:24.747 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(8), sophic_devotion
1:25.986 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), sophic_devotion, corrupting_rage
1:27.225 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, hailstorm(10), sophic_devotion, corrupting_rage
1:28.463 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(2), hailstorm(10), sophic_devotion, corrupting_rage
1:29.702 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(3), sophic_devotion, corrupting_rage
1:30.977 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(7), sophic_devotion, corrupting_rage
1:32.252 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(8), sophic_devotion, corrupting_rage
1:33.527 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, hailstorm(8), sophic_devotion, corrupting_rage
1:34.802 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, hot_hand, maelstrom_weapon, hailstorm(8), sophic_devotion, forgestorm_ignited, corrupting_rage
1:36.078 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(8), forgestorm_ignited, corrupting_rage
1:37.354 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, primordial_wave, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), hailstorm(8), forgestorm_ignited, corrupting_rage
1:38.630 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hot_hand, maelstrom_weapon(10), hailstorm(8), forgestorm_ignited, corrupting_rage
1:39.905 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(10), hailstorm(8), forgestorm_ignited, corrupting_rage
1:41.181 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), forgestorm_ignited, corrupting_rage
1:42.245 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), forgestorm_ignited, corrupting_rage
1:43.309 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), forgestorm_ignited, corrupting_rage
1:44.373 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(6), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
1:45.437 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(8), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
1:46.501 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, sophic_devotion, corrupting_rage
1:47.565 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), ice_strike, sophic_devotion, corrupting_rage
1:48.628 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), sophic_devotion, corrupting_rage
1:49.692 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(8), sophic_devotion, corrupting_rage
1:50.755 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, hailstorm(8), sophic_devotion, corrupting_rage
1:51.788 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(8), sophic_devotion, corrupting_rage
1:52.820 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), sophic_devotion, corrupting_rage
1:54.059 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, hot_hand, maelstrom_weapon(7), sophic_devotion, corrupting_rage
1:55.406 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, sophic_devotion, corrupting_rage
1:56.644 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, sophic_devotion, corrupting_rage
1:57.882 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, sophic_devotion, corrupting_rage
1:59.121 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst, hot_hand, hailstorm(10), ice_strike, sophic_devotion, corrupting_rage
2:00.360 single N windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, sophic_devotion, corrupting_rage
2:01.212 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, sophic_devotion, corrupting_rage
2:02.671 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), ice_strike, corrupting_rage
2:03.946 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), ice_strike, corrupting_rage
2:05.222 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(4), hailstorm(10), ice_strike, corrupting_rage
2:06.498 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(7), corrupting_rage
2:08.008 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(10), ice_strike, corrupting_rage
2:09.283 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon, hailstorm(10), ice_strike, corrupting_rage
2:10.559 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(2), hailstorm(10), ice_strike, corrupting_rage
2:11.834 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(5), hailstorm(10), ice_strike, corrupting_rage
2:13.110 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(6), corrupting_rage
2:14.386 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, crackling_surge(2), hot_hand, maelstrom_weapon(7), corrupting_rage
2:15.661 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(7), corrupting_rage
2:16.936 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(4), hailstorm(7), corrupting_rage
2:18.212 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(2), hot_hand, maelstrom_weapon(6), corrupting_rage
2:19.488 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), hot_hand, maelstrom_weapon(9), corrupting_rage
2:20.764 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hailstorm(9), corrupting_rage
2:22.040 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), hailstorm(9), ice_strike, corrupting_rage
2:23.316 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(9), ice_strike, corrupting_rage
2:24.591 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst, hot_hand, hailstorm(10), ice_strike, corrupting_rage
2:25.866 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), ice_strike, corrupting_rage
2:27.142 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), hailstorm(10), ice_strike, spiraling_winds, corrupting_rage
2:28.418 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(10), ice_strike, spiraling_winds, corrupting_rage
2:29.694 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(10), hailstorm(10), ice_strike, spiraling_winds(2), corrupting_rage
2:30.970 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hailstorm(10), ice_strike, spiraling_winds(2), corrupting_rage
2:32.033 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds(3), corrupting_rage
2:33.097 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), spiraling_winds(4), corrupting_rage
2:34.160 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(6), ice_strike, spiraling_winds(4), corrupting_rage
2:35.224 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(9), ice_strike, spiraling_winds(5), corrupting_rage
2:36.288 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon, hailstorm(9), ice_strike, spiraling_winds(5), corrupting_rage
2:37.321 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(3), spiraling_winds(6), sophic_devotion, corrupting_rage
2:38.354 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(5), spiraling_winds(6), sophic_devotion, corrupting_rage
2:39.387 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hailstorm(5), spiraling_winds(7), sophic_devotion, corrupting_rage
2:40.419 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), hailstorm(5), spiraling_winds(7), sophic_devotion, corrupting_rage
2:41.452 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, ashen_catalyst(3), stormbringer, maelstrom_weapon(6), spiraling_winds(8), sophic_devotion, corrupting_rage
2:42.485 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(8), spiraling_winds(8), sophic_devotion, corrupting_rage
2:43.723 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon, hailstorm(8), spiraling_winds(9), sophic_devotion, corrupting_rage
2:44.962 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), stormbringer, maelstrom_weapon(2), hailstorm(8), spiraling_winds(9), sophic_devotion, corrupting_rage
2:46.201 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(6), stormbringer, maelstrom_weapon(6), hailstorm(8), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
2:47.476 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, maelstrom_weapon(8), hailstorm(8), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
2:48.751 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, hailstorm(10), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
2:50.027 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), spiraling_winds(10), sophic_devotion, corrupting_rage
2:51.303 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(6), spiraling_winds(10), sophic_devotion
2:52.578 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon, hailstorm(6)
2:53.853 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon(2), hailstorm(6)
2:55.128 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_weapon(4)
2:56.404 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(7)
2:57.680 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(8), spiraling_winds
2:58.955 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon, hailstorm(8), spiraling_winds
3:00.194 default E use_item_irideus_fragment Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(6), hailstorm(8), ice_strike, spiraling_winds(2)
3:00.194 default F berserking PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(6), hailstorm(8), ice_strike, crumbling_power(20), spiraling_winds(2)
3:00.194 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana berserking, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(6), hailstorm(8), ice_strike, crumbling_power(19), spiraling_winds(2)
3:01.321 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_haste, ashen_catalyst(4), hot_hand, maelstrom_weapon(7), crumbling_power(19), spiraling_winds(2)
3:02.448 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), crumbling_power(18), spiraling_winds(3)
3:03.575 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), crumbling_power(17), spiraling_winds(4)
3:04.702 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana berserking, elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), crumbling_power(16), spiraling_winds(4)
3:05.828 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_haste, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), crumbling_power(15), spiraling_winds(5)
3:06.955 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(5), crumbling_power(14), spiraling_winds(5), corrupting_rage
3:08.081 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(7), crumbling_power(13), spiraling_winds(6), corrupting_rage
3:09.242 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), crumbling_power(12), spiraling_winds(6), corrupting_rage
3:10.402 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), crumbling_power(11), spiraling_winds(7), corrupting_rage
3:11.563 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), crumbling_power(10), spiraling_winds(8), corrupting_rage
3:12.690 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), crumbling_power(9), spiraling_winds(8), corrupting_rage
3:13.929 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(7), hailstorm(10), ice_strike, crumbling_power(8), spiraling_winds(9), corrupting_rage
3:15.168 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(10), hailstorm(10), ice_strike, crumbling_power(7), spiraling_winds(9), corrupting_rage
3:16.407 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, crumbling_power(6), spiraling_winds(10), corrupting_rage
3:17.440 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, crumbling_power(5), spiraling_winds(10), corrupting_rage
3:18.473 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), ice_strike, crumbling_power(4), spiraling_winds(10), corrupting_rage
3:19.506 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), crumbling_power(3), spiraling_winds(10), corrupting_rage
3:20.539 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(9), spiraling_winds(10), corrupting_rage
3:21.603 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(9), spiraling_winds(10), corrupting_rage
3:22.666 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(9), corrupting_rage
3:23.729 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(9), corrupting_rage
3:24.793 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(8), hailstorm(9), corrupting_rage
3:25.857 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(10), corrupting_rage
3:26.921 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(10), ice_strike, spiraling_winds, corrupting_rage
3:27.985 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(10), ice_strike, spiraling_winds, corrupting_rage
3:29.261 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), spiraling_winds(2), corrupting_rage
3:30.537 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(10), spiraling_winds(2), corrupting_rage
3:31.813 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), spiraling_winds(3), corrupting_rage
3:33.089 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), spiraling_winds(4), corrupting_rage
3:34.365 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), spiraling_winds(4), corrupting_rage
3:35.641 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, stormbringer, maelstrom_weapon(7), spiraling_winds(5), corrupting_rage
3:36.916 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(10), spiraling_winds(6), corrupting_rage
3:38.191 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), stormbringer, maelstrom_weapon, hailstorm(10), spiraling_winds(6), corrupting_rage
3:39.599 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, spiraling_winds(7), corrupting_rage
3:40.875 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(4), stormbringer, maelstrom_weapon(7), spiraling_winds(8), corrupting_rage
3:42.151 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(8), spiraling_winds(8), corrupting_rage
3:43.426 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, ashen_catalyst(5), hailstorm(8), spiraling_winds(9), corrupting_rage
3:44.702 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon, hailstorm(8), spiraling_winds(9), corrupting_rage
3:45.978 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(3), hailstorm(8), spiraling_winds(10), corrupting_rage
3:47.253 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
3:48.529 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(7), spiraling_winds(10), corrupting_rage
3:49.805 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, crackling_surge(2), ashen_catalyst(4), stormbringer, hailstorm(7), spiraling_winds(10), corrupting_rage
3:51.081 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst(5), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(7), spiraling_winds(10), corrupting_rage
3:52.357 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, crackling_surge(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(7), spiraling_winds(10), corrupting_rage
3:53.632 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(7), ice_strike, spiraling_winds(10), corrupting_rage
3:54.908 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(7), ice_strike, spiraling_winds(10), corrupting_rage
3:56.184 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, spiraling_winds(10), corrupting_rage
3:57.460 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), ice_strike, spiraling_winds(10), corrupting_rage
3:58.735 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), spiraling_winds(10), corrupting_rage
4:00.011 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), spiraling_winds(10), corrupting_rage
4:01.287 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), hot_hand, stormbringer, hailstorm(8), spiraling_winds(10), corrupting_rage
4:02.561 single N windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, hot_hand, maelstrom_weapon, hailstorm(8), spiraling_winds(10), corrupting_rage
4:03.413 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(8), spiraling_winds(10), corrupting_rage
4:04.689 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(8), spiraling_winds(10), corrupting_rage
4:05.965 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana primordial_wave, ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(8), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:07.241 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), hailstorm(8), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:08.517 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(8), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:09.793 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(8), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:11.069 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(8), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:12.345 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:13.409 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:14.473 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:15.537 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(10), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:16.601 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, spiraling_winds(10), forgestorm_ignited, corrupting_rage
4:17.634 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, corrupting_rage
4:18.667 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), corrupting_rage
4:19.699 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), corrupting_rage
4:20.731 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hailstorm(6), corrupting_rage
4:21.763 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(6), corrupting_rage
4:22.796 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), corrupting_rage
4:23.827 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(4), sophic_devotion, corrupting_rage
4:25.148 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), stormbringer, maelstrom_weapon(8), ice_strike, sophic_devotion, corrupting_rage
4:26.386 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(4), stormbringer, hailstorm(8), ice_strike, sophic_devotion, corrupting_rage
4:27.747 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(5), stormbringer, maelstrom_weapon, sophic_devotion, corrupting_rage
4:29.022 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, stormbringer, maelstrom_weapon(2), sophic_devotion, corrupting_rage
4:30.298 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, stormbringer, maelstrom_weapon(4), sophic_devotion, corrupting_rage
4:31.573 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(5), sophic_devotion, corrupting_rage
4:32.848 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(3), stormbringer, maelstrom_weapon, hailstorm(5), sophic_devotion, corrupting_rage
4:34.124 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(5), sophic_devotion, corrupting_rage
4:35.400 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(6), sophic_devotion, corrupting_rage
4:36.676 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(5), hot_hand, maelstrom_weapon, hailstorm(6), sophic_devotion, corrupting_rage
4:37.951 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(6), sophic_devotion, corrupting_rage
4:39.227 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(4), hailstorm(6), ice_strike, sophic_devotion, corrupting_rage
4:40.502 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon(2), hot_hand, maelstrom_weapon(6), hailstorm(6), ice_strike, sophic_devotion, corrupting_rage
4:41.778 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(6), ice_strike, sophic_devotion, corrupting_rage
4:43.054 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), sophic_devotion, corrupting_rage
4:44.330 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), sophic_devotion, corrupting_rage
4:45.606 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), sophic_devotion, corrupting_rage
4:46.882 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), sophic_devotion, corrupting_rage
4:48.158 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), sophic_devotion, corrupting_rage
4:49.432 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(7), sophic_devotion, corrupting_rage
4:50.706 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, stormbringer, maelstrom_weapon(8), sophic_devotion, forgestorm_ignited, corrupting_rage
4:51.982 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst, stormbringer, hailstorm(8), forgestorm_ignited, corrupting_rage
4:53.258 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, primordial_wave, ashen_catalyst(2), stormbringer, maelstrom_weapon(10), hailstorm(8), forgestorm_ignited, corrupting_rage
4:54.534 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(10), hailstorm(8), sophic_devotion, forgestorm_ignited, corrupting_rage
4:55.809 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), stormbringer, maelstrom_weapon, hailstorm(10), sophic_devotion, forgestorm_ignited, corrupting_rage
4:56.873 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, sophic_devotion, forgestorm_ignited, corrupting_rage
4:58.082 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, maelstrom_weapon(7), hailstorm(10), ice_strike, spiraling_winds, sophic_devotion, forgestorm_ignited, corrupting_rage
4:59.146 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, hailstorm(10), ice_strike, spiraling_winds(2), sophic_devotion, forgestorm_ignited, corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 250000 250000 0
Spell Power 6635 6149 0
Crit 22.03% 15.82% 1047
Haste 17.84% 17.84% 3032
Versatility 3.93% 0.93% 191
Mana Regen 2560 2560 0
Attack Power 5440 5012 0
Mastery 58.69% 58.69% 3842
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +519 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [16]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement_Ele"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkESSSDlEAAAAAAAAAAAAAKRIJkQKiCJNAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
actions+=/primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
actions+=/call_action_list,name=funnel,if=active_enemies>1&rotation.funnel

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.funnel=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.funnel+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.funnel+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/windstrike,if=(talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1)|buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/stormstrike,if=buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&buff.crackling_thunder.up
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)|(talent.converging_storms.enabled&buff.converging_storms.stack<buff.converging_storms.max_stack)
actions.funnel+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.funnel+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.funnel+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.funnel+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.funnel+=/sundering
actions.funnel+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.funnel+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=3
actions.funnel+=/stormstrike,if=buff.crash_lightning.up&talent.deeply_rooted_elements.enabled
actions.funnel+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.funnel+=/windstrike
actions.funnel+=/stormstrike
actions.funnel+=/ice_strike
actions.funnel+=/lava_lash
actions.funnel+=/crash_lightning
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=2
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5
actions.funnel+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.funnel+=/flame_shock,if=!ticking
actions.funnel+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
actions.single+=/primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
actions.single+=/lava_lash,if=talent.lashing_flames.enabled
actions.single+=/ice_strike,if=!buff.ice_strike.up
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/ice_strike
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=action.sundering.cooldown
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1047
# gear_haste_rating=3032
# gear_mastery_rating=3842
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:
Total Events Processed: 243627522
Max Event Queue: 295
Sim Seconds: 2250297
CPU Seconds: 237.7201
Physical Seconds: 119.2587
Speed Up: 9466

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.93sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 183155 611 7.61 3656 7335 38.0 38.0 31.5% 0.0% 0.0% 0.0% 6.76sec 183155 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost antimagic_shell 48707 51633 172 0.64 16014 0 6.8 3.2 0.0% 0.0% 0.0% 0.0% 42.74sec 51633 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 146.59sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 808426 2695 38.76 3622 7252 193.8 193.8 31.5% 16.3% 0.0% 0.0% 1.80sec 1154923 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 393363 1311 37.88 1811 3625 189.4 189.4 31.4% 16.8% 0.0% 0.0% 1.80sec 561961 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost blood_draw 374606 30475 102 0.40 11527 23117 2.0 2.0 32.0% 0.0% 0.0% 0.0% 0.00sec 30475 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.57sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_damage 155166 3209428 10698 26.85 18212 36350 134.2 134.2 31.4% 0.0% 0.0% 0.0% 2.00sec 3209428 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 220364 735 0.56 60475 120423 3.0 2.8 31.3% 0.0% 0.0% 0.0% 119.64sec 220364 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay ticks -43265 35786 119 0.00 480 961 5.2 0.0 31.2% 0.0% 0.0% 0.0% 48.63sec 35786 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 307473 1025 1.39 33773 67516 6.9 6.9 31.1% 0.0% 0.0% 0.0% 29.31sec 439258 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 83.19sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 382154 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 786990 2623 19.74 6074 12117 60.3 98.7 31.4% 0.0% 0.0% 0.0% 4.95sec 786990 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 222026 766272 2554 8.75 13334 26606 43.8 43.8 31.4% 0.0% 0.0% 0.0% 4.94sec 766272 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 382721 1276 8.75 6670 13290 43.8 43.8 31.3% 0.0% 0.0% 0.0% 4.94sec 382721 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 77.95sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 2078514 6928 12.07 26216 52363 60.3 60.3 31.5% 0.0% 0.0% 0.0% 4.95sec 2078514 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 410197 1367 12.02 5203 10386 60.1 60.1 31.3% 0.0% 0.0% 0.0% 4.97sec 410197 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 414689 1382 9.39 6733 13488 46.9 46.9 31.1% 0.0% 0.0% 0.0% 6.27sec 592429 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 207579 692 9.39 3366 6745 46.9 46.9 31.2% 0.0% 0.0% 0.0% 6.27sec 296549 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1916268 6388 11.50 0 33340 57.5 57.5 100.0% 0.0% 0.0% 0.0% 5.16sec 1916268 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 958134 3194 11.50 0 16670 57.5 57.5 100.0% 0.0% 0.0% 0.0% 5.16sec 958134 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost overwhelming_rage ticks -374037 263273 878 3.93 13388 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.19sec 325218 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 35.93sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 304.76sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.51sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul auto_attack 0 283321 1744 35.69 2227 4464 96.6 96.6 31.5% 0.0% 0.0% 0.0% 2.85sec 404755 162.47sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 137551 847 19.49 1981 3974 52.8 52.8 31.4% 0.0% 0.0% 0.0% 5.31sec 196507 162.47sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 254 2 1.07 67 133 2.9 2.9 31.3% 0.0% 0.0% 0.0% 121.52sec 363 162.47sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 20.38sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1783686 5946 47.88 5671 11336 239.4 239.4 31.4% 0.0% 0.0% 0.0% 1.25sec 1783686 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 62473 208 4.09 2323 4646 20.5 20.5 31.3% 0.0% 0.0% 0.0% 14.24sec 89249 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 62463 208 4.09 2323 4646 20.5 20.5 31.4% 0.0% 0.0% 0.0% 14.26sec 89235 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.5 0.0 0.0% 0.0% 0.0% 0.0% 14.26sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy algethar_puzzle_box_channel 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy antimagic_shell 48707 49183 164 0.62 15824 0 7.0 3.1 0.0% 0.0% 0.0% 0.0% 45.42sec 49183 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 72358 241 1.36 8831 17622 6.8 6.8 20.3% 0.0% 0.0% 0.0% 46.27sec 72358 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 1249166 9450 117.44 4014 8030 258.7 258.7 20.3% 0.0% 0.0% 0.0% 4.33sec 1784568 132.18sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 298567 2259 86.19 1307 2615 189.9 189.9 20.3% 0.0% 0.0% 0.0% 5.97sec 426535 132.18sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_magus frostbolt 317792 194867 1474 9.00 8177 16339 19.8 19.8 20.3% 0.0% 0.0% 0.0% 14.91sec 194867 132.18sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_magus shadow_bolt 317791 620685 4696 28.42 8233 16481 62.6 62.6 20.4% 0.0% 0.0% 0.0% 4.53sec 620685 132.18sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1150542 18732 326.03 2864 5720 333.7 333.7 20.4% 0.0% 0.0% 0.0% 0.74sec 1643673 61.42sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 222202 3618 199.72 903 1801 204.4 204.4 20.4% 0.0% 0.0% 0.0% 1.32sec 317440 61.42sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_magus frostbolt 317792 85287 1421 8.00 8829 17594 8.0 8.0 20.9% 0.0% 0.0% 0.0% 30.89sec 85287 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_magus shadow_bolt 317791 391850 6531 35.80 9091 18156 35.8 35.8 20.5% 0.0% 0.0% 0.0% 6.28sec 391850 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 812515 2708 29.42 4590 9180 147.1 147.1 20.4% 0.0% 0.0% 0.0% 2.46sec 1160765 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.59sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy blood_draw 374606 28508 95 0.40 11785 23540 2.0 2.0 21.0% 0.0% 0.0% 0.0% 179.79sec 28508 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy clawing_shadows 207311 2370216 7901 14.21 27720 55338 71.0 71.0 20.4% 0.0% 0.0% 0.0% 4.10sec 2370216 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 46.16sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation_damage 344955 63470 212 1.39 7574 15144 0.0 6.9 20.8% 0.0% 0.0% 0.0% 0.00sec 63470 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_and_decay ticks -43265 81170 271 0.00 734 1467 8.5 0.0 20.4% 0.0% 0.0% 0.0% 36.66sec 81170 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 2197389 7325 19.27 18951 37873 96.4 96.4 20.4% 0.0% 0.0% 0.0% 3.08sec 2197389 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 647558 2159 27.40 4726 0 0.0 137.0 0.0% 0.0% 0.0% 0.0% 0.00sec 647558 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 279256 931 1.37 33985 67955 6.8 6.8 20.4% 0.0% 0.0% 0.0% 46.65sec 398948 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 168.45sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 469858 1566 4.55 17170 34297 22.7 22.7 20.4% 0.0% 0.0% 0.0% 13.19sec 671243 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 755336 2518 19.66 6384 12764 98.3 98.3 20.4% 0.0% 0.0% 0.0% 3.77sec 755336 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound_application 197147 0 0 0.00 0 0 102.0 0.0 0.0% 0.0% 0.0% 0.0% 5.29sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 382154 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 26194 87 2.32 1868 3731 11.6 11.6 20.7% 0.0% 0.0% 0.0% 27.01sec 26194 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak_aoe 196780 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 27.01sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy overwhelming_rage ticks -374037 262015 873 3.93 13323 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.40sec 322469 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 303.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul auto_attack 0 1644688 5482 37.20 7337 14713 186.0 186.0 20.4% 0.0% 0.0% 0.0% 1.61sec 2349614 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 598279 1994 12.59 7893 15792 62.9 62.9 20.4% 0.0% 0.0% 0.0% 4.66sec 598279 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 129875 433 7.87 2743 5485 39.3 39.3 20.4% 0.0% 0.0% 0.0% 7.75sec 185540 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 422 1 0.75 94 188 3.7 3.7 20.5% 0.0% 0.0% 0.0% 90.13sec 603 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 219861 733 3.08 11861 23736 15.4 15.4 20.4% 0.0% 0.0% 0.0% 6.96sec 219861 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 1019153 3397 3.08 54961 110071 15.4 15.4 20.4% 0.0% 0.0% 0.0% 6.96sec 1019153 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.21sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 904544 18091 32.55 27716 55218 27.1 27.1 20.5% 0.0% 0.0% 0.0% 7.85sec 904544 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 117329 391 0.73 26757 53685 3.6 3.6 20.4% 0.0% 0.0% 0.0% 91.72sec 117329 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 20.7 0.0 0.0% 0.0% 0.0% 0.0% 14.15sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 381225 1271 19.90 3185 6362 11.6 99.5 20.4% 0.0% 0.0% 0.0% 27.01sec 381225 300.00sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 594542 1982 4.19 25039 50181 20.9 20.9 13.3% 0.0% 0.0% 0.0% 14.28sec 1316310 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 721767 2406 12.99 9798 19583 20.9 65.0 13.4% 0.0% 0.0% 0.0% 14.28sec 1316310 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 85.9 0.0 0.0% 0.0% 0.0% 0.0% 3.41sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 803843 2679 7.16 19806 39691 35.8 35.8 13.3% 0.0% 0.0% 0.0% 8.44sec 803843 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 2002322 6674 35.35 9998 20025 176.8 176.8 13.3% 0.0% 0.0% 0.0% 1.68sec 2002322 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 18004 60 6.60 546 0 33.0 33.0 0.0% 0.0% 0.0% 0.0% 6.42sec 18004 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 256114 854 1.24 36286 73094 6.2 6.2 13.7% 0.0% 0.0% 0.0% 10.33sec 256114 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage 32409 129357 431 1.22 21194 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 10.33sec 133444 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowfiend 34433 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 312124 1040 15.94 3916 0 7.0 79.7 0.0% 0.0% 0.0% 0.0% 37.97sec 312124 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 602461 2008 25.56 4160 8333 13.5 127.8 13.3% 0.0% 0.0% 0.0% 21.05sec 602461 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 127.8 0.0 0.0% 0.0% 0.0% 0.0% 2.33sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_shadowfiend melee 0 146892 4197 56.57 3937 7871 33.0 33.0 13.1% 0.0% 0.0% 0.0% 6.42sec 146892 35.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement doom_winds 384352 30134 100 0.75 6666 13365 3.7 3.7 21.0% 0.0% 0.0% 0.0% 90.41sec 43050 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 308.89sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 15.5 0.0 0.0% 0.0% 0.0% 0.0% 20.41sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 98010 327 5.92 2749 5500 29.6 29.6 20.5% 0.0% 0.0% 0.0% 10.01sec 459403 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 361394 1205 36.85 1627 3254 29.6 184.2 20.6% 0.0% 0.0% 0.0% 10.01sec 459403 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 410731 1369 198.57 343 686 992.9 992.9 20.6% 0.0% 0.0% 0.0% 0.68sec 410731 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 368834 1229 5.66 10807 21620 28.3 28.3 20.7% 0.0% 0.0% 0.0% 7.74sec 368834 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 290952 970 2.85 16919 33838 14.3 14.3 20.5% 0.0% 0.0% 0.0% 19.45sec 290952 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 563896 1880 4.31 21703 43408 21.6 21.6 20.5% 0.0% 0.0% 0.0% 13.77sec 563896 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 528355 1761 4.01 21884 43743 20.0 20.0 20.6% 0.0% 0.0% 0.0% 14.72sec 528355 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 4134658 13782 13.63 50287 100589 68.1 68.1 20.7% 0.0% 0.0% 0.0% 4.37sec 4134658 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 1 537242 1791 38.69 2661 5325 193.5 193.5 20.7% 16.3% 0.0% 0.0% 1.81sec 767508 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 2 268988 897 38.71 1332 2666 193.5 193.5 20.6% 16.3% 0.0% 0.0% 1.80sec 384278 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement overwhelming_rage ticks -374037 262555 875 3.95 13283 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 59.39sec 267820 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.12sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 90.8 0.0 0.0% 0.0% 0.0% 0.0% 3.29sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 1579345 5264 24.19 10817 21686 121.0 121.0 20.6% 0.0% 0.0% 0.0% 2.46sec 2256264 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_mh 390287 363354 1211 10.51 6912 0 52.6 52.6 0.0% 0.0% 0.0% 0.0% 5.63sec 363354 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 789569 2632 24.19 5408 10843 121.0 121.0 20.6% 0.0% 0.0% 0.0% 2.46sec 1127985 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_offhand 390287 181713 606 10.51 3456 0 52.6 52.6 0.0% 0.0% 0.0% 0.0% 5.63sec 181713 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 291682 972 1.20 40277 80724 6.0 6.0 20.3% 0.0% 0.0% 0.0% 50.61sec 291682 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement tempest_strikes 428078 1133660 3779 32.51 5782 11568 162.5 162.5 20.6% 0.0% 0.0% 0.0% 1.84sec 1133660 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_totem 8512 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 113.81sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 2068484 6895 75.16 4558 9141 375.8 375.8 20.7% 0.0% 0.0% 0.0% 2.49sec 2955052 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 26513 431 37.95 566 1131 38.9 38.9 20.5% 0.0% 0.0% 0.0% 2.23sec 37877 61.47sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_spirit_wolf melee 0 908112 8683 219.97 1962 3929 383.4 383.4 20.7% 0.0% 0.0% 0.0% 1.56sec 1297336 104.59sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 310.63sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele elemental_blast 117014 3410624 11369 4.95 113455 226964 24.8 24.8 21.4% 0.0% 0.0% 0.0% 12.23sec 3410624 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele feral_spirit 51533 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 22.14sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock 188389 770696 2569 18.08 7003 14023 90.4 90.4 21.7% 0.0% 0.0% 0.0% 3.31sec 1758084 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock ticks -188389 987388 3291 39.20 4140 8290 90.4 196.0 21.7% 0.0% 0.0% 0.0% 3.31sec 1758084 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_attack 10444 290264 968 122.11 391 782 610.6 610.6 21.6% 0.0% 0.0% 0.0% 0.74sec 290264 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele forgestorm_ignited_damage 381700 379381 1265 5.78 10808 21616 28.9 28.9 21.5% 0.0% 0.0% 0.0% 7.55sec 379381 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele frost_shock 196840 1944123 6480 8.57 37282 74662 42.8 42.8 21.7% 0.0% 0.0% 0.0% 6.95sec 1944123 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele ice_strike 342240 719837 2399 4.83 24497 49033 24.1 24.1 21.7% 0.0% 0.0% 0.0% 12.54sec 719837 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lava_lash 60103 3783688 12612 14.74 42182 84284 73.7 73.7 21.8% 0.0% 0.0% 0.0% 4.04sec 3783688 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt 188196 1817580 6059 5.74 52021 104108 28.7 28.7 21.8% 0.0% 0.0% 0.0% 10.37sec 1817580 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele main_hand 1 542886 1810 38.82 2658 5317 194.1 194.1 21.6% 16.4% 0.0% 0.0% 1.80sec 775571 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele offhand 2 277991 927 39.64 1332 2666 198.2 198.2 21.6% 16.4% 0.0% 0.0% 1.76sec 397140 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele overwhelming_rage ticks -374037 259721 866 3.91 13283 0 4.0 19.6 0.0% 0.0% 0.0% 0.0% 59.51sec 264929 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 303.46sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave 375982 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 46.18sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave_damage 375984 330620 1102 1.40 38923 78057 7.0 7.0 21.6% 0.0% 0.0% 0.0% 46.18sec 330620 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt_pw 188196 788696 2629 1.39 93677 188148 6.9 6.9 21.3% 0.0% 0.0% 0.0% 45.77sec 788696 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike 17364 0 0 0.00 0 0 32.3 0.0 0.0% 0.0% 0.0% 0.0% 9.14sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_mh 32175 377947 1260 6.46 9622 19237 32.3 32.3 21.7% 0.0% 0.0% 0.0% 9.14sec 539938 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_offhand 32176 188905 630 6.46 4810 9627 32.3 32.3 21.6% 0.0% 0.0% 0.0% 9.14sec 269871 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_totem 8512 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 116.81sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_attack 25504 270739 902 24.01 1853 3712 120.1 120.1 21.6% 0.0% 0.0% 0.0% 5.13sec 386780 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_greater_earth_elemental melee 0 31791 500 41.65 592 1186 44.2 44.2 21.6% 0.0% 0.0% 0.0% 2.51sec 45418 63.60sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_frost_wolf melee 0 286757 8309 208.82 1962 3929 120.1 120.1 21.6% 0.0% 0.0% 0.0% 2.68sec 409663 34.51sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_lightning_wolf melee 0 288914 7868 197.39 1963 3934 120.8 120.8 21.7% 0.0% 0.0% 0.0% 2.68sec 412745 36.72sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_fiery_wolf melee 0 287261 8316 208.90 1962 3929 120.3 120.3 21.7% 0.0% 0.0% 0.0% 2.67sec 410383 34.54sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
234837.2 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.6 2.2 22.2s 18.7s 5.5s 23.05% 0.00% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 243.0s
  • trigger_min/max:2.2s / 243.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s
  • uptime_min/max:5.51% / 45.99%

Stack Uptimes

  • brittle_1:23.05%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.3s 18.8s 5.5s 23.19% 0.00% 2.2 (2.2) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 219.0s
  • trigger_min/max:3.0s / 216.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s
  • uptime_min/max:3.47% / 46.45%

Stack Uptimes

  • brittle_1:23.19%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 114.9 161.6s 2.6s 293.3s 98.53% 0.00% 105.9 (105.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.4s / 288.6s
  • trigger_min/max:0.0s / 14.2s
  • trigger_pct:100.00%
  • duration_min/max:5.6s / 355.6s
  • uptime_min/max:96.77% / 98.80%

Stack Uptimes

  • death_rot_1:0.28%
  • death_rot_2:0.29%
  • death_rot_3:0.67%
  • death_rot_4:0.50%
  • death_rot_5:1.07%
  • death_rot_6:0.64%
  • death_rot_7:0.54%
  • death_rot_8:0.53%
  • death_rot_9:0.53%
  • death_rot_10:93.48%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% from you for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 6.4 233.0 50.2s 1.3s 46.3s 98.39% 0.00% 176.8 (176.8) 5.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 242.2s
  • trigger_min/max:0.0s / 16.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 301.1s
  • uptime_min/max:93.97% / 100.00%

Stack Uptimes

  • everfrost_1:2.12%
  • everfrost_2:2.11%
  • everfrost_3:2.11%
  • everfrost_4:2.10%
  • everfrost_5:2.09%
  • everfrost_6:2.08%
  • everfrost_7:2.07%
  • everfrost_8:2.06%
  • everfrost_9:2.06%
  • everfrost_10:79.58%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 23.5 33.5 12.8s 5.3s 10.4s 81.20% 0.00% 1.8 (2.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 108.2s
  • trigger_min/max:0.0s / 32.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 101.9s
  • uptime_min/max:64.08% / 91.41%

Stack Uptimes

  • festering_wound_1:23.54%
  • festering_wound_2:26.19%
  • festering_wound_3:17.92%
  • festering_wound_4:7.57%
  • festering_wound_5:3.37%
  • festering_wound_6:2.60%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 72.7 2.7s 4.0s 296.7s 98.89% 99.05% 72.7 (72.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 3.6s
  • trigger_min/max:0.8s / 15.4s
  • trigger_pct:100.00%
  • duration_min/max:236.4s / 358.2s
  • uptime_min/max:98.15% / 99.50%

Stack Uptimes

  • lashing_flames_1:98.89%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.1 59.0 190.0s 5.0s 279.8s 99.11% 0.00% 54.8 (54.8) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 350.2s
  • trigger_min/max:0.9s / 55.2s
  • trigger_pct:100.00%
  • duration_min/max:2.2s / 357.9s
  • uptime_min/max:89.39% / 99.43%

Stack Uptimes

  • razorice_1:1.09%
  • razorice_2:0.86%
  • razorice_3:0.79%
  • razorice_4:0.92%
  • razorice_5:95.47%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Rotten Touch 11.9 7.6 25.1s 15.0s 13.5s 53.59% 0.00% 7.6 (7.6) 11.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rotten_touch
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.9s / 105.6s
  • trigger_min/max:0.8s / 56.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 83.4s
  • uptime_min/max:32.71% / 79.96%

Stack Uptimes

  • rotten_touch_1:53.59%

Spelldata

  • id:390276
  • name:Rotten Touch
  • tooltip:Scourge Strike damage taken from {$@=}auracaster is increased by {$s1=50}%.
  • description:{$@spelldesc390275=Sudden Doom causes your next Death Coil to also increase your {$?s207311=true}[Clawing Shadows][Scourge Strike] damage against the target by {$390276s1=50}% for {$390276d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 235845.91
Minimum 219173.01
Maximum 255181.91
Spread ( max - min ) 36008.90
Range [ ( max - min ) / 2 * 100% ] 7.63%
Standard Deviation 5309.1605
5th Percentile 227345.87
95th Percentile 244685.94
( 95th Percentile - 5th Percentile ) 17340.07
Mean Distribution
Standard Deviation 61.3090
95.00% Confidence Interval ( 235725.75 - 235966.07 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1947
0.1 Scale Factor Error with Delta=300 240623
0.05 Scale Factor Error with Delta=300 962489
0.01 Scale Factor Error with Delta=300 24062203
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3764
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 58598936 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.