SimulationCraft 1025-01

for World of Warcraft 10.2.5.53162 Live (hotfix 2024-02-01/53162, git build 036feb25dd)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 51434 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
51434.3 51434.3 55.7 / 0.108% 9586.3 / 18.6% 4058.5
APS APS Error APS Range APR
173.0 3.9 / 2.277% 448.3 / 259.1% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.6 Runic Power 2.44% 53.7 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 51434
Abomination Limb 0 (615) 0.0% (1.2%) 3.0 120.97s 61565 49684

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.00 1.2393 0.0000 0.00 0.00 0.00% 49684.18 49684.18

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [f]:0.12
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
    cooldowns
    [g]:2.85
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
    Abomination Limb (_damage) 615 1.2% 38.0 6.76s 4814 0 Direct 38.0 3650 7324 4814 31.7% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.02 38.02 0.00 0.00 0.00 0.0000 0.0000 183036.52 183036.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.32% 25.98 10 36 3649.55 2343 7165 3651.60 3035 4543 94808 94808 0.00%
crit 31.68% 12.05 2 23 7324.31 4920 14161 7327.39 5324 9825 88229 88229 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
auto_attack_mh 2670 5.2% 191.5 1.83s 4179 2301 Direct 191.5 3616 7244 4179 31.8% 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 191.53 191.53 0.00 0.00 0.00 1.8160 0.0000 800479.95 1143571.94 30.00% 2301.50 2301.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.88% 99.36 58 141 3616.00 2527 7436 3616.29 3319 3940 359302 513302 30.00%
crit 31.80% 60.90 32 96 7243.79 4813 14872 7242.46 6516 8108 441178 630270 30.00%
miss 16.32% 31.26 11 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1299 2.5% 187.0 1.83s 2081 1146 Direct 187.0 1808 3620 2081 31.8% 16.8%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 187.04 187.04 0.00 0.00 0.00 1.8157 0.0000 389279.60 556127.90 30.00% 1146.22 1146.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.35% 96.04 57 144 1808.13 1203 3718 1808.24 1678 1987 173650 248078 30.00%
crit 31.84% 59.56 34 92 3620.47 2527 7518 3620.15 3276 4077 215629 308050 30.00%
miss 16.81% 31.45 14 53 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 103 0.2% 2.0 180.11s 15240 0 Direct 2.0 11568 23095 15241 31.9% 0.0%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 30488.35 30488.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.14% 1.36 0 3 11567.94 10395 18490 10414.98 0 18490 15770 15770 0.00%
crit 31.86% 0.64 0 2 23094.94 20789 36263 12429.44 0 36263 14719 14719 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Breath of Sindragosa 0 (10599) 0.0% (20.6%) 2.9 120.65s 1075057 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [j]:2.95
  • if_expr:!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
    Breath of Sindragosa (_damage) 10599 20.6% 131.7 2.03s 24059 0 Direct 131.7 18260 36461 24058 31.9% 0.0%

Stats Details: Breath Of Sindragosa Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.65 131.65 0.00 0.00 0.00 0.0000 0.0000 3167395.77 3167395.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.14% 89.71 42 139 18259.62 9604 41487 18294.15 16407 20794 1638042 1638042 0.00%
crit 31.86% 41.94 10 77 36460.67 19207 82032 36525.13 31900 44557 1529354 1529354 0.00%

Action Details: Breath Of Sindragosa Damage

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Burnout Wave 734 1.4% 3.0 119.69s 74525 0 Direct 2.8 60361 120295 79240 31.5% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.96 2.78 0.00 0.00 0.00 0.0000 0.0000 220275.62 220275.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.49% 1.90 0 3 60361.48 22015 69346 57539.45 0 69346 114915 114915 0.00%
crit 31.51% 0.88 0 3 120294.72 44029 138692 77526.02 0 138692 105360 105360 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 15 0.0% 0.7 75.61s 6006 4634 Periodic 8.1 419 840 553 31.8% 0.0% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.74 0.00 0.00 8.06 0.00 1.2973 0.0000 4457.60 4457.60 0.00% 4633.68 4633.68
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.23% 5.50 0 45 419.41 312 709 218.71 0 561 2306 2306 0.00%
crit 31.77% 2.56 0 24 840.13 625 1429 432.25 0 1400 2151 2151 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    breath
    [X]:0.74
  • if_expr:runic_power<36&rune.time_to_2>runic_power%18

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Dragon Games Equipment 1026 2.0% 6.9 29.34s 44365 0 Direct 6.9 33769 67534 44400 31.5% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.94 6.94 0.00 0.00 0.00 0.0000 0.0000 307989.67 439996.45 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.51% 4.75 0 9 33769.46 33171 34829 33741.29 0 34829 160476 229257 29.96%
crit 31.49% 2.18 0 7 67533.82 66341 69658 61449.19 0 69658 147514 210739 27.29%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 2629 5.1% 60.3 4.95s 13080 0 Periodic 98.7 6073 12118 7994 31.8% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.32 0.00 98.69 98.69 59.30 0.0000 2.9998 788964.88 788964.88 0.00% 2664.94 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.22% 67.33 42 96 6073.28 76 14969 6073.06 5546 6710 408917 408917 0.00%
crit 31.78% 31.36 11 54 12118.33 150 30275 12115.18 10053 13942 380048 380048 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.33
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountFrost Death Knight1370065PCT0.280
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Frost Strike 2585 (3878) 5.1% (7.6%) 44.4 4.90s 26346 19663 Direct 44.4 (88.7) 13343 26601 17563 31.8% (31.8%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.36 44.36 0.00 0.00 0.00 1.3399 0.0000 779031.01 779031.01 0.00% 19663.12 19663.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.17% 30.24 12 56 13342.95 8141 25434 13324.47 11662 14932 403472 403472 0.00%
crit 31.83% 14.12 2 30 26601.25 16283 50658 26557.51 21794 32239 375559 375559 0.00%

Action Details: Frost Strike

  • id:222026
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}

Action Priority List

    high_prio_actions
    [m]:2.44
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [o]:30.56
  • if_expr:buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
    single_target
    [r]:4.08
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [v]:7.28
  • if_expr:!variable.pooling_runic_power

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountImproved Frost Strike3168031PCT0.200
    Frost Strike Off-Hand 1293 2.5% 44.4 4.90s 8783 0 Direct 44.4 6672 13300 8783 31.8% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.36 44.36 0.00 0.00 0.00 0.0000 0.0000 389568.16 389568.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.15% 30.23 12 57 6671.73 4071 12665 6662.28 5801 7542 201683 201683 0.00%
crit 31.85% 14.13 2 32 13299.57 8141 25434 13275.67 10981 15678 187885 187885 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Frost Strike3168031PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Howling Blast 7003 (8387) 13.6% (16.3%) 60.3 4.95s 41610 34374 Direct 60.3 (120.6) 26350 52685 34742 31.9% (31.8%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.32 60.32 0.00 0.00 0.00 1.2105 0.0000 2095535.27 2095535.27 0.00% 34373.52 34373.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.13% 41.09 20 60 26349.90 4768 62655 26355.90 23499 29815 1082830 1082830 0.00%
crit 31.87% 19.22 5 35 52684.62 10013 122710 52683.80 44020 66333 1012705 1012705 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [T]:37.81
  • if_expr:variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
    breath
    [Y]:0.27
  • if_expr:runic_power<36&rune.time_to_2>runic_power%18
    breath
    [a]:0.29
  • if_expr:buff.rime.react
    single_target
    [q]:21.94
  • if_expr:buff.rime.react&talent.icebreaker.rank=2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Rime5905223.000Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Percent Cost Rime590521-1.000Spell Data
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
    Avalanche 1384 2.7% 60.3 4.95s 6868 0 Direct 60.3 5214 10411 6868 31.8% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.31 60.31 0.00 0.00 0.00 0.0000 0.0000 414212.92 414212.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.17% 41.12 19 66 5213.70 2842 12279 5214.51 4598 5854 214366 214366 0.00%
crit 31.83% 19.20 5 35 10411.03 5685 24835 10411.34 8243 13094 199847 199847 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Obliterate 1429 (11753) 2.8% (22.9%) 48.1 6.12s 73303 27215 Direct 48.1 (211.3) 6758 13540 8901 31.6% (68.9%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 48.06 48.06 0.00 0.00 0.00 2.6934 0.0000 427758.37 611098.96 30.00% 27215.35 27215.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.40% 32.87 13 55 6757.76 4477 13967 6765.35 5824 7720 222144 317357 30.00%
crit 31.60% 15.19 3 30 13539.86 8954 27934 13538.82 10836 17173 205614 293742 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]

Action Priority List

    breath
    [V]:23.78
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [W]:30.16
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Z]:6.34
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [p]:27.46
  • if_expr:buff.killing_machine.react
    single_target
    [s]:17.90
  • if_expr:!variable.pooling_runes

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
    Obliterate Off-Hand 715 1.4% 48.1 6.12s 4454 0 Direct 48.1 3379 6771 4454 31.7% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 48.06 48.06 0.00 0.00 0.00 0.0000 0.0000 214033.45 305769.86 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.31% 32.83 12 56 3378.72 2238 6983 3382.11 2990 3941 110918 158458 30.00%
crit 31.69% 15.23 3 31 6770.61 4477 13967 6772.69 5392 9337 103116 147312 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
    Obliterate (_km) 6406 12.5% 57.6 5.15s 33355 0 Direct 57.6 0 33355 33355 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.58 57.58 0.00 0.00 0.00 0.0000 0.0000 1920678.13 1920678.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 57.58 32 88 33354.89 18680 81609 33331.03 29900 36804 1920678 1920678 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
    Obliterate Off-Hand (_km) 3203 6.2% 57.6 5.15s 16678 0 Direct 57.6 0 16677 16677 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.58 57.58 0.00 0.00 0.00 0.0000 0.0000 960339.06 960339.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 57.58 32 88 16677.44 9340 40804 16665.51 14950 18402 960339 960339 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Raise Dead 0 (1382) 0.0% (2.7%) 3.0 121.55s 140128 0

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [k]:2.96
    auto_attack 1717  / 928 1.8% 94.8 2.91s 2937 1901 Direct 94.8 2226 4461 2937 31.8% 0.0%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.77 94.77 0.00 0.00 0.00 1.5454 0.0000 278324.93 397617.18 30.00% 1900.50 1900.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.19% 64.62 36 89 2226.03 1426 4450 2228.87 2001 2502 143850 205506 30.00%
crit 31.81% 30.14 9 54 4461.02 2852 8899 4467.08 3836 5283 134475 192111 30.00%

Action Details: Auto Attack

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:2.92
    Claw 838  / 453 0.9% 52.0 5.38s 2608 2608 Direct 52.0 1978 3963 2608 31.7% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.04 52.04 0.00 0.00 0.00 1.0000 0.0000 135714.26 193882.45 30.00% 2608.08 2608.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.27% 35.53 19 50 1978.07 1284 4005 1980.21 1764 2314 70272 100391 30.00%
crit 31.73% 16.51 4 33 3963.44 2567 8009 3967.70 3268 4967 65442 93491 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.04
  • if_expr:energy>70
    Gnaw 2  / 1 0.0% 2.9 121.56s 87 87 Direct 2.9 66 133 87 31.7% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.90 2.90 0.00 0.00 0.00 1.0000 0.0000 253.47 362.11 30.00% 87.37 87.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.26% 1.98 0 3 66.28 45 108 63.64 0 105 131 188 28.75%
crit 31.74% 0.92 0 3 132.66 91 216 88.03 0 214 122 175 19.90%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.90
Remorseless Winter 0 (5931) 0.0% (11.5%) 15.2 20.39s 116695 92458

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.23 0.00 0.00 0.00 0.00 1.2622 0.0000 0.00 0.00 0.00% 92457.76 92457.76

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    high_prio_actions
    [n]:15.23
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5931 11.5% 238.6 1.26s 7447 0 Direct 238.6 5652 11311 7447 31.7% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 238.63 238.63 0.00 0.00 0.00 0.0000 0.0000 1776945.64 1776945.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.29% 162.96 112 219 5651.98 1254 17533 5653.03 4760 6655 921019 921019 0.00%
crit 31.71% 75.67 42 122 11311.28 2508 35066 11311.83 8919 13757 855927 855927 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFrost Death Knight1370066PCT0.040
Spell Periodic AmountFrost Death Knight1370067PCT0.040
Spell Periodic AmountBiting Cold3770562PCT0.350
Spell Direct AmountBiting Cold3770563PCT0.350

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Gathering Storm21180510.100Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Everfrost37697410.060
Brittle37455710.060
Strike Twice 206 0.4% 20.2 14.46s 3060 0 Direct 20.2 2323 4646 3060 31.7% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.19 20.19 0.00 0.00 0.00 0.0000 0.0000 61789.40 88272.83 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.27% 13.79 4 28 2322.79 2296 2411 2322.75 2296 2386 32021 45745 30.00%
crit 31.73% 6.41 0 17 4645.72 4593 4822 4635.95 0 4822 29769 42528 29.94%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 206 0.4% 20.2 14.38s 3063 0 Direct 20.2 2323 4645 3063 31.9% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.21 20.21 0.00 0.00 0.00 0.0000 0.0000 61889.35 88415.61 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.14% 13.77 3 31 2322.79 2296 2411 2322.71 2296 2385 31983 45691 30.00%
crit 31.86% 6.44 0 16 4645.46 4593 4822 4640.19 0 4822 29906 42725 29.97%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Frost 0
Anti-Magic Shell 172 99.2% 6.8 42.80s 7615 0 Direct 3.2 16014 0 16014 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.77 3.22 0.00 0.00 0.00 0.0000 0.0000 51549.37 51549.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.22 0 14 16013.62 16014 16014 13777.82 0 16014 51549 51549 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [l]:6.77
  • if_expr:runic_power.deficit>40&death_knight.first_ams_cast<time

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownAnti-Magic Barrier2057271ADD-20000.000
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Arcane Torrent 1.9 146.97s

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.94 0.00 0.00 0.00 0.00 1.2752 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [b]:0.91
  • if_expr:runic_power<60
    single_target
    [u]:1.03
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 4.0 83.32s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [d]:0.30
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
    cooldowns
    [e]:3.65
  • if_expr:buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929621SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929631SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382156
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 3.8 78.20s

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.83 0.00 0.00 0.00 0.00 1.1856 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [U]:2.94
  • if_expr:rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
    single_target
    [t]:0.88
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Pillar of Frost 8.7 35.73s

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [h]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [i]:8.42
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Elemental Potion of Ultimate Power 1.4 305.34s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [c]:1.45
  • if_expr:(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
Unholy Strength 20.1 14.44s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.15 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 121.0s 121.0s 11.8s 11.80% 0.00% 32.2 (32.2) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 123.9s
  • trigger_min/max:120.0s / 123.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:9.78% / 14.22%

Stack Uptimes

  • abomination_limb_1:11.80%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Anti-Magic Shell 6.8 0.0 42.8s 42.8s 6.9s 15.60% 18.79% 0.0 (0.0) 6.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.40
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 101.7s
  • trigger_min/max:40.0s / 101.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:11.01% / 18.08%

Stack Uptimes

  • antimagic_shell_1:15.60%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 10.5 37.3 29.3s 6.2s 18.9s 66.02% 0.00% 0.0 (0.0) 3.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 84.8s
  • trigger_min/max:0.9s / 48.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.4s
  • uptime_min/max:48.90% / 83.06%

Stack Uptimes

  • bonegrinder_crit_1:17.05%
  • bonegrinder_crit_2:14.81%
  • bonegrinder_crit_3:12.87%
  • bonegrinder_crit_4:11.27%
  • bonegrinder_crit_5:10.02%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 6.0 0.0 48.3s 48.3s 9.8s 19.77% 16.70% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:19.0s / 249.7s
  • trigger_min/max:19.0s / 249.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:5.61% / 32.03%

Stack Uptimes

  • bonegrinder_frost_1:19.77%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 3.0 14.6 120.5s 15.1s 19.4s 19.24% 0.00% 2.0 (2.0) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 126.8s
  • trigger_min/max:0.0s / 116.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:16.19% / 22.67%

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.89%
  • bound_by_fire_and_blaze_2:4.34%
  • bound_by_fire_and_blaze_3:4.22%
  • bound_by_fire_and_blaze_4:3.68%
  • bound_by_fire_and_blaze_5:2.77%
  • bound_by_fire_and_blaze_6:3.33%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.6s 120.6s 44.6s 43.98% 0.00% 131.3 (131.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 126.3s
  • trigger_min/max:120.0s / 126.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 106.0s
  • uptime_min/max:20.94% / 64.38%

Stack Uptimes

  • breath_of_sindragosa_1:43.98%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.2s 58.4s 50.1s 80.20% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 353.0s
  • trigger_min/max:15.0s / 340.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 350.5s
  • uptime_min/max:49.87% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.20%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dragon Games Equipment 2.8 0.0 120.6s 120.6s 0.8s 0.76% 0.00% 6.9 (6.9) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.92
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 126.8s
  • trigger_min/max:120.0s / 126.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.9s
  • uptime_min/max:0.53% / 1.04%

Stack Uptimes

  • dragon_games_equipment_1:0.76%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.4s 305.4s 27.1s 12.86% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.9s
  • trigger_min/max:300.0s / 328.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.73% / 17.92%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.86%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 83.6s 83.2s 19.6s 25.87% 0.00% 11.6 (11.6) 3.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 293.4s
  • trigger_min/max:0.0s / 293.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.7s
  • uptime_min/max:16.96% / 30.19%

Stack Uptimes

  • empower_rune_weapon_1:25.87%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 8.4 0.0 35.7s 35.7s 12.8s 35.80% 0.00% 0.0 (0.0) 8.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.8s / 50.4s
  • trigger_min/max:26.8s / 50.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 26.0s
  • uptime_min/max:26.07% / 45.86%

Stack Uptimes

  • enduring_strength_1:35.80%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 8.6 21.4 36.0s 9.7s 10.0s 28.93% 98.97% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.2s / 87.1s
  • trigger_min/max:0.9s / 81.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:18.62% / 35.82%

Stack Uptimes

  • enduring_strength_builder_1:10.30%
  • enduring_strength_builder_2:8.88%
  • enduring_strength_builder_3:5.59%
  • enduring_strength_builder_4:2.62%
  • enduring_strength_builder_5:1.06%
  • enduring_strength_builder_6:0.36%
  • enduring_strength_builder_7:0.09%
  • enduring_strength_builder_8:0.01%
  • enduring_strength_builder_9:0.00%
  • enduring_strength_builder_10:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storm 12.9 120.2 24.2s 2.2s 15.3s 65.75% 85.70% 67.8 (108.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.3s / 105.1s
  • trigger_min/max:0.9s / 35.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 95.1s
  • uptime_min/max:54.07% / 75.58%

Stack Uptimes

  • gathering_storm_1:2.46%
  • gathering_storm_2:5.52%
  • gathering_storm_3:4.89%
  • gathering_storm_4:3.97%
  • gathering_storm_5:5.20%
  • gathering_storm_6:3.73%
  • gathering_storm_7:3.67%
  • gathering_storm_8:2.83%
  • gathering_storm_9:2.21%
  • gathering_storm_10:31.26%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 1.0 174.7 172.6s 1.7s 291.6s 97.94% 0.00% 172.7 (172.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.9s / 244.3s
  • trigger_min/max:1.0s / 12.9s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 354.5s
  • uptime_min/max:96.58% / 98.57%

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.26%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 45.4 14.5 6.6s 5.0s 2.4s 35.93% 54.50% 1.8 (1.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 65.0s
  • trigger_min/max:0.0s / 43.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.1s
  • uptime_min/max:16.88% / 58.24%

Stack Uptimes

  • killing_machine_1:30.28%
  • killing_machine_2:5.65%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 8.7 0.0 35.7s 35.7s 11.8s 34.31% 36.45% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.8s / 50.4s
  • trigger_min/max:26.8s / 50.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:30.37% / 38.26%

Stack Uptimes

  • pillar_of_frost_1:34.31%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 8.7 57.4 35.8s 4.4s 11.4s 33.21% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:25.5s / 50.4s
  • trigger_min/max:0.9s / 43.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:26.92% / 37.96%

Stack Uptimes

  • pillar_of_frost_bonus_1:1.90%
  • pillar_of_frost_bonus_2:3.32%
  • pillar_of_frost_bonus_3:3.51%
  • pillar_of_frost_bonus_4:2.86%
  • pillar_of_frost_bonus_5:3.46%
  • pillar_of_frost_bonus_6:3.27%
  • pillar_of_frost_bonus_7:2.96%
  • pillar_of_frost_bonus_8:2.73%
  • pillar_of_frost_bonus_9:1.93%
  • pillar_of_frost_bonus_10:1.37%
  • pillar_of_frost_bonus_11:1.16%
  • pillar_of_frost_bonus_12:1.00%
  • pillar_of_frost_bonus_13:0.93%
  • pillar_of_frost_bonus_14:0.82%
  • pillar_of_frost_bonus_15:0.64%
  • pillar_of_frost_bonus_16:0.44%
  • pillar_of_frost_bonus_17:0.29%
  • pillar_of_frost_bonus_18:0.20%
  • pillar_of_frost_bonus_19:0.19%
  • pillar_of_frost_bonus_20:0.13%
  • pillar_of_frost_bonus_21:0.07%
  • pillar_of_frost_bonus_22:0.02%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 13.0 2.3 24.2s 20.4s 17.2s 74.53% 0.00% 218.9 (218.9) 12.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 103.6s
  • trigger_min/max:20.0s / 27.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 97.2s
  • uptime_min/max:64.97% / 83.97%

Stack Uptimes

  • remorseless_winter_1:74.53%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 60.7 11.4 4.9s 4.2s 2.0s 40.78% 99.99% 11.4 (11.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 51.5s
  • trigger_min/max:0.0s / 51.5s
  • trigger_pct:63.17%
  • duration_min/max:0.0s / 33.6s
  • uptime_min/max:26.48% / 59.61%

Stack Uptimes

  • rime_1:40.78%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.5 13.8 22.3s 10.8s 11.6s 52.45% 0.00% 13.8 (13.8) 13.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 151.9s
  • trigger_min/max:0.9s / 135.8s
  • trigger_pct:14.99%
  • duration_min/max:0.0s / 75.9s
  • uptime_min/max:23.81% / 79.79%

Stack Uptimes

  • rune_mastery_1:52.45%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.5 23.3s 14.3s 10.1s 43.22% 41.83% 7.5 (7.5) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 83.4s
  • trigger_min/max:0.0s / 60.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.3s
  • uptime_min/max:22.61% / 68.25%

Stack Uptimes

  • rune_of_hysteria_1:43.22%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Ground 0.7 0.1 126.5s 76.7s 10.2s 2.20% 0.00% 0.1 (0.1) 0.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 247.9s
  • trigger_min/max:1.2s / 247.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 151.1s
  • uptime_min/max:0.00% / 12.89%

Stack Uptimes

  • unholy_ground_1:2.20%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 11.7 36.0s 14.4s 23.5s 65.89% 0.00% 11.7 (11.7) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 204.0s
  • trigger_min/max:0.0s / 65.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 189.0s
  • uptime_min/max:41.78% / 92.32%

Stack Uptimes

  • unholy_strength_1:65.89%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 1.0 174.7 172.6s 1.7s 291.6s 97.94% 0.00% 172.7 (172.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.9s / 244.3s
  • trigger_min/max:1.0s / 12.9s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 354.5s
  • uptime_min/max:96.58% / 98.57%

Stack Uptimes

  • unleashed_frenzy_1:0.34%
  • unleashed_frenzy_2:0.34%
  • unleashed_frenzy_3:97.26%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=10 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (thousandbone_tongueslicer)

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_thousandbone_tongueslicer
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382156
  • name:Well Fed
  • tooltip:Critical strike and mastery increased by {$=}w1.
  • description:Increases Critical Strike and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 26.7 10.0 48.0 10.9s 1.3s 128.4s
Windfury (Off Hand) 22.3 6.0 44.0 13.0s 1.3s 154.1s
Killing Machine spent on Obliterate 57.6 32.0 88.0 5.1s 0.9s 45.9s
Killing Machine: Critical auto attacks 58.0 33.0 88.0 5.5s 1.3s 43.1s
Killing Machine wasted: Critical auto attacks 1.8 0.0 11.0 62.5s 1.3s 334.4s
Rune ready 223.5 162.0 287.0 1.5s 0.0s 13.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.56% 0.00% 8.06% 0.7s 0.0s 7.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Horn of Winter30.2830.000256.309138.20560.040310.800
Death and Decay113.1330.000318.873278.949122.023359.944
Remorseless Winter0.3560.0007.2105.4240.91018.252
Empower Rune Weapon1.3900.000129.0655.4924.134134.242
Abomination Limb1.0000.0003.8602.9801.0336.964
Pillar of Frost1.3840.0009.12612.1146.38122.469
Breath of Sindragosa2.1580.0006.2546.3634.13912.008
Raise Dead1.7350.0004.1675.1382.3778.314
Anti-Magic Shell6.8970.00061.68647.27020.986107.497

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=460816)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0811.409 / 1.1703.81031.151
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
16.81747.37186.554 / 84.489132.638211.982

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Anti-Magic ShellRunic Power3.2215.700.42%4.880.402.47%
Breath of SindragosaRune11.1310.764.81%0.970.373.29%
Empower Rune WeaponRunic Power19.1889.352.36%4.666.536.81%
Empower Rune WeaponRune19.1818.978.48%0.990.211.09%
Frost FeverRunic Power32.74156.734.14%4.796.994.27%
Horn of WinterRunic Power3.8395.712.53%25.000.000.00%
Horn of WinterRune7.667.663.43%1.000.000.00%
Murderous EfficiencyRune28.7928.7912.88%1.000.000.00%
Rage of the Frozen ChampionRunic Power60.31476.3112.60%7.906.181.28%
Rune RegenerationRune84.1384.1337.64%1.000.000.00%
Rune of HysteriaRunic Power156.07322.378.53%2.0723.986.92%
Runic AttenuationRunic Power71.27344.719.12%4.8411.633.26%
Runic EmpowermentRune73.9073.2432.76%0.990.660.89%
Arcane TorrentRunic Power1.9438.711.02%20.000.000.00%
Death and DecayRunic Power0.747.420.20%10.000.000.00%
Howling BlastRunic Power60.320.050.00%0.000.000.00%
ObliterateRunic Power105.642087.5255.20%19.7625.311.20%
Remorseless WinterRunic Power15.23146.903.88%9.655.373.53%
pet - ghoul
Energy RegenEnergy1098.271916.35100.00%1.74165.747.96%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_damage)Runic Power 131.332363.8663.98%18.0017.961339.93
Death and DecayRune 0.740.740.33%1.001.006004.03
Frost StrikeRunic Power 44.361330.6736.02%30.0030.00878.20
Howling BlastRune 60.320.000.00%0.000.00537874889.63
ObliterateRune 105.64211.2892.97%2.004.4016673.48
Remorseless WinterRune 15.2315.236.70%1.001.00116695.73
pet - ghoul
ClawEnergy 52.042081.52100.00%40.0040.0065.20
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 330760.0 754.99 880.84 253295.6 293003.9 31833.9 330760.0
Runic Power 0.0 12.60 12.32 86.4 86.9 0.4 124.0
Rune 6.0 0.75 0.76 0.0 2.3 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 51434.34
Minimum 42967.45
Maximum 61363.93
Spread ( max - min ) 18396.48
Range [ ( max - min ) / 2 * 100% ] 17.88%
Standard Deviation 2460.3033
5th Percentile 47487.55
95th Percentile 55514.14
( 95th Percentile - 5th Percentile ) 8026.59
Mean Distribution
Standard Deviation 28.4110
95.00% Confidence Interval ( 51378.66 - 51490.03 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 88
0.1% Error 8790
0.1 Scale Factor Error with Delta=300 51673
0.05 Scale Factor Error with Delta=300 206691
0.01 Scale Factor Error with Delta=300 5167268
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 51434.34
Minimum 42967.45
Maximum 61363.93
Spread ( max - min ) 18396.48
Range [ ( max - min ) / 2 * 100% ] 17.88%
Standard Deviation 2460.3033
5th Percentile 47487.55
95th Percentile 55514.14
( 95th Percentile - 5th Percentile ) 8026.59
Mean Distribution
Standard Deviation 28.4110
95.00% Confidence Interval ( 51378.66 - 51490.03 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 88
0.1% Error 8790
0.1 Scale Factor Error with Delta=300 51673
0.05 Scale Factor Error with Delta=300 206691
0.01 Scale Factor Error with Delta=300 5167268
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 51434.34
Minimum 42967.45
Maximum 61363.93
Spread ( max - min ) 18396.48
Range [ ( max - min ) / 2 * 100% ] 17.88%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 14994148.70
Minimum 10480975.59
Maximum 19114243.77
Spread ( max - min ) 8633268.18
Range [ ( max - min ) / 2 * 100% ] 28.79%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 880.04
Minimum 0.00
Maximum 2243.07
Spread ( max - min ) 2243.07
Range [ ( max - min ) / 2 * 100% ] 127.44%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 752.90
Minimum 0.00
Maximum 1866.27
Spread ( max - min ) 1866.27
Range [ ( max - min ) / 2 * 100% ] 123.94%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
B 0.00 variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
E 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
F 0.00 variable,name=2h_check,value=main_hand.2h
G 0.00 variable,name=erw_pooling_time,op=setif,value=30,value_else=45,condition=death_knight.ams_absorb_percent>0.59
Protects Breath from starving itself on ERW charges depending on anticipated resource gains. More resources enable more aggressive use.
Default action list Executed every time the actor is available.
# count action,conditions
H 1.00 auto_attack
I 0.00 call_action_list,name=variables
Choose Action list to run
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=high_prio_actions
L 0.00 call_action_list,name=cooldowns
M 0.00 call_action_list,name=racials
N 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
O 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
P 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
Q 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
R 0.00 call_action_list,name=aoe,if=active_enemies>=2
S 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
T 37.81 howling_blast,if=variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
Breath Active Rotation
U 2.94 horn_of_winter,if=rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
V 23.78 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&(buff.killing_machine.react|runic_power>45)
W 30.16 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up
X 0.74 death_and_decay,if=runic_power<36&rune.time_to_2>runic_power%18
0.00 remorseless_winter,if=runic_power<36&rune.time_to_2>runic_power%18
Y 0.27 howling_blast,if=runic_power<36&rune.time_to_2>runic_power%18
Z 6.34 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
a 0.29 howling_blast,if=buff.rime.react
b 0.91 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
c 1.45 potion,if=(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
Cooldowns
d 0.30 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
e 3.65 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
f 0.12 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
g 2.85 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=set_bonus.tier31_2pc&buff.chilling_rage.remains<3
0.00 chill_streak,if=!set_bonus.tier31_2pc&active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
h 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
i 8.42 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
j 2.95 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
k 2.96 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react&rune>2|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>50|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.high_prio_actions
# count action,conditions
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
l 6.77 antimagic_shell,if=runic_power.deficit>40&death_knight.first_ams_cast<time
0.00 antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.ready|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up))
0.00 antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&((!talent.obliteration|talent.obliteration&(!cooldown.pillar_of_frost.ready|buff.pillar_of_frost.up&!buff.killing_machine.react))|(equipped.fyralath_the_dreamrender&!dot.mark_of_fyralath.ticking))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
m 2.44 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
n 15.23 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target
# count action,conditions
o 30.56 frost_strike,if=buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
Single Target Rotation
0.00 howling_blast,if=buff.rime.react&set_bonus.tier30_2pc&buff.killing_machine.stack<2
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
p 27.46 obliterate,if=buff.killing_machine.react
q 21.94 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)&talent.obliteration&talent.breath_of_sindragosa
r 4.08 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
s 17.90 obliterate,if=!variable.pooling_runes
t 0.88 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
u 1.03 arcane_torrent,if=runic_power.deficit>20
v 7.28 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.pillar_of_frost.up&!buff.empower_rune_weapon.up&!death_and_decay.ticking&(active_enemies<2|dot.frost_fever.ticking)
Trinkets
0.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
w 2.96 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&((variable.damage_trinket_priority=1|trinket.2.cooldown.remains)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
x 2.78 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&((variable.damage_trinket_priority=2|trinket.1.cooldown.remains)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGHngkqspjweicTWTTWTWWTWTUWTZZnZTZVxTZTVZTleVVTWTWniTbVWTWWTWTXWaXsqnsqmptosoqolspoipnopoqrprsvpqvpqnosovpqivpqolsosrngkqjwZTVTVTWWeTWWTVnTVxWiVUTWVTWTlWaVXsunvvpqvpvpsqvsqivnsvsqvpqolspoqosnopoqrspoiqpopoqnoposoqsoqporlpgnjwkTVTTVViTWTWTWWeWnUxWTWTWTWTVTWWVlTWnVbsqsvhvsvsq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 4 trinket_1_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 5 trinket_2_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 6 trinket_1_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 7 trinket_2_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat A trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat B damage_trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat E rw_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat F 2h_check PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat G erw_pooling_time PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
0:00.000 default H auto_attack Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
0:00.000 high_prio_actions n remorseless_winter Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune		 bloodlust, corrupting_rage
0:01.036 cooldowns g abomination_limb Fluffy_Pillow 10.0/124: 8% runic_power
5.0/6: 83% rune		 bloodlust, remorseless_winter, corrupting_rage
0:02.073 cooldowns k raise_dead PR_Death_Knight_Frost 10.0/124: 8% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, remorseless_winter, rime, corrupting_rage
0:02.073 single_target q howling_blast Fluffy_Pillow 10.0/124: 8% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, remorseless_winter, rime, corrupting_rage
0:03.108 single_target s obliterate Fluffy_Pillow 18.0/124: 15% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, gathering_storm, remorseless_winter, corrupting_rage
0:04.147 single_target p obliterate Fluffy_Pillow 38.0/124: 31% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, abomination_limb, gathering_storm(3), killing_machine, remorseless_winter, rime, corrupting_rage
0:05.182 cooldowns j breath_of_sindragosa Fluffy_Pillow 58.0/124: 47% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, corrupting_rage
0:05.182 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 58.0/124: 47% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, corrupting_rage
0:05.182 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 58.0/124: 47% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, corrupting_rage
0:05.182 cooldowns i pillar_of_frost PR_Death_Knight_Frost 63.0/124: 51% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, corrupting_rage
0:05.182 cooldowns c potion Fluffy_Pillow 63.0/124: 51% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, corrupting_rage
0:05.182 breath T howling_blast Fluffy_Pillow 63.0/124: 51% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, corrupting_rage, elemental_potion_of_ultimate_power
0:06.082 breath W obliterate Fluffy_Pillow 76.0/124: 61% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit, bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:06.983 breath T howling_blast Fluffy_Pillow 83.0/124: 67% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons, breath_of_sindragosa, gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy, bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:07.883 breath T howling_blast Fluffy_Pillow 73.0/124: 59% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(2), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(2), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:08.784 breath W obliterate Fluffy_Pillow 63.0/124: 51% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:09.685 breath T howling_blast Fluffy_Pillow 65.0/124: 52% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:10.585 breath W obliterate Fluffy_Pillow 60.0/124: 48% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:11.485 breath W obliterate Fluffy_Pillow 67.0/124: 54% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:12.385 breath T howling_blast Fluffy_Pillow 69.0/124: 56% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:13.285 breath W obliterate Fluffy_Pillow 59.0/124: 48% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:14.187 breath T howling_blast Fluffy_Pillow 72.2/124: 58% runic_power
0.0/6: 0% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, rime, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:15.088 breath U horn_of_winter PR_Death_Knight_Frost 88.3/124: 71% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:15.989 breath W obliterate Fluffy_Pillow 106.0/124: 85% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:16.889 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, rime, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:17.790 Waiting     0.464s 104.1/124: 84% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:18.254 breath Z obliterate Fluffy_Pillow 86.1/124: 69% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:19.156 Waiting     0.102s 110.9/124: 89% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:19.258 breath Z obliterate Fluffy_Pillow 92.9/124: 75% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:20.158 high_prio_actions n remorseless_winter Fluffy_Pillow 117.7/124: 95% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:21.057 Waiting     0.215s 106.0/124: 85% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:21.272 breath Z obliterate Fluffy_Pillow 88.0/124: 71% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:22.172 breath T howling_blast Fluffy_Pillow 119.0/124: 96% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:23.072 Waiting     0.193s 111.0/124: 90% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:23.265 breath Z obliterate Fluffy_Pillow 93.0/124: 75% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:24.165 Waiting     0.307s 118.0/124: 95% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:24.472 breath V obliterate Fluffy_Pillow 100.0/124: 81% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.199 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.373 Waiting     0.109s 106.0/124: 85% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, corrupting_rage, elemental_potion_of_ultimate_power
0:25.482 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, corrupting_rage, elemental_potion_of_ultimate_power
0:26.516 breath Z obliterate Fluffy_Pillow 96.0/124: 77% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:27.551 breath T howling_blast Fluffy_Pillow 103.0/124: 83% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:28.586 breath V obliterate Fluffy_Pillow 93.0/124: 75% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:29.621 breath Z obliterate Fluffy_Pillow 95.0/124: 77% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:30.657 breath T howling_blast Fluffy_Pillow 102.0/124: 82% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:31.694 Waiting     0.531s 97.0/124: 78% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:32.225 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 79.0/124: 64% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:32.225 Waiting     1.030s 79.0/124: 64% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:33.255 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 61.0/124: 49% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:33.255 breath V obliterate Fluffy_Pillow 66.0/124: 53% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:34.157 Waiting     1.096s 86.0/124: 69% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:35.253 breath V obliterate Fluffy_Pillow 50.0/124: 40% runic_power
3.0/6: 50% rune		 bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
0:36.153 breath T howling_blast Fluffy_Pillow 75.0/124: 60% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
0:37.053 breath W obliterate Fluffy_Pillow 65.0/124: 52% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
0:37.954 breath T howling_blast Fluffy_Pillow 71.8/124: 58% runic_power
0.0/6: 0% rune		 bloodlust, antimagic_shell, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
0:38.854 Waiting     0.381s 69.9/124: 56% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
0:39.235 breath W obliterate Fluffy_Pillow 51.9/124: 42% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
0:40.135 high_prio_actions n remorseless_winter Fluffy_Pillow 76.7/124: 62% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
0:41.328 cooldowns i pillar_of_frost PR_Death_Knight_Frost 59.3/124: 48% runic_power
0.0/6: 0% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
0:41.328 breath T howling_blast Fluffy_Pillow 59.3/124: 48% runic_power
0.0/6: 0% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
0:42.499 breath b arcane_torrent PR_Death_Knight_Frost 51.2/124: 41% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
0:43.669 breath V obliterate Fluffy_Pillow 64.2/124: 52% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
0:44.839 breath W obliterate Fluffy_Pillow 71.0/124: 57% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
0:46.010 breath T howling_blast Fluffy_Pillow 77.8/124: 63% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:47.180 breath W obliterate Fluffy_Pillow 67.8/124: 55% runic_power
2.0/6: 33% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:48.352 breath W obliterate Fluffy_Pillow 56.8/124: 46% runic_power
3.0/6: 50% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:49.523 breath T howling_blast Fluffy_Pillow 58.8/124: 47% runic_power
1.0/6: 17% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:50.693 Waiting     0.060s 53.8/124: 43% runic_power
1.0/6: 17% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:50.753 breath W obliterate Fluffy_Pillow 53.8/124: 43% runic_power
2.0/6: 33% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:51.924 breath T howling_blast Fluffy_Pillow 55.8/124: 45% runic_power
1.0/6: 17% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
0:53.095 Waiting     0.093s 50.8/124: 41% runic_power
1.0/6: 17% rune		 empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
0:53.188 breath X death_and_decay Fluffy_Pillow 32.8/124: 26% runic_power
1.0/6: 17% rune		 empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
0:54.359 breath W obliterate Fluffy_Pillow 29.8/124: 24% runic_power
2.0/6: 33% rune		 unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:55.638 breath a howling_blast Fluffy_Pillow 36.8/124: 30% runic_power
1.0/6: 17% rune		 unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:56.921 breath X death_and_decay Fluffy_Pillow 26.8/124: 22% runic_power
1.0/6: 17% rune		 unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:58.202 single_target s obliterate Fluffy_Pillow 0.8/124: 1% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:59.482 single_target q howling_blast Fluffy_Pillow 20.8/124: 17% runic_power
2.0/6: 33% rune		 unholy_ground, rune_of_hysteria, icy_talons(3), rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:00.763 high_prio_actions n remorseless_winter Fluffy_Pillow 30.8/124: 25% runic_power
3.0/6: 50% rune		 unholy_ground, rune_of_hysteria, icy_talons(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:02.046 single_target s obliterate Fluffy_Pillow 43.2/124: 35% runic_power
2.0/6: 33% rune		 unholy_ground, rune_of_hysteria, icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:03.329 single_target q howling_blast Fluffy_Pillow 80.4/124: 65% runic_power
0.0/6: 0% rune		 unholy_ground, rune_of_hysteria, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:04.611 high_prio_actions m frost_strike Fluffy_Pillow 96.5/124: 78% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:05.893 single_target p obliterate Fluffy_Pillow 66.5/124: 54% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, unholy_ground, rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:07.173 single_target t horn_of_winter PR_Death_Knight_Frost 91.3/124: 74% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:08.517 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:09.863 single_target s obliterate Fluffy_Pillow 94.0/124: 76% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:11.207 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(7), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:12.553 single_target q howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:13.898 single_target o frost_strike Fluffy_Pillow 103.9/124: 84% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:15.244 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 73.9/124: 60% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:15.244 single_target s obliterate Fluffy_Pillow 73.9/124: 60% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:16.588 single_target p obliterate Fluffy_Pillow 98.7/124: 80% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, icy_talons(3), killing_machine(2), rime, unleashed_frenzy(3), corrupting_rage
1:17.932 single_target o frost_strike Fluffy_Pillow 123.7/124: 100% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), killing_machine, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:19.275 cooldowns i pillar_of_frost PR_Death_Knight_Frost 98.7/124: 80% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), killing_machine(2), rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:19.328 single_target p obliterate Fluffy_Pillow 98.7/124: 80% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), killing_machine(2), pillar_of_frost, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:20.672 high_prio_actions n remorseless_winter Fluffy_Pillow 118.7/124: 96% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:22.108 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:23.454 single_target p obliterate Fluffy_Pillow 94.0/124: 76% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:24.799 single_target o frost_strike Fluffy_Pillow 119.0/124: 96% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:26.145 single_target q howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:27.489 single_target r frost_strike Fluffy_Pillow 102.0/124: 82% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:28.836 single_target p obliterate Fluffy_Pillow 72.0/124: 58% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), gathering_storm(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:30.180 single_target r frost_strike Fluffy_Pillow 102.0/124: 82% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
1:31.525 single_target s obliterate Fluffy_Pillow 72.0/124: 58% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:32.868 single_target v frost_strike Fluffy_Pillow 92.0/124: 74% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:34.211 single_target p obliterate Fluffy_Pillow 67.0/124: 54% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:35.555 single_target q howling_blast Fluffy_Pillow 87.0/124: 70% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:36.900 single_target v frost_strike Fluffy_Pillow 95.0/124: 77% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:38.244 single_target p obliterate Fluffy_Pillow 70.0/124: 56% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:39.588 single_target q howling_blast Fluffy_Pillow 90.0/124: 73% runic_power
1.0/6: 17% rune		 icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:40.932 high_prio_actions n remorseless_winter Fluffy_Pillow 103.0/124: 83% runic_power
1.0/6: 17% rune		 icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:42.277 single_target o frost_strike Fluffy_Pillow 118.0/124: 95% runic_power
1.0/6: 17% rune		 icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
1:43.622 single_target s obliterate Fluffy_Pillow 88.0/124: 71% runic_power
2.0/6: 33% rune		 icy_talons(3), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3)
1:44.966 single_target o frost_strike Fluffy_Pillow 113.0/124: 91% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3)
1:46.309 single_target v frost_strike Fluffy_Pillow 83.0/124: 67% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3)
1:47.654 single_target p obliterate Fluffy_Pillow 58.0/124: 47% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3)
1:49.000 single_target q howling_blast Fluffy_Pillow 78.0/124: 63% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(4), remorseless_winter, rime, unleashed_frenzy(3)
1:50.344 cooldowns i pillar_of_frost PR_Death_Knight_Frost 86.0/124: 69% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, unleashed_frenzy(3)
1:50.344 single_target v frost_strike Fluffy_Pillow 86.0/124: 69% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(5), killing_machine, pillar_of_frost, remorseless_winter, unleashed_frenzy(3)
1:51.689 single_target p obliterate Fluffy_Pillow 61.0/124: 49% runic_power
3.0/6: 50% rune		 rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, unleashed_frenzy(3)
1:53.032 single_target q howling_blast Fluffy_Pillow 85.8/124: 69% runic_power
3.0/6: 50% rune		 rune_of_hysteria, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3)
1:54.375 single_target o frost_strike Fluffy_Pillow 101.9/124: 82% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3)
1:55.720 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 71.9/124: 58% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3)
1:55.720 single_target s obliterate Fluffy_Pillow 71.9/124: 58% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3)
1:57.065 single_target o frost_strike Fluffy_Pillow 102.9/124: 83% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:58.409 single_target s obliterate Fluffy_Pillow 79.1/124: 64% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:59.754 single_target r frost_strike Fluffy_Pillow 103.9/124: 84% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
2:01.097 high_prio_actions n remorseless_winter Fluffy_Pillow 73.9/124: 60% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
2:02.441 cooldowns g abomination_limb Fluffy_Pillow 83.9/124: 68% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:03.786 cooldowns k raise_dead PR_Death_Knight_Frost 83.9/124: 68% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:03.786 single_target q howling_blast Fluffy_Pillow 83.9/124: 68% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:05.130 cooldowns j breath_of_sindragosa Fluffy_Pillow 96.9/124: 78% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, icy_talons(3), gathering_storm, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:05.182 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 96.9/124: 78% runic_power
5.0/6: 83% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:05.182 breath Z obliterate Fluffy_Pillow 96.9/124: 78% runic_power
5.0/6: 83% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
2:06.528 breath T howling_blast Fluffy_Pillow 103.9/124: 84% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
2:07.872 breath V obliterate Fluffy_Pillow 93.9/124: 76% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:09.218 breath T howling_blast Fluffy_Pillow 77.9/124: 63% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(6), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:10.564 breath V obliterate Fluffy_Pillow 67.9/124: 55% runic_power
5.0/6: 83% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(7), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
2:11.909 breath T howling_blast Fluffy_Pillow 69.9/124: 56% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:13.252 breath W obliterate Fluffy_Pillow 46.9/124: 38% runic_power
5.0/6: 83% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:14.598 breath W obliterate Fluffy_Pillow 48.9/124: 39% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:14.598 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 68.9/124: 56% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:15.943 breath T howling_blast Fluffy_Pillow 60.9/124: 49% runic_power
3.0/6: 50% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:17.113 breath W obliterate Fluffy_Pillow 55.9/124: 45% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:18.283 breath W obliterate Fluffy_Pillow 39.9/124: 32% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:19.453 breath T howling_blast Fluffy_Pillow 46.9/124: 38% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:20.623 breath V obliterate Fluffy_Pillow 46.9/124: 38% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, unleashed_frenzy(3), bound_by_fire_and_blaze(6)
2:21.791 high_prio_actions n remorseless_winter Fluffy_Pillow 48.9/124: 39% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(6)
2:22.961 breath T howling_blast Fluffy_Pillow 40.9/124: 33% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(6)
2:24.132 breath V obliterate Fluffy_Pillow 30.9/124: 25% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(6)
2:25.244 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 19.9/124: 16% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3)
2:25.302 breath W obliterate Fluffy_Pillow 19.9/124: 16% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), dragon_games_equipment
2:26.472 cooldowns i pillar_of_frost PR_Death_Knight_Frost 26.9/124: 22% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3)
2:26.472 breath V obliterate Fluffy_Pillow 26.9/124: 22% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3)
2:27.643 breath U horn_of_winter PR_Death_Knight_Frost 28.9/124: 23% runic_power
1.0/6: 17% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(7), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3)
2:28.812 breath T howling_blast Fluffy_Pillow 40.9/124: 33% runic_power
3.0/6: 50% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(7), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3)
2:29.982 breath W obliterate Fluffy_Pillow 35.9/124: 29% runic_power
5.0/6: 83% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3)
2:31.153 breath V obliterate Fluffy_Pillow 44.1/124: 36% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3)
2:32.324 breath T howling_blast Fluffy_Pillow 39.1/124: 32% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3)
2:33.494 breath W obliterate Fluffy_Pillow 31.0/124: 25% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3)
2:34.664 breath T howling_blast Fluffy_Pillow 50.2/124: 41% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3)
2:36.008 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 42.2/124: 34% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
2:36.008 breath W obliterate Fluffy_Pillow 42.2/124: 34% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
2:37.351 breath a howling_blast Fluffy_Pillow 31.0/124: 25% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
2:38.695 breath V obliterate Fluffy_Pillow 22.9/124: 18% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:40.040 breath X death_and_decay Fluffy_Pillow 24.9/124: 20% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:41.384 single_target s obliterate Fluffy_Pillow 16.9/124: 14% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:42.665 single_target u arcane_torrent PR_Death_Knight_Frost 41.9/124: 34% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:43.947 high_prio_actions n remorseless_winter Fluffy_Pillow 61.9/124: 50% runic_power
1.0/6: 17% rune		 unholy_strength, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:45.228 single_target v frost_strike Fluffy_Pillow 71.9/124: 58% runic_power
0.0/6: 0% rune		 unholy_ground, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:46.509 single_target v frost_strike Fluffy_Pillow 46.9/124: 38% runic_power
1.0/6: 17% rune		 unholy_ground, icy_talons(3), killing_machine(2), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:47.790 single_target p obliterate Fluffy_Pillow 21.9/124: 18% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), killing_machine(2), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:49.070 single_target q howling_blast Fluffy_Pillow 41.9/124: 34% runic_power
1.0/6: 17% rune		 unholy_ground, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
2:50.352 single_target v frost_strike Fluffy_Pillow 49.9/124: 40% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
2:51.697 Waiting     0.097s 24.9/124: 20% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
2:51.794 single_target p obliterate Fluffy_Pillow 24.9/124: 20% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
2:53.139 single_target v frost_strike Fluffy_Pillow 44.9/124: 36% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
2:54.485 single_target p obliterate Fluffy_Pillow 14.9/124: 12% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), killing_machine, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
2:55.831 single_target s obliterate Fluffy_Pillow 34.9/124: 28% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
2:57.174 single_target q howling_blast Fluffy_Pillow 59.9/124: 48% runic_power
1.0/6: 17% rune		 icy_talons(3), rime, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
2:58.518 single_target v frost_strike Fluffy_Pillow 67.9/124: 55% runic_power
1.0/6: 17% rune		 icy_talons(3), unleashed_frenzy(3), corrupting_rage
2:59.862 single_target s obliterate Fluffy_Pillow 42.9/124: 35% runic_power
2.0/6: 33% rune		 icy_talons(3), unleashed_frenzy(3), corrupting_rage
3:01.206 single_target q howling_blast Fluffy_Pillow 67.9/124: 55% runic_power
1.0/6: 17% rune		 icy_talons(3), rime, unleashed_frenzy(3), corrupting_rage
3:02.550 cooldowns i pillar_of_frost PR_Death_Knight_Frost 75.9/124: 61% runic_power
1.0/6: 17% rune		 icy_talons(3), unleashed_frenzy(3), corrupting_rage
3:02.550 single_target v frost_strike Fluffy_Pillow 75.9/124: 61% runic_power
1.0/6: 17% rune		 icy_talons(3), pillar_of_frost, unleashed_frenzy(3), corrupting_rage
3:03.894 high_prio_actions n remorseless_winter Fluffy_Pillow 50.9/124: 41% runic_power
2.0/6: 33% rune		 icy_talons(3), pillar_of_frost, unleashed_frenzy(3), corrupting_rage
3:05.291 single_target s obliterate Fluffy_Pillow 65.9/124: 53% runic_power
3.0/6: 50% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, unleashed_frenzy(3), corrupting_rage
3:06.637 single_target v frost_strike Fluffy_Pillow 85.9/124: 69% runic_power
1.0/6: 17% rune		 icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, unleashed_frenzy(3), corrupting_rage
3:07.980 single_target s obliterate Fluffy_Pillow 55.9/124: 45% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, unleashed_frenzy(3), corrupting_rage
3:09.325 single_target q howling_blast Fluffy_Pillow 80.7/124: 65% runic_power
0.0/6: 0% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy(3)
3:10.670 single_target v frost_strike Fluffy_Pillow 90.6/124: 73% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3)
3:12.014 single_target p obliterate Fluffy_Pillow 60.6/124: 49% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3)
3:13.358 single_target q howling_blast Fluffy_Pillow 85.4/124: 69% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(7), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3)
3:14.704 single_target o frost_strike Fluffy_Pillow 106.5/124: 86% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), gathering_storm(8), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
3:16.048 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 76.5/124: 62% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
3:16.048 single_target s obliterate Fluffy_Pillow 76.5/124: 62% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
3:17.392 single_target p obliterate Fluffy_Pillow 101.5/124: 82% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), killing_machine, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
3:18.737 single_target o frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:20.081 single_target q howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:21.426 single_target o frost_strike Fluffy_Pillow 107.0/124: 86% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:22.769 single_target s obliterate Fluffy_Pillow 82.0/124: 66% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:24.113 high_prio_actions n remorseless_winter Fluffy_Pillow 102.0/124: 82% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:25.458 single_target o frost_strike Fluffy_Pillow 112.0/124: 90% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:26.802 single_target p obliterate Fluffy_Pillow 92.0/124: 74% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:28.148 single_target o frost_strike Fluffy_Pillow 112.0/124: 90% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:29.493 single_target q howling_blast Fluffy_Pillow 87.0/124: 70% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:30.836 single_target r frost_strike Fluffy_Pillow 95.0/124: 77% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:32.182 single_target s obliterate Fluffy_Pillow 65.0/124: 52% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:33.525 single_target p obliterate Fluffy_Pillow 89.8/124: 72% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
3:34.870 single_target o frost_strike Fluffy_Pillow 120.8/124: 97% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(7), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:36.214 cooldowns i pillar_of_frost PR_Death_Knight_Frost 90.8/124: 73% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:36.214 single_target q howling_blast Fluffy_Pillow 90.8/124: 73% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:37.558 single_target p obliterate Fluffy_Pillow 100.7/124: 81% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
3:38.902 single_target o frost_strike Fluffy_Pillow 120.7/124: 97% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:40.246 single_target p obliterate Fluffy_Pillow 90.7/124: 73% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:41.591 single_target o frost_strike Fluffy_Pillow 115.7/124: 93% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:42.936 single_target q howling_blast Fluffy_Pillow 85.7/124: 69% runic_power
5.0/6: 83% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:44.280 high_prio_actions n remorseless_winter Fluffy_Pillow 95.6/124: 77% runic_power
5.0/6: 83% rune		 rune_of_hysteria, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:45.624 single_target o frost_strike Fluffy_Pillow 108.0/124: 87% runic_power
4.0/6: 67% rune		 rune_of_hysteria, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:46.968 single_target p obliterate Fluffy_Pillow 78.0/124: 63% runic_power
4.0/6: 67% rune		 rune_of_hysteria, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:48.312 single_target o frost_strike Fluffy_Pillow 115.2/124: 93% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), gathering_storm(2), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:49.655 single_target s obliterate Fluffy_Pillow 85.2/124: 69% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), gathering_storm(2), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:50.999 single_target o frost_strike Fluffy_Pillow 110.2/124: 89% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), gathering_storm(4), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:52.344 single_target q howling_blast Fluffy_Pillow 85.2/124: 69% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), gathering_storm(4), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:53.688 single_target s obliterate Fluffy_Pillow 98.2/124: 79% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), gathering_storm(5), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:55.035 single_target o frost_strike Fluffy_Pillow 118.2/124: 95% runic_power
1.0/6: 17% rune		 icy_talons(3), gathering_storm(7), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:56.379 single_target q howling_blast Fluffy_Pillow 88.2/124: 71% runic_power
3.0/6: 50% rune		 rune_of_hysteria, icy_talons(3), killing_machine, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:57.725 single_target p obliterate Fluffy_Pillow 98.2/124: 79% runic_power
3.0/6: 50% rune		 rune_of_hysteria, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:59.069 single_target o frost_strike Fluffy_Pillow 123.0/124: 99% runic_power
2.0/6: 33% rune		 rune_of_hysteria, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:00.414 single_target r frost_strike Fluffy_Pillow 99.2/124: 80% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:01.759 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 69.2/124: 56% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:01.759 single_target p obliterate Fluffy_Pillow 69.2/124: 56% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:03.105 cooldowns g abomination_limb Fluffy_Pillow 94.0/124: 76% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
4:04.451 high_prio_actions n remorseless_winter Fluffy_Pillow 94.0/124: 76% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(3)
4:05.794 cooldowns j breath_of_sindragosa Fluffy_Pillow 109.0/124: 88% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, abomination_limb, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3)
4:05.794 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 109.0/124: 88% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3)
4:05.794 cooldowns k raise_dead PR_Death_Knight_Frost 109.0/124: 88% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze
4:05.794 breath T howling_blast Fluffy_Pillow 109.0/124: 88% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze
4:07.138 breath V obliterate Fluffy_Pillow 104.0/124: 84% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine(2), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2)
4:08.482 breath T howling_blast Fluffy_Pillow 111.0/124: 89% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2)
4:09.827 breath T howling_blast Fluffy_Pillow 88.0/124: 71% runic_power
5.0/6: 83% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3)
4:11.170 breath V obliterate Fluffy_Pillow 78.0/124: 63% runic_power
5.0/6: 83% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4)
4:12.513 breath V obliterate Fluffy_Pillow 80.0/124: 64% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(7), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4)
4:13.857 cooldowns i pillar_of_frost PR_Death_Knight_Frost 68.8/124: 55% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5)
4:13.857 breath T howling_blast Fluffy_Pillow 68.8/124: 55% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5)
4:15.200 breath W obliterate Fluffy_Pillow 60.7/124: 49% runic_power
5.0/6: 83% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:16.543 breath T howling_blast Fluffy_Pillow 73.7/124: 59% runic_power
4.0/6: 67% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:17.887 breath W obliterate Fluffy_Pillow 53.8/124: 43% runic_power
6.0/6: 100% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:19.232 breath T howling_blast Fluffy_Pillow 60.6/124: 49% runic_power
5.0/6: 83% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:20.575 breath W obliterate Fluffy_Pillow 52.5/124: 42% runic_power
6.0/6: 100% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:21.919 breath W obliterate Fluffy_Pillow 36.5/124: 29% runic_power
4.0/6: 67% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:21.919 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 61.3/124: 49% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(11), bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:23.264 breath W obliterate Fluffy_Pillow 49.5/124: 40% runic_power
3.0/6: 50% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(11), bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:24.433 high_prio_actions n remorseless_winter Fluffy_Pillow 62.5/124: 50% runic_power
1.0/6: 17% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(13), bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:25.622 breath U horn_of_winter PR_Death_Knight_Frost 63.1/124: 51% runic_power
0.0/6: 0% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:25.815 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 76.1/124: 61% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
4:26.793 breath W obliterate Fluffy_Pillow 82.3/124: 66% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:27.964 breath T howling_blast Fluffy_Pillow 77.3/124: 62% runic_power
2.0/6: 33% rune		 rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:29.136 breath W obliterate Fluffy_Pillow 69.2/124: 56% runic_power
5.0/6: 83% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:30.306 breath T howling_blast Fluffy_Pillow 76.2/124: 61% runic_power
3.0/6: 50% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:31.475 breath W obliterate Fluffy_Pillow 66.2/124: 53% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:32.645 breath T howling_blast Fluffy_Pillow 78.2/124: 63% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:33.816 breath W obliterate Fluffy_Pillow 50.2/124: 41% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:34.987 breath T howling_blast Fluffy_Pillow 52.2/124: 42% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:36.157 Waiting     0.225s 42.2/124: 34% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
4:36.382 breath V obliterate Fluffy_Pillow 42.2/124: 34% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
4:37.553 breath T howling_blast Fluffy_Pillow 54.2/124: 44% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
4:38.722 breath W obliterate Fluffy_Pillow 49.2/124: 40% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
4:39.893 breath W obliterate Fluffy_Pillow 33.2/124: 27% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3)
4:41.063 breath V obliterate Fluffy_Pillow 35.2/124: 28% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3)
4:42.234 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 42.2/124: 34% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3)
4:42.234 breath T howling_blast Fluffy_Pillow 42.2/124: 34% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3)
4:43.579 breath W obliterate Fluffy_Pillow 32.2/124: 26% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(3), unleashed_frenzy(3)
4:44.924 high_prio_actions n remorseless_winter Fluffy_Pillow 21.2/124: 17% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(3), unleashed_frenzy(3)
4:46.268 breath V obliterate Fluffy_Pillow 23.2/124: 19% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3)
4:47.614 breath b arcane_torrent PR_Death_Knight_Frost 25.2/124: 20% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3)
4:48.961 single_target s obliterate Fluffy_Pillow 14.2/124: 11% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3)
4:50.307 single_target q howling_blast Fluffy_Pillow 34.2/124: 28% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3)
4:51.652 single_target s obliterate Fluffy_Pillow 42.2/124: 34% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:52.996 single_target v frost_strike Fluffy_Pillow 62.2/124: 50% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:54.340 cooldowns h pillar_of_frost PR_Death_Knight_Frost 42.2/124: 34% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:54.340 single_target v frost_strike Fluffy_Pillow 42.2/124: 34% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), gathering_storm(7), pillar_of_frost, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:55.684 single_target s obliterate Fluffy_Pillow 12.2/124: 10% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm(7), pillar_of_frost, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:57.028 single_target v frost_strike Fluffy_Pillow 37.2/124: 30% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
4:58.373 single_target s obliterate Fluffy_Pillow 7.2/124: 6% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), unleashed_frenzy(3), corrupting_rage
4:59.716 single_target q howling_blast Fluffy_Pillow 27.2/124: 22% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5690 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3848 0 16538 15751 9278
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 330760 315020 0
Runic Power 124 124 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 31.22% 24.64% 2995
Haste 11.86% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 5974 5598 0
Mastery 46.03% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +923 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +111 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +519 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Talents

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowFrost Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=thousandbone_tongueslicer
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
actions.precombat+=/variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h
# Protects Breath from starving itself on ERW charges depending on anticipated resource gains. More resources enable more aggressive use.
actions.precombat+=/variable,name=erw_pooling_time,op=setif,value=30,value_else=45,condition=death_knight.ams_absorb_percent>0.59

# Executed every time the actor is available.
actions=auto_attack
# Choose Action list to run
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/frostscythe,if=!death_and_decay.ticking&equipped.fyralath_the_dreamrender&(cooldown.rage_of_fyralath_417131.remains<3|!dot.mark_of_fyralath.ticking)
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=howling_blast,if=variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&(buff.killing_machine.react|runic_power>45)
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up
actions.breath+=/death_and_decay,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/remorseless_winter,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/howling_blast,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&((cooldown.pillar_of_frost.remains_expected<7&buff.bloodlust.up)|((active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>12)|variable.st_planning)&cooldown.pillar_of_frost.ready))|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=set_bonus.tier31_2pc&buff.chilling_rage.remains<3
actions.cooldowns+=/chill_streak,if=!set_bonus.tier31_2pc&active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react&rune>2|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>50|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
actions.high_prio_actions=invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions.high_prio_actions+=/mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40&death_knight.first_ams_cast<time
actions.high_prio_actions+=/antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.ready|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up))
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions.high_prio_actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&((!talent.obliteration|talent.obliteration&(!cooldown.pillar_of_frost.ready|buff.pillar_of_frost.up&!buff.killing_machine.react))|(equipped.fyralath_the_dreamrender&!dot.mark_of_fyralath.ticking))
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/remorseless_winter,if=variable.rw_buffs|variable.adds_remain

# Obliteration Active Rotation
actions.obliteration=howling_blast,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&buff.rime.react
actions.obliteration+=/frost_strike,if=(active_enemies<=1|!talent.glacial_advance)&buff.killing_machine.react<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/glacial_advance,if=buff.killing_machine.react<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&(variable.frostscythe_priority|active_enemies>3&!death_and_decay.ticking&equipped.fyralath_the_dreamrender&(cooldown.rage_of_fyralath_417131.remains<3|!dot.mark_of_fyralath.ticking))
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&(!dot.frost_fever.ticking|buff.rime.react&set_bonus.tier30_2pc&!variable.rp_buffs)
actions.obliteration+=/glacial_advance,if=!buff.killing_machine.react&(!death_knight.runeforge.razorice&(!talent.avalanche|debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)|((variable.rp_buffs|rune<2)&active_enemies>1))
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(rune<2|variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<30
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<30
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=frost_strike,if=buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
actions.single_target+=/howling_blast,if=buff.rime.react&set_bonus.tier30_2pc&buff.killing_machine.stack<2
actions.single_target+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets
actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.pillar_of_frost.up&!buff.empower_rune_weapon.up&!death_and_decay.ticking&(active_enemies<2|dot.frost_fever.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&buff.pillar_of_frost.remains>10&(!variable.rp_buffs|cooldown.empower_rune_weapon.max_charges<2&buff.empower_rune_weapon.up)|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&((variable.damage_trinket_priority=1|trinket.2.cooldown.remains)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&((variable.damage_trinket_priority=2|trinket.1.cooldown.remains)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions.variables+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions.variables+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions.variables+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
actions.variables+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains>10|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up
actions.variables+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>8|!death_and_decay.ticking&active_enemies>4))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions.variables+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions.variables+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions.variables+=/variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions.variables+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=9278
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 56938 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
56938.2 56938.2 44.7 / 0.079% 7609.8 / 13.4% 4136.1
APS APS Error APS Range APR
163.9 3.8 / 2.342% 429.7 / 262.2% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.7 7.8 Runic Power 1.38% 52.9 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 56938
Apocalypse 242 (8125) 0.4% (14.3%) 6.8 46.27s 356884 291119 Direct 6.8 (537.3) 8833 17657 10630 20.4% (20.3%)

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.82 6.82 0.00 0.00 0.00 1.2260 0.0000 72478.91 72478.91 0.00% 291119.47 291119.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.62% 5.43 1 8 8832.68 6282 13297 8825.48 6910 10759 47949 47949 0.00%
crit 20.38% 1.39 0 7 17656.99 13377 26594 13841.86 0 26343 24530 24530 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for {$?a134735=false}[every {$s3=2} Festering {$=}LWound:Wounds;][each Festering Wound] you burst. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [U]:5.82
  • if_expr:variable.st_planning&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [Y]:1.00
  • if_expr:debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell CooldownArmy of the Damned2768373ADD-45000.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
    main_hand 9462  / 4168 7.3% 258.4 4.33s 4828 3207 Direct 258.4 4012 8017 4828 20.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 258.43 258.43 0.00 0.00 0.00 1.5055 0.0000 1247809.76 1782630.82 30.00% 3207.10 3207.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.61% 205.74 137 285 4011.79 1930 6543 4017.15 3623 4434 825403 1179177 30.00%
crit 20.39% 52.69 24 87 8016.81 3859 13085 8027.37 6873 9410 422407 603454 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 2257  / 994 1.7% 189.6 5.97s 1571 1571 Direct 189.6 1306 2613 1571 20.2%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 189.63 189.63 0.00 0.00 0.00 1.0000 0.0000 297855.13 425518.18 30.00% 1570.75 1570.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.77% 151.26 98 204 1306.30 645 2186 1307.65 1205 1457 197594 282285 30.00%
crit 20.23% 38.37 15 67 2613.27 1331 4372 2615.93 2245 3115 100261 143233 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:47.41
    default
    [ ]:47.41
    default
    [ ]:47.41
    default
    [ ]:47.41
    Frostbolt 1474  / 649 1.1% 19.8 14.91s 9822 6219 Direct 19.8 8170 16352 9826 20.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.83 19.82 0.00 0.00 0.00 1.5793 0.0000 194729.65 194729.65 0.00% 6219.01 6219.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.76% 15.81 7 24 8170.14 4407 13856 8177.35 7063 9439 129144 129144 0.00%
crit 20.24% 4.01 0 11 16351.90 9101 27711 16165.17 0 27711 65585 65585 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:19.93
    Shadow Bolt 4706  / 2073 3.6% 62.6 4.53s 9905 6590 Direct 62.6 8229 16453 9909 20.4%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.63 62.60 0.00 0.00 0.00 1.5030 0.0000 620303.04 620303.04 0.00% 6590.06 6590.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.57% 49.81 31 69 8229.00 4272 13580 8237.92 7449 9145 409901 409901 0.00%
crit 20.43% 12.79 2 28 16452.67 8544 26794 16470.75 12354 22667 210402 210402 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:69.34
Army of the Dead 0 (6293) 0.0% (10.9%) 2.0 0.00s 932139 1414475

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6591 0.4688 0.00 0.00 0.00% 211417.30 1414474.75

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    high_prio_actions
    [h]:1.00
  • if_expr:talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
    main_hand 17431  / 3934 6.8% 341.5 0.74s 3413 2627 Direct 341.5 2835 5665 3413 20.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 341.49 341.49 0.00 0.00 0.00 1.2994 0.0000 1165620.13 1665214.07 30.00% 2626.90 2626.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.57% 271.74 231 313 2835.30 1231 4230 2834.27 2281 3106 770466 1100694 30.00%
crit 20.43% 69.75 36 104 5665.13 2461 8459 5661.60 4215 6432 395154 564520 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 3338  / 753 1.3% 208.0 1.32s 1073 1073 Direct 208.0 891 1778 1073 20.5%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 207.97 207.97 0.00 0.00 0.00 1.0000 0.0000 223203.43 318870.18 30.00% 1073.25 1073.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.47% 165.27 136 189 891.12 411 1413 890.85 728 987 147278 210403 30.00%
crit 20.53% 42.70 20 65 1778.24 822 2827 1777.29 1306 2193 75925 108467 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:27.13
    default
    [ ]:26.05
    default
    [ ]:27.28
    default
    [ ]:27.15
    default
    [ ]:25.78
    default
    [ ]:24.60
    default
    [ ]:25.18
    default
    [ ]:24.80
    Frostbolt 1412  / 286 0.5% 8.0 30.96s 10591 7423 Direct 8.0 8811 17547 10591 20.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.00 1.4270 0.0000 84728.15 84728.15 0.00% 7422.53 7422.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.63% 6.37 1 8 8811.44 4203 14050 8813.92 5552 12145 56133 56133 0.00%
crit 20.37% 1.63 0 7 17547.37 8406 28100 14664.96 0 28100 28595 28595 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:8.00
    Shadow Bolt 6512  / 1319 2.3% 35.8 6.30s 10922 8286 Direct 35.8 9073 18106 10922 20.5%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.78 35.78 0.00 0.00 0.00 1.3181 0.0000 390726.01 390726.01 0.00% 8286.17 8286.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.53% 28.45 18 36 9072.93 3952 13580 9069.31 7089 10209 258159 258159 0.00%
crit 20.47% 7.32 0 17 18106.02 7905 26794 18091.47 0 25695 132567 132567 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:37.78
auto_attack_mh 2710 4.8% 147.1 2.46s 5524 2262 Direct 147.1 4590 9177 5524 20.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 147.10 147.10 0.00 0.00 0.00 2.4417 0.0000 812600.73 1160887.79 30.00% 2262.43 2262.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.63% 117.14 79 156 4589.79 3685 6722 4589.33 4373 4799 537641 768078 30.00%
crit 20.37% 29.96 11 54 9176.94 7371 13443 9175.65 8373 10173 274960 392810 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 96 0.2% 2.0 0.00s 14265 0 Direct 2.0 11782 23501 14264 21.2%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 28529.34 28529.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.82% 1.58 0 2 11782.34 10403 15271 11253.01 0 15271 18573 18573 0.00%
crit 21.18% 0.42 0 2 23501.26 20806 30095 8894.53 0 30095 9956 9956 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Clawing Shadows 7898 13.9% 71.0 4.10s 33331 28007 Direct 71.0 27688 55452 33331 20.3%

Stats Details: Clawing Shadows

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 70.98 70.98 0.00 0.00 0.00 1.1901 0.0000 2365783.52 2365783.52 0.00% 28006.72 28006.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.68% 56.55 37 78 27688.46 12775 53212 27713.83 23491 32805 1565908 1565908 0.00%
crit 20.32% 14.42 3 31 55451.74 27828 106424 55525.29 35606 77408 799876 799876 0.00%

Action Details: Clawing Shadows

  • id:207311
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207311
  • name:Clawing Shadows
  • school:shadow
  • tooltip:
  • description:Deals {$s2=0} Shadow damage and causes 1 Festering Wound to burst.

Action Priority List

    st
    [n]:70.74
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    st
    [q]:0.24
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Rotten Touch39027610.500
Dark Transformation 0 (211) 0.0% (0.4%) 6.9 46.15s 9133 7231

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.94 0.00 0.00 0.00 0.00 1.2631 0.0000 0.00 0.00 0.00% 7230.89 7230.89

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [T]:5.94
  • if_expr:cooldown.apocalypse.remains<5
    garg_setup
    [d]:1.00
  • if_expr:talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownUnholy Command3169411ADD-15000.000
    Dark Transformation (_damage) 211 0.4% 0.0 0.00s 0 0 Direct 6.9 7563 15102 9133 20.8%

Stats Details: Dark Transformation Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 6.94 0.00 0.00 0.00 0.0000 0.0000 63393.18 63393.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.18% 5.50 1 8 7563.29 6146 11427 7557.49 6182 8979 41571 41571 0.00%
crit 20.82% 1.44 0 6 15101.90 12364 22504 11982.02 0 21230 21822 21822 0.00%

Action Details: Dark Transformation Damage

  • id:344955
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344955
  • name:Dark Transformation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc63560=Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Death and Decay 271 0.5% 8.5 36.55s 9597 8067 Periodic 92.0 734 1466 883 20.4% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.46 0.00 0.00 91.98 0.00 1.1896 0.0000 81213.36 81213.36 0.00% 8067.29 8067.29
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.62% 73.23 43 114 733.60 457 1234 734.29 666 805 53725 53725 0.00%
crit 20.38% 18.75 4 37 1466.31 915 2467 1467.26 1186 1846 27488 27488 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    garg_setup
    [Z]:1.00
  • if_expr:!death_and_decay.ticking&debuff.festering_wound.stack>1
    st
    [m]:7.46
  • if_expr:!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Death Coil 7328 (9487) 12.9% (16.7%) 96.3 3.08s 29508 24418 Direct 96.3 (233.3) 18952 37872 22802 20.3% (20.3%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.34 96.30 0.00 0.00 0.00 1.2084 0.0000 2195739.43 2195739.43 0.00% 24418.08 24418.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 76.70 50 104 18951.94 11452 32280 18962.80 17719 20521 1453652 1453652 0.00%
crit 20.35% 19.59 5 38 37872.45 22903 65161 37884.67 31247 45802 742088 742088 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Details: Death Coil Damage

  • id:47632
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47632
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fire a blast of unholy energy, causing Shadow damage to an enemy target or healing a friendly Undead target.

Action Priority List

    high_prio_actions
    [i]:6.94
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
    st
    [l]:81.37
  • if_expr:!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
    st
    [p]:8.03

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Death Coil3775801PCT0.300
Spell TargetsImproved Death Coil3775802ADD1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Percent Cost Sudden Doom813401-1.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
    Coil of Devastation 2160 3.8% 0.0 0.00s 0 0 Periodic 137.0 4724 0 4724 0.0% 91.3%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 136.97 136.97 81.88 0.0000 2.0000 647061.72 647061.72 0.00% 2362.12 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 136.97 105 170 4724.19 1718 21787 4731.13 3930 5672 647062 647062 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 931 1.6% 6.8 46.65s 40924 0 Direct 6.8 33982 67984 40955 20.5%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.83 6.83 0.00 0.00 0.00 0.0000 0.0000 279703.01 399585.92 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.49% 5.43 0 9 33981.51 33373 35042 33986.77 0 35042 184485 263557 29.99%
crit 20.51% 1.40 0 7 67984.07 66746 70083 52028.50 0 70083 95218 136029 22.95%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1561 2.7% 22.7 13.25s 20662 17017 Direct 22.7 17178 34304 20662 20.3%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.66 22.66 0.00 0.00 0.00 1.2142 0.0000 468146.04 668797.11 30.00% 17017.30 17017.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.66% 18.05 8 29 17177.61 12164 31171 17165.12 14557 19202 310024 442902 30.00%
crit 20.34% 4.61 0 12 34304.01 24328 58361 34010.48 0 54917 158122 225895 29.77%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [e]:1.00
  • if_expr:debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
    st
    [o]:21.66
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack<4
  • target_if_expr:debuff.festering_wound.stack

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Festering Strike3168671PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Festering Wound 2519 4.4% 98.3 3.78s 7685 0 Direct 98.3 6382 12766 7685 20.4%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 98.25 98.25 0.00 0.00 0.00 0.0000 0.0000 755074.25 755074.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.59% 78.20 51 111 6382.37 4230 11686 6383.94 5795 6801 499097 499097 0.00%
crit 20.41% 20.05 5 43 12765.96 8544 23371 12768.78 10590 15821 255977 255977 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040
Spell Direct AmountImproved Festering Strike3168671PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Outbreak 87 0.2% 11.6 27.01s 2245 1850 Direct 11.6 1869 3724 2245 20.3%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.2141 0.0000 26100.34 26100.34 0.00% 1849.51 1849.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.69% 9.26 3 14 1868.52 1319 3282 1868.96 1515 2377 17310 17310 0.00%
crit 20.31% 2.36 0 10 3724.03 2639 6563 3441.95 0 6563 8791 8791 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    high_prio_actions
    [j]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Raise Dead 0 (7911) 0.0% (13.9%) 1.0 0.00s 2368645 0

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
    auto_attack 5481  / 5481 9.6% 186.0 1.61s 8821 5485 Direct 186.0 7330 14656 8821 20.3%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 186.03 186.03 0.00 0.00 0.00 1.6082 0.0000 1640937.37 2344256.01 30.00% 5484.98 5484.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 148.18 106 191 7330.40 2483 18961 7339.84 6496 8428 1086186 1551734 30.00%
crit 20.35% 37.85 17 63 14655.78 4965 37922 14678.26 10327 22092 554751 792522 30.00%

Action Details: Auto Attack

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:1.00
    Sweeping Claws 1995  / 1995 3.5% 62.9 4.67s 9500 9457 Direct 62.9 7891 15775 9499 20.4%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.85 62.85 0.00 0.00 0.00 1.0045 0.0000 597085.85 597085.85 0.00% 9457.14 9457.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.60% 50.03 33 68 7890.72 5506 14018 7893.89 7235 8569 394769 394769 0.00%
crit 20.40% 12.82 2 29 15775.38 11012 27658 15777.64 12385 20385 202316 202316 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:62.85
    Claw 433  / 433 0.8% 39.4 7.73s 3303 3288 Direct 39.4 2744 5488 3303 20.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.42 39.42 0.00 0.00 0.00 1.0045 0.0000 130197.89 186001.74 30.00% 3288.16 3288.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.62% 31.39 17 49 2743.78 2234 9879 2742.06 2475 3085 86119 123031 30.00%
crit 20.38% 8.03 0 19 5487.95 4469 15901 5483.67 0 7751 44079 62971 29.99%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:39.42
  • if_expr:energy>70
    Gnaw 1  / 1 0.0% 3.7 90.14s 114 113 Direct 3.7 94 188 114 21.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0045 0.0000 424.18 605.99 30.00% 113.27 113.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.00% 2.95 0 4 94.00 79 122 93.78 0 113 277 396 29.93%
crit 21.00% 0.78 0 4 188.07 158 243 109.59 0 243 147 210 17.49%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:3.73
Soul Reaper 732 (4127) 1.3% (7.3%) 15.4 6.95s 80559 63673 Direct 15.4 (30.8) 11856 23742 14283 20.4% (20.5%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.40 15.40 0.00 0.00 0.00 1.2652 0.0000 219945.71 219945.71 0.00% 63673.02 63673.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.58% 12.25 3 19 11856.35 7133 18449 11867.69 10255 13828 145298 145298 0.00%
crit 20.42% 3.14 0 12 23741.70 14266 36373 22909.87 0 35851 74647 74647 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [X]:15.40
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370075PCT0.150
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
    Soul Reaper (_execute) 3395 6.0% 15.4 6.95s 66283 0 Direct 15.4 54990 109899 66281 20.6%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.40 15.40 0.00 0.00 0.00 0.0000 0.0000 1020595.79 1020595.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.43% 12.23 5 19 54989.93 40962 84650 55067.28 47596 64847 672578 672578 0.00%
crit 20.57% 3.17 0 11 109898.77 85095 166890 106083.79 0 166890 348018 348018 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370075PCT0.150
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Summon Gargoyle 0 (3047) 0.0% (5.3%) 2.0 185.23s 451320 0

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [S]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead
    garg_setup
    [a]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
    Gargoyle Strike 18053  / 3047 5.3% 27.1 7.85s 33283 21211 Direct 27.1 27674 55238 33282 20.3%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.12 27.12 0.00 0.00 0.00 1.5692 0.0000 902640.83 902640.83 0.00% 21210.66 21210.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 21.60 12 28 27673.63 8081 63418 27670.73 21722 33743 597836 597836 0.00%
crit 20.35% 5.52 0 15 55238.12 16577 123277 55081.57 0 106603 304804 304804 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.
Unholy Assault 391 0.7% 3.6 91.69s 32134 28179 Direct 3.6 26735 53408 32134 20.2%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.64 3.64 0.00 0.00 0.00 1.1404 0.0000 117026.65 117026.65 0.00% 28178.82 28178.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.76% 2.90 0 4 26735.12 20458 36607 26660.93 0 36265 77657 77657 0.00%
crit 20.24% 0.74 0 4 53407.83 42325 72529 30012.33 0 72529 39370 39370 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Damage increased by {$s4=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing all damage done by {$s4=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [W]:3.33
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [c]:0.31
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Virulent Plague 1272 2.2% 11.6 27.01s 32813 0 Periodic 99.5 3183 6369 3834 20.4% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.50 99.50 10.62 0.0000 3.0000 381427.11 381427.11 0.00% 1277.86 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.58% 79.18 53 106 3182.88 2167 6070 3183.13 3001 3382 252012 252012 0.00%
crit 20.42% 20.32 6 38 6369.16 4591 12139 6369.83 5501 7625 129415 129415 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.172500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370077PCT0.040
Spell Periodic AmountUnholy Death Knight1370078PCT0.040

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Tick Time Plaguebringer3901781-0.500Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 0
Anti-Magic Shell 164 99.9% 7.0 45.45s 7052 0 Direct 3.1 15824 0 15824 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.96 3.10 0.00 0.00 0.00 0.0000 0.0000 49081.72 49081.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.10 0 13 15823.90 15824 15824 13365.59 0 15824 49082 49082 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [f]:6.96
  • if_expr:runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownAnti-Magic Barrier2057271ADD-20000.000
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Algeth'ar Puzzle (_box_channel) 2.0 0.00s

Stats Details: Algethar Puzzle Box Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 2.00 0.00 0.00 1.5530 1.5530 0.00 0.00 0.00% 0.00 0.00

Action Details: Algethar Puzzle Box Channel

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 185.60s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [k]:2.00
  • if_expr:(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
Empower Rune Weapon 2.4 168.38s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.39 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [V]:2.08
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
    garg_setup
    [b]:0.31
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929621SET1.000
Festering Wound (_application) 102.0 5.28s

Stats Details: Festering Wound Application

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 101.99 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Festering Wound Application

  • id:197147
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:197147
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:Festering Strike applies a pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$195757s1=3} Runic Power. Stacks up to {$194310u=6} times on any target.
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382154
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Outbreak (_aoe) 11.6 27.01s

Stats Details: Outbreak Aoe

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Outbreak Aoe

  • id:196780
  • school:shadow
  • range:200.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196780
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:{$@spelldesc77575=Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}}
Elemental Potion of Ultimate Power 1.5 302.93s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    high_prio_actions
    [g]:1.46
  • if_expr:(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Unholy Strength 20.7 14.05s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 181.8s 181.8s 30.0s 20.27% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1411.05

Trigger Details

  • interval_min/max:181.8s / 183.8s
  • trigger_min/max:181.8s / 183.8s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s
  • uptime_min/max:16.67% / 25.00%

Stack Uptimes

  • algethar_puzzle_1:20.27%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Anti-Magic Shell 7.0 0.0 45.5s 45.5s 6.9s 16.10% 18.52% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.40
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 122.3s
  • trigger_min/max:40.0s / 122.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:11.56% / 17.75%

Stack Uptimes

  • antimagic_shell_1:16.10%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Berserking 2.0 0.0 185.6s 185.6s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.4s / 192.6s
  • trigger_min/max:181.4s / 192.6s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Commander of the Dead 6.9 0.0 46.2s 46.2s 28.6s 66.13% 87.68% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 59.8s
  • trigger_min/max:45.0s / 59.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:61.66% / 69.27%

Stack Uptimes

  • commander_of_the_dead_1:66.13%

Spelldata

  • id:390260
  • name:Commander of the Dead
  • tooltip:Your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead ghouls deal {$390264s1=35}% increased damage.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.3s 58.5s 50.4s 80.29% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 345.0s
  • trigger_min/max:15.0s / 334.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.3s
  • uptime_min/max:48.89% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.29%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Transformation 6.9 0.0 46.2s 46.2s 21.8s 50.56% 54.89% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 59.8s
  • trigger_min/max:45.0s / 59.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.0s
  • uptime_min/max:45.45% / 56.31%

Stack Uptimes

  • dark_transformation_1:50.56%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Dragon Games Equipment 2.7 0.0 120.0s 120.0s 0.7s 0.64% 0.00% 6.8 (6.8) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.57
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.1s
  • trigger_min/max:120.0s / 120.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s
  • uptime_min/max:0.42% / 0.91%

Stack Uptimes

  • dragon_games_equipment_1:0.64%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 303.0s 303.0s 27.4s 13.09% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 326.8s
  • trigger_min/max:300.0s / 326.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.82% / 17.94%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.09%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 168.4s 168.4s 19.3s 15.32% 0.00% 6.9 (6.9) 2.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 195.7s
  • trigger_min/max:120.0s / 195.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:12.46% / 18.18%

Stack Uptimes

  • empower_rune_weapon_1:15.32%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Festermight 13.1 64.7 23.4s 3.8s 19.2s 83.79% 0.00% 0.0 (0.0) 12.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 45.0s
  • trigger_min/max:0.8s / 28.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:72.64% / 91.39%

Stack Uptimes

  • festermight_1:8.02%
  • festermight_2:8.19%
  • festermight_3:8.45%
  • festermight_4:16.04%
  • festermight_5:11.24%
  • festermight_6:9.99%
  • festermight_7:8.04%
  • festermight_8:5.66%
  • festermight_9:3.70%
  • festermight_10:1.90%
  • festermight_11:0.86%
  • festermight_12:0.64%
  • festermight_13:0.57%
  • festermight_14:0.39%
  • festermight_15:0.11%
  • festermight_16:0.01%
  • festermight_17:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 95.3 167.1s 3.1s 293.0s 98.52% 0.00% 93.3 (93.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:46.8s / 330.2s
  • trigger_min/max:0.8s / 14.0s
  • trigger_pct:100.00%
  • duration_min/max:21.2s / 355.6s
  • uptime_min/max:96.66% / 98.80%

Stack Uptimes

  • icy_talons_1:0.33%
  • icy_talons_2:0.34%
  • icy_talons_3:97.85%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 11.9 7.7 25.0s 14.8s 10.6s 41.81% 0.00% 7.7 (7.7) 11.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 169.2s
  • trigger_min/max:0.8s / 167.1s
  • trigger_pct:14.96%
  • duration_min/max:0.0s / 64.4s
  • uptime_min/max:14.95% / 71.32%

Stack Uptimes

  • rune_mastery_1:41.81%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 39.7 6.6 7.5s 6.4s 2.8s 36.94% 0.00% 6.6 (6.6) 39.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 76.8s
  • trigger_min/max:0.8s / 76.8s
  • trigger_pct:48.00%
  • duration_min/max:0.0s / 26.3s
  • uptime_min/max:19.87% / 52.05%

Stack Uptimes

  • runic_corruption_1:36.94%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 19.6 0.6 14.9s 14.4s 1.4s 9.28% 0.00% 0.6 (0.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.6s / 58.8s
  • trigger_min/max:1.6s / 56.4s
  • trigger_pct:14.18%
  • duration_min/max:0.0s / 11.3s
  • uptime_min/max:1.75% / 20.92%

Stack Uptimes

  • sudden_doom_1:9.28%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.6 0.0 91.7s 91.7s 19.5s 23.71% 29.17% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 99.0s
  • trigger_min/max:90.0s / 99.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.93% / 26.81%

Stack Uptimes

  • unholy_assault_1:23.71%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Damage increased by {$s4=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing all damage done by {$s4=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Ground 8.5 0.0 36.5s 36.5s 9.9s 27.88% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 139.5s
  • trigger_min/max:10.0s / 139.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.8s
  • uptime_min/max:18.47% / 37.50%

Stack Uptimes

  • unholy_ground_1:27.88%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 12.2 35.7s 14.1s 23.9s 67.77% 0.00% 12.2 (12.2) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 176.7s
  • trigger_min/max:0.0s / 61.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 166.3s
  • uptime_min/max:43.07% / 91.74%

Stack Uptimes

  • unholy_strength_1:67.77%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 184.2s 184.2s 24.5s 98.06% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 194.5s
  • trigger_min/max:180.5s / 194.5s
  • trigger_pct:100.00%
  • duration_min/max:22.4s / 25.0s
  • uptime_min/max:92.78% / 98.07%

Stack Uptimes

  • dark_empowerment_1:98.06%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (sizzling_seafood_medley)

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sizzling_seafood_medley
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382154
  • name:Well Fed
  • tooltip:Haste and mastery increased by {$=}w1.
  • description:Increases Haste and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 24.6 8.0 45.0 11.9s 1.6s 135.6s
Rune ready 151.0 114.0 188.0 2.1s 0.0s 13.9s
Runic Corruption from Runic Power Spent 46.3 23.0 71.0 6.4s 0.8s 76.8s
Festering Wound from Festering Strike 56.7 38.0 82.0 13.2s 1.1s 93.7s
Festering Wound from Infected Claws 30.7 14.0 51.0 9.7s 1.0s 125.8s
Festering Wound from Unholy Assault 14.6 12.0 16.0 91.7s 90.0s 99.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.02% 0.00% 9.11% 1.5s 0.0s 11.8s
ghoul - Energy Cap 0.34% 0.04% 1.30% 0.1s 0.0s 1.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Raise Dead0.0000.0000.000300.000240.008359.984
Army of the Dead5.7850.000138.07311.5730.000138.073
Summon Gargoyle4.2971.49215.4478.5944.87918.835
Apocalypse2.2420.00015.29215.4528.42630.358
Unholy Assault3.5150.0009.21112.8017.26118.609
Dark Transformation1.4740.00014.77510.2604.46025.323
Empower Rune Weapon31.6530.00075.69775.75667.901100.694
Death and Decay6.6000.00090.18859.9782.370144.896
Soul Reaper13.3300.000231.789207.688162.032257.592
Anti-Magic Shell5.6330.00082.32239.91925.844119.752

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=342405)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1352.047 / 1.3236.34825.004
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
33.39760.68793.446 / 91.715132.413178.921

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
Anti-Magic ShellRunic Power3.1015.370.66%4.950.140.93%
ApocalypseRune13.6412.368.19%0.911.279.33%
Empower Rune WeaponRunic Power11.4756.122.41%4.891.232.15%
Empower Rune WeaponRune11.4710.556.99%0.920.928.02%
Festering WoundRunic Power98.25292.4712.56%2.982.280.77%
Rune RegenerationRune128.05128.0584.82%1.000.000.00%
Runic AttenuationRunic Power71.58350.4415.05%4.907.462.08%
Army of the DeadRunic Power2.0019.740.85%9.870.261.29%
Clawing ShadowsRunic Power70.98709.7930.48%10.000.000.00%
Death and DecayRunic Power8.4684.623.63%10.000.000.00%
Festering StrikeRunic Power22.66453.1519.46%20.000.000.00%
OutbreakRunic Power11.62112.274.82%9.663.973.41%
Soul ReaperRunic Power15.40147.696.34%9.596.304.09%
Summon GargoyleRunic Power2.0087.413.75%43.7012.5912.59%
pet - ghoul
Dark TransformationEnergy6.94313.347.79%45.14380.8154.86%
Energy RegenEnergy1346.983709.7592.21%2.7520.720.56%
pet - army_ghoul
Energy RegenEnergy852.156972.58100.00%8.18390.275.30%
pet - apoc_ghoul
Energy RegenEnergy673.565249.22100.00%7.791551.0422.81%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.30%1.001.00932138.86
Clawing ShadowsRune 70.9870.9846.16%1.001.0033330.72
Death and DecayRune 8.468.465.50%1.001.009596.88
Death CoilRunic Power 96.342303.28100.00%23.9123.911234.24
Festering StrikeRune 22.6645.3129.47%2.002.0010330.98
OutbreakRune 11.6211.627.56%1.001.002245.32
Soul ReaperRune 15.4015.4010.01%1.001.0080559.80
pet - ghoul
ClawEnergy 39.421576.7538.54%40.0040.0082.57
Sweeping ClawsEnergy 62.852514.1861.46%40.0040.00237.49
pet - army_ghoul
ClawEnergy 207.978318.65100.00%40.0040.0026.83
pet - apoc_ghoul
ClawEnergy 189.637585.14100.00%40.0040.0039.27
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 327940.0 755.42 870.70 262868.9 293356.3 -37747.9 327940.0
Runic Power 8.0 7.76 7.68 34.2 23.8 0.0 85.0
Rune 5.0 0.50 0.51 0.0 3.2 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 56938.23
Minimum 51234.04
Maximum 64019.44
Spread ( max - min ) 12785.40
Range [ ( max - min ) / 2 * 100% ] 11.23%
Standard Deviation 1975.3563
5th Percentile 53978.07
95th Percentile 60482.64
( 95th Percentile - 5th Percentile ) 6504.57
Mean Distribution
Standard Deviation 22.8110
95.00% Confidence Interval ( 56893.52 - 56982.94 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4624
0.1 Scale Factor Error with Delta=300 33310
0.05 Scale Factor Error with Delta=300 133240
0.01 Scale Factor Error with Delta=300 3331000
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 56938.23
Minimum 51234.04
Maximum 64019.44
Spread ( max - min ) 12785.40
Range [ ( max - min ) / 2 * 100% ] 11.23%
Standard Deviation 1975.3563
5th Percentile 53978.07
95th Percentile 60482.64
( 95th Percentile - 5th Percentile ) 6504.57
Mean Distribution
Standard Deviation 22.8110
95.00% Confidence Interval ( 56893.52 - 56982.94 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4624
0.1 Scale Factor Error with Delta=300 33310
0.05 Scale Factor Error with Delta=300 133240
0.01 Scale Factor Error with Delta=300 3331000
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 56938.23
Minimum 51234.04
Maximum 64019.44
Spread ( max - min ) 12785.40
Range [ ( max - min ) / 2 * 100% ] 11.23%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 9534819.09
Minimum 7166936.43
Maximum 11993282.50
Spread ( max - min ) 4826346.06
Range [ ( max - min ) / 2 * 100% ] 25.31%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 870.42
Minimum 0.00
Maximum 2284.20
Spread ( max - min ) 2284.20
Range [ ( max - min ) / 2 * 100% ] 131.21%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 753.65
Minimum 0.00
Maximum 1786.55
Spread ( max - min ) 1786.55
Range [ ( max - min ) / 2 * 100% ] 118.53%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2,if=!equipped.fyralath_the_dreamrender|raid_event.adds.exists
6 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
7 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
A 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
B 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
E 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
F 0.00 variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
Default action list Executed every time the actor is available.
# count action,conditions
G 1.00 auto_attack
H 0.00 call_action_list,name=variables
Call Action Lists
I 0.00 call_action_list,name=high_prio_actions
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=racials
L 0.00 run_action_list,name=garg_setup,if=variable.garg_setup_complete=0
M 0.00 call_action_list,name=cooldowns,if=variable.st_planning
N 0.00 call_action_list,name=aoe_cooldowns,if=variable.adds_remain
O 0.00 call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
P 0.00 call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
Q 0.00 call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
R 0.00 call_action_list,name=st,if=active_enemies<=3
actions.cooldowns
# count action,conditions
S 1.00 summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
ST/Cleave Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
T 5.94 dark_transformation,if=cooldown.apocalypse.remains<5
U 5.82 apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
V 2.08 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 abomination_limb,if=rune<3&variable.st_planning
W 3.33 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
X 15.40 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.garg_setup
# count action,conditions
Y 1.00 apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)
Garg Setup
0.00 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
Z 1.00 any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>1
a 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
b 0.31 empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=23
c 0.31 unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=23
d 1.00 dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
e 1.00 festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
0.00 death_coil,if=rune<=1
actions.high_prio_actions
# count action,conditions
0.00 mind_freeze,if=target.debuff.casting.react
Priority Actions
f 6.96 antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
0.00 antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle))
0.00 antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
0.00 invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=22|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.army_ghoul.remains<=18|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+10>cooldown.invoke_external_buff_power_infusion.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
g 1.46 potion,if=(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
h 1.00 army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
i 6.94 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|cooldown.unholy_assault.ready|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains|!talent.summon_gargoyle)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
j 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration+3
k 2.00 berserking,if=(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(18>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=18|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|active_enemies>=2&death_and_decay.ticking)|fight_remains<=18
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration+3
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.st
# count action,conditions
l 81.37 death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
Single Target
0.00 epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
m 7.46 any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)
n 70.74 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
o 21.66 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4
p 8.03 death_coil
q 0.24 wound_spender,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack>=4
actions.trinkets
# count action,conditions
0.00 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&(active_enemies<5|active_enemies>21|fight_remains<4)&(debuff.festering_wound.stack>2|time>15)
Trinkets
r 2.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<16|!talent.summon_gargoyle&pet.army_ghoul.active&pet.army_ghoul.remains<16)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(variable.damage_trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
s 2.74 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(variable.damage_trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGjreZdagiifibcYlnnloklmnlnlnnjnlnolnnllnlonslnnllnnlnnlollfjTolmUlllnnlonlnnnlojlllnnlnonlpfnnlnTppWUjlmlnnlolnolnnllnnponpfjlnnlnTolUlmnolsnljlnnonlnplolnnlnnlnnjrlhTSiifiVWUXmnlkloXlnlnmXljllnXlnlnXlonlXnlnfoXTpjoUXlllmXlnolXlnnlXoljnpXpnfsnlXlnTlWXUmnnijXllnlol

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 4 raise_dead PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 5 army_of_the_dead PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 6 trinket_1_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat 7 trinket_2_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat A trinket_1_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat B trinket_2_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat E trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
Pre precombat F damage_trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
0:00.000 default G auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 corrupting_rage
0:00.000 high_prio_actions j outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 bloodlust, corrupting_rage
0:00.000 trinkets r use_item_algethar_puzzle_box Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, corrupting_rage
0:01.354 garg_setup e festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, algethar_puzzle, corrupting_rage
0:02.372 garg_setup Z death_and_decay Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, algethar_puzzle, corrupting_rage
0:03.386 garg_setup d dark_transformation PR_Death_Knight_Unholy 48.0/100: 48% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, unholy_ground, algethar_puzzle, corrupting_rage
0:03.386 garg_setup a summon_gargoyle PR_Death_Knight_Unholy 48.0/100: 48% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:04.355 high_prio_actions g potion Fluffy_Pillow 98.0/100: 98% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:04.355 high_prio_actions i death_coil Fluffy_Pillow 98.0/100: 98% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:05.326 high_prio_actions i death_coil Fluffy_Pillow 73.0/100: 73% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, unholy_ground, icy_talons, dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.295 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 43.0/100: 43% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, unholy_ground, icy_talons(2), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.295 high_prio_actions i death_coil Fluffy_Pillow 43.0/100: 43% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, icy_talons(2), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.263 garg_setup b empower_rune_weapon PR_Death_Knight_Unholy 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.263 garg_setup c unholy_assault Fluffy_Pillow 23.0/100: 23% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:08.107 garg_setup Y apocalypse Fluffy_Pillow 23.0/100: 23% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:08.951 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.795 st n clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:10.639 st n clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:11.482 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:12.325 st o festering_strike Fluffy_Pillow 21.0/100: 21% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.168 racials k berserking PR_Death_Knight_Unholy 41.0/100: 41% runic_power
3.0/6: 50% rune		 bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.168 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune		 bloodlust, berserking, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.973 st m death_and_decay Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:14.776 st n clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:15.542 st l death_coil Fluffy_Pillow 34.0/100: 34% runic_power
2.0/6: 33% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:16.308 st n clawing_shadows Fluffy_Pillow 4.0/100: 4% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:17.073 st l death_coil Fluffy_Pillow 22.0/100: 22% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:17.839 st n clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:18.606 st n clawing_shadows Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:19.374 high_prio_actions j outbreak Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:20.140 st n clawing_shadows Fluffy_Pillow 68.0/100: 68% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:20.906 st l death_coil Fluffy_Pillow 81.0/100: 81% runic_power
2.0/6: 33% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:21.672 st n clawing_shadows Fluffy_Pillow 51.0/100: 51% runic_power
2.0/6: 33% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:22.438 st o festering_strike Fluffy_Pillow 69.0/100: 69% runic_power
4.0/6: 67% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:23.205 st l death_coil Fluffy_Pillow 89.0/100: 89% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:23.972 st n clawing_shadows Fluffy_Pillow 59.0/100: 59% runic_power
3.0/6: 50% rune		 bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:24.739 st n clawing_shadows Fluffy_Pillow 77.0/100: 77% runic_power
2.0/6: 33% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:25.545 st l death_coil Fluffy_Pillow 90.0/100: 90% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:26.431 st l death_coil Fluffy_Pillow 95.0/100: 95% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:27.317 st n clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(14), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:28.335 st l death_coil Fluffy_Pillow 83.0/100: 83% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:29.353 st o festering_strike Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:30.370 st n clawing_shadows Fluffy_Pillow 78.0/100: 78% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:31.388 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 91.0/100: 91% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, elemental_potion_of_ultimate_power
0:31.388 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, dragon_games_equipment, elemental_potion_of_ultimate_power
0:32.405 st n clawing_shadows Fluffy_Pillow 66.0/100: 66% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight, commander_of_the_dead, elemental_potion_of_ultimate_power
0:33.423 st n clawing_shadows Fluffy_Pillow 79.0/100: 79% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, icy_talons(3), sudden_doom, festermight(2), elemental_potion_of_ultimate_power
0:34.441 st l death_coil Fluffy_Pillow 92.0/100: 92% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(3)
0:35.458 st l death_coil Fluffy_Pillow 92.0/100: 92% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3)
0:36.475 st n clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3)
0:37.492 st n clawing_shadows Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(4)
0:38.510 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(5)
0:39.527 st n clawing_shadows Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, icy_talons(3), festermight(5)
0:40.544 st n clawing_shadows Fluffy_Pillow 76.0/100: 76% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), festermight(6)
0:41.866 st l death_coil Fluffy_Pillow 94.0/100: 94% runic_power
3.0/6: 50% rune		 icy_talons(3), festermight(7)
0:43.188 st o festering_strike Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune		 icy_talons(3), festermight(7)
0:44.511 st l death_coil Fluffy_Pillow 84.0/100: 84% runic_power
1.0/6: 17% rune		 icy_talons(3), sudden_doom, festermight(7)
0:45.833 st l death_coil Fluffy_Pillow 84.0/100: 84% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(7)
0:47.156 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 59.0/100: 59% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(7), corrupting_rage
0:47.156 high_prio_actions j outbreak Fluffy_Pillow 59.0/100: 59% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), festermight(7), corrupting_rage
0:48.478 cooldowns T dark_transformation PR_Death_Knight_Unholy 69.0/100: 69% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), festermight(7), corrupting_rage
0:49.798 st o festering_strike Fluffy_Pillow 74.0/100: 74% runic_power
2.0/6: 33% rune		 antimagic_shell, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
0:51.119 st l death_coil Fluffy_Pillow 94.0/100: 94% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:52.442 st m death_and_decay Fluffy_Pillow 69.0/100: 69% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, corrupting_rage
0:53.764 cooldowns U apocalypse Fluffy_Pillow 79.0/100: 79% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:55.023 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
0:56.281 st l death_coil Fluffy_Pillow 61.0/100: 61% runic_power
5.0/6: 83% rune		 unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead, corrupting_rage
0:57.539 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
5.0/6: 83% rune		 unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
0:58.797 st n clawing_shadows Fluffy_Pillow 1.0/100: 1% runic_power
5.0/6: 83% rune		 unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
1:00.056 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
5.0/6: 83% rune		 unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
1:01.315 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune		 unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:02.572 st o festering_strike Fluffy_Pillow 7.0/100: 7% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
1:03.893 st n clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
1:05.215 st l death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(7), commander_of_the_dead
1:06.538 st n clawing_shadows Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead
1:07.859 st n clawing_shadows Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead
1:09.178 st n clawing_shadows Fluffy_Pillow 76.0/100: 76% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead
1:10.500 st l death_coil Fluffy_Pillow 94.0/100: 94% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(10), commander_of_the_dead
1:11.821 st o festering_strike Fluffy_Pillow 64.0/100: 64% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(10), commander_of_the_dead
1:13.143 high_prio_actions j outbreak Fluffy_Pillow 89.0/100: 89% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(10), commander_of_the_dead
1:14.465 st l death_coil Fluffy_Pillow 99.0/100: 99% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead
1:15.785 st l death_coil Fluffy_Pillow 69.0/100: 69% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead
1:17.108 st l death_coil Fluffy_Pillow 39.0/100: 39% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, commander_of_the_dead
1:18.431 st n clawing_shadows Fluffy_Pillow 9.0/100: 9% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, commander_of_the_dead, corrupting_rage
1:19.752 st n clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight, corrupting_rage
1:21.074 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(2), corrupting_rage
1:22.394 st n clawing_shadows Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
1:23.716 st o festering_strike Fluffy_Pillow 53.0/100: 53% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(3), corrupting_rage
1:25.037 st n clawing_shadows Fluffy_Pillow 73.0/100: 73% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(3), corrupting_rage
1:26.360 st l death_coil Fluffy_Pillow 91.0/100: 91% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(4), corrupting_rage
1:27.681 st p death_coil Fluffy_Pillow 61.0/100: 61% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), festermight(4), corrupting_rage
1:29.003 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 36.0/100: 36% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), runic_corruption, sudden_doom, festermight(4), corrupting_rage
1:29.003 st n clawing_shadows Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, icy_talons(3), runic_corruption, sudden_doom, festermight(4), corrupting_rage
1:30.326 st n clawing_shadows Fluffy_Pillow 49.0/100: 49% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, icy_talons(3), sudden_doom, festermight(5), corrupting_rage
1:31.648 st l death_coil Fluffy_Pillow 62.0/100: 62% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, icy_talons(3), sudden_doom, festermight(6), corrupting_rage
1:32.968 st n clawing_shadows Fluffy_Pillow 62.0/100: 62% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), festermight(6), corrupting_rage
1:34.289 cooldowns T dark_transformation PR_Death_Knight_Unholy 80.0/100: 80% runic_power
0.0/6: 0% rune		 antimagic_shell, icy_talons(3), festermight(7), corrupting_rage
1:35.610 st p death_coil Fluffy_Pillow 80.0/100: 80% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
1:36.930 st p death_coil Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune		 icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
1:38.252 cooldowns W unholy_assault Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
1:39.573 cooldowns U apocalypse Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
1:40.897 high_prio_actions j outbreak Fluffy_Pillow 37.0/100: 37% runic_power
5.0/6: 83% rune		 icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:42.218 st l death_coil Fluffy_Pillow 52.0/100: 52% runic_power
4.0/6: 67% rune		 icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:43.540 st m death_and_decay Fluffy_Pillow 22.0/100: 22% runic_power
4.0/6: 67% rune		 icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead
1:44.862 st l death_coil Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead
1:46.121 st n clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead
1:47.381 st n clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead
1:48.638 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead
1:49.896 st o festering_strike Fluffy_Pillow 13.0/100: 13% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead
1:51.155 st l death_coil Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead
1:52.414 st n clawing_shadows Fluffy_Pillow 3.0/100: 3% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead
1:53.675 st o festering_strike Fluffy_Pillow 16.0/100: 16% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead
1:54.997 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead
1:56.319 st n clawing_shadows Fluffy_Pillow 11.0/100: 11% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), unholy_assault, festermight(7), commander_of_the_dead
1:57.641 st n clawing_shadows Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), unholy_assault, festermight(8), commander_of_the_dead
1:58.965 st l death_coil Fluffy_Pillow 42.0/100: 42% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead, corrupting_rage
2:00.287 st l death_coil Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, sudden_doom, commander_of_the_dead, corrupting_rage
2:01.608 st n clawing_shadows Fluffy_Pillow 12.0/100: 12% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
2:02.929 st n clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
2:04.252 st p death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(2), commander_of_the_dead, corrupting_rage
2:05.574 st o festering_strike Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
2:06.894 st n clawing_shadows Fluffy_Pillow 33.0/100: 33% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
2:08.216 st p death_coil Fluffy_Pillow 51.0/100: 51% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(3), corrupting_rage
2:09.538 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 21.0/100: 21% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
2:09.538 high_prio_actions j outbreak Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
2:10.860 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
2:12.183 st n clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
2:13.505 st n clawing_shadows Fluffy_Pillow 24.0/100: 24% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:14.825 st l death_coil Fluffy_Pillow 37.0/100: 37% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
2:16.144 st n clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), festermight(5), corrupting_rage
2:17.465 Waiting     2.141s 20.0/100: 20% runic_power
0.0/6: 0% rune		 icy_talons(3), festermight(6), corrupting_rage
2:19.606 cooldowns T dark_transformation PR_Death_Knight_Unholy 20.0/100: 20% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(6), corrupting_rage
2:20.926 st o festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:22.248 st l death_coil Fluffy_Pillow 45.0/100: 45% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
2:23.570 Waiting     0.846s 15.0/100: 15% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
2:24.416 cooldowns U apocalypse Fluffy_Pillow 20.0/100: 20% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
2:25.894 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
2:27.215 st m death_and_decay Fluffy_Pillow 2.0/100: 2% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
2:28.536 st n clawing_shadows Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
2:29.794 st o festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:31.053 st l death_coil Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:31.388 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 15.0/100: 15% runic_power
1.0/6: 17% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:32.311 st n clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
1.0/6: 17% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:33.570 st l death_coil Fluffy_Pillow 33.0/100: 33% runic_power
1.0/6: 17% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:34.830 high_prio_actions j outbreak Fluffy_Pillow 8.0/100: 8% runic_power
1.0/6: 17% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, festermight(6), commander_of_the_dead, corrupting_rage
2:36.087 st l death_coil Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, corrupting_rage
2:37.345 st n clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
2:38.666 st n clawing_shadows Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
2:39.988 st o festering_strike Fluffy_Pillow 49.0/100: 49% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(8), commander_of_the_dead, corrupting_rage
2:41.309 st n clawing_shadows Fluffy_Pillow 69.0/100: 69% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(8), commander_of_the_dead, corrupting_rage
2:42.629 st l death_coil Fluffy_Pillow 82.0/100: 82% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead, corrupting_rage
2:43.951 st n clawing_shadows Fluffy_Pillow 52.0/100: 52% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(9), commander_of_the_dead
2:45.273 st p death_coil Fluffy_Pillow 70.0/100: 70% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), commander_of_the_dead
2:46.594 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), commander_of_the_dead
2:47.915 st o festering_strike Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, commander_of_the_dead
2:49.236 st l death_coil Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), commander_of_the_dead
2:50.557 st n clawing_shadows Fluffy_Pillow 0.0/100: 0% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption
2:51.877 st n clawing_shadows Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight
2:53.199 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(2)
2:54.520 st n clawing_shadows Fluffy_Pillow 1.0/100: 1% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(2)
2:55.842 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3)
2:57.163 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(4)
2:58.486 st n clawing_shadows Fluffy_Pillow 2.0/100: 2% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:59.809 st n clawing_shadows Fluffy_Pillow 15.0/100: 15% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
3:01.129 high_prio_actions j outbreak Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
3:01.437 trinkets r use_item_algethar_puzzle_box Fluffy_Pillow 38.0/100: 38% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
3:03.197 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(6), algethar_puzzle, corrupting_rage
3:04.517 high_prio_actions h army_of_the_dead PR_Death_Knight_Unholy 13.0/100: 13% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(6), algethar_puzzle, corrupting_rage
3:05.839 cooldowns T dark_transformation PR_Death_Knight_Unholy 23.0/100: 23% runic_power
1.0/6: 17% rune		 icy_talons(3), sudden_doom, festermight(6), algethar_puzzle, corrupting_rage
3:07.161 cooldowns S summon_gargoyle PR_Death_Knight_Unholy 28.0/100: 28% runic_power
1.0/6: 17% rune		 icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:07.161 high_prio_actions i death_coil Fluffy_Pillow 78.0/100: 78% runic_power
1.0/6: 17% rune		 icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:08.484 high_prio_actions i death_coil Fluffy_Pillow 78.0/100: 78% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:09.805 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 48.0/100: 48% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:09.805 high_prio_actions i death_coil Fluffy_Pillow 48.0/100: 48% runic_power
2.0/6: 33% rune		 antimagic_shell, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:11.126 cooldowns V empower_rune_weapon PR_Death_Knight_Unholy 18.0/100: 18% runic_power
4.0/6: 67% rune		 antimagic_shell, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:11.126 cooldowns W unholy_assault Fluffy_Pillow 23.0/100: 23% runic_power
5.0/6: 83% rune		 antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:12.275 cooldowns U apocalypse Fluffy_Pillow 28.0/100: 28% runic_power
5.0/6: 83% rune		 antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:13.423 cooldowns X soul_reaper Fluffy_Pillow 40.0/100: 40% runic_power
6.0/6: 100% rune		 antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:14.574 st m death_and_decay Fluffy_Pillow 50.0/100: 50% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:15.723 st n clawing_shadows Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:16.819 st l death_coil Fluffy_Pillow 83.0/100: 83% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:17.913 racials k berserking PR_Death_Knight_Unholy 83.0/100: 83% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:17.913 st l death_coil Fluffy_Pillow 83.0/100: 83% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:18.908 st o festering_strike Fluffy_Pillow 58.0/100: 58% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:19.903 cooldowns X soul_reaper Fluffy_Pillow 78.0/100: 78% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:20.899 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:21.895 st n clawing_shadows Fluffy_Pillow 63.0/100: 63% runic_power
4.0/6: 67% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:22.891 st l death_coil Fluffy_Pillow 81.0/100: 81% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:23.887 st n clawing_shadows Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:24.883 st m death_and_decay Fluffy_Pillow 64.0/100: 64% runic_power
2.0/6: 33% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:25.928 cooldowns X soul_reaper Fluffy_Pillow 74.0/100: 74% runic_power
2.0/6: 33% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:26.924 st l death_coil Fluffy_Pillow 94.0/100: 94% runic_power
2.0/6: 33% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:27.918 high_prio_actions j outbreak Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:28.915 st l death_coil Fluffy_Pillow 79.0/100: 79% runic_power
3.0/6: 50% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:29.910 st l death_coil Fluffy_Pillow 49.0/100: 49% runic_power
3.0/6: 50% rune		 berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), runic_corruption, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:30.904 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:31.998 cooldowns X soul_reaper Fluffy_Pillow 37.0/100: 37% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:33.258 st l death_coil Fluffy_Pillow 52.0/100: 52% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), commander_of_the_dead, corrupting_rage
3:34.516 st n clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
5.0/6: 83% rune		 unholy_strength, unholy_ground, icy_talons(3), commander_of_the_dead, corrupting_rage
3:35.777 st l death_coil Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
3:37.099 st n clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, corrupting_rage
3:38.419 cooldowns X soul_reaper Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
3:39.741 st l death_coil Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
3:41.061 st o festering_strike Fluffy_Pillow 3.0/100: 3% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), festermight(2), corrupting_rage
3:42.384 st n clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(2), corrupting_rage
3:43.704 st l death_coil Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(3), corrupting_rage
3:45.025 cooldowns X soul_reaper Fluffy_Pillow 6.0/100: 6% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
3:46.346 st n clawing_shadows Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(3), corrupting_rage
3:47.668 st l death_coil Fluffy_Pillow 34.0/100: 34% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), sudden_doom, festermight(4), corrupting_rage
3:48.988 st n clawing_shadows Fluffy_Pillow 34.0/100: 34% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
3:50.309 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 47.0/100: 47% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(5), corrupting_rage
3:50.309 st o festering_strike Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, icy_talons(3), festermight(5), corrupting_rage
3:51.630 cooldowns X soul_reaper Fluffy_Pillow 67.0/100: 67% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), festermight(5), corrupting_rage
3:52.953 cooldowns T dark_transformation PR_Death_Knight_Unholy 77.0/100: 77% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, icy_talons(3), festermight(5), corrupting_rage
3:54.273 st p death_coil Fluffy_Pillow 77.0/100: 77% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
3:55.594 high_prio_actions j outbreak Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, corrupting_rage
3:56.915 st o festering_strike Fluffy_Pillow 57.0/100: 57% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:58.236 cooldowns U apocalypse Fluffy_Pillow 82.0/100: 82% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:59.561 cooldowns X soul_reaper Fluffy_Pillow 94.0/100: 94% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:00.884 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:02.205 st l death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:03.526 st l death_coil Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:04.846 st m death_and_decay Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead, corrupting_rage
4:06.169 cooldowns X soul_reaper Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:07.426 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:08.685 st n clawing_shadows Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:09.943 st o festering_strike Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:11.200 st l death_coil Fluffy_Pillow 48.0/100: 48% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:12.459 cooldowns X soul_reaper Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:13.717 st l death_coil Fluffy_Pillow 33.0/100: 33% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:14.976 st n clawing_shadows Fluffy_Pillow 3.0/100: 3% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(5), commander_of_the_dead, corrupting_rage
4:16.300 st n clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(6), commander_of_the_dead, corrupting_rage
4:17.621 st l death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(7), commander_of_the_dead, corrupting_rage
4:18.942 cooldowns X soul_reaper Fluffy_Pillow 9.0/100: 9% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, commander_of_the_dead
4:20.263 Waiting     0.416s 19.0/100: 19% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), commander_of_the_dead
4:20.679 st o festering_strike Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), commander_of_the_dead
4:22.001 st l death_coil Fluffy_Pillow 39.0/100: 39% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), sudden_doom, commander_of_the_dead
4:23.324 high_prio_actions j outbreak Fluffy_Pillow 39.0/100: 39% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption
4:24.644 st n clawing_shadows Fluffy_Pillow 54.0/100: 54% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3)
4:25.966 st p death_coil Fluffy_Pillow 67.0/100: 67% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight
4:27.287 cooldowns X soul_reaper Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight
4:28.609 st p death_coil Fluffy_Pillow 47.0/100: 47% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight
4:29.931 st n clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight
4:31.252 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 35.0/100: 35% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2)
4:31.252 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(2)
4:31.388 st n clawing_shadows Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(2), dragon_games_equipment
4:32.710 st l death_coil Fluffy_Pillow 48.0/100: 48% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(3)
4:34.031 cooldowns X soul_reaper Fluffy_Pillow 23.0/100: 23% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
4:35.354 st l death_coil Fluffy_Pillow 33.0/100: 33% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
4:36.674 st n clawing_shadows Fluffy_Pillow 3.0/100: 3% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
4:37.996 Waiting     0.285s 21.0/100: 21% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
4:38.281 cooldowns T dark_transformation PR_Death_Knight_Unholy 21.0/100: 21% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(4), corrupting_rage
4:39.601 st l death_coil Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(4), commander_of_the_dead, corrupting_rage
4:40.923 cooldowns W unholy_assault Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead, corrupting_rage
4:42.445 cooldowns X soul_reaper Fluffy_Pillow 26.0/100: 26% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:43.766 cooldowns U apocalypse Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:45.089 st m death_and_decay Fluffy_Pillow 48.0/100: 48% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:46.411 st n clawing_shadows Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:47.670 st n clawing_shadows Fluffy_Pillow 76.0/100: 76% runic_power
2.0/6: 33% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight, commander_of_the_dead, corrupting_rage
4:48.928 high_prio_actions i death_coil Fluffy_Pillow 89.0/100: 89% runic_power
2.0/6: 33% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
4:50.185 high_prio_actions j outbreak Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
4:51.444 cooldowns X soul_reaper Fluffy_Pillow 74.0/100: 74% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
4:52.705 st l death_coil Fluffy_Pillow 84.0/100: 84% runic_power
2.0/6: 33% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
4:53.962 st l death_coil Fluffy_Pillow 54.0/100: 54% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
4:55.221 st n clawing_shadows Fluffy_Pillow 29.0/100: 29% runic_power
4.0/6: 67% rune		 icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
4:56.542 st l death_coil Fluffy_Pillow 42.0/100: 42% runic_power
4.0/6: 67% rune		 icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(3), commander_of_the_dead, corrupting_rage
4:57.863 st o festering_strike Fluffy_Pillow 17.0/100: 17% runic_power
5.0/6: 83% rune		 icy_talons(3), dark_transformation, unholy_assault, festermight(3), commander_of_the_dead, corrupting_rage
4:59.185 st l death_coil Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune		 icy_talons(3), unholy_assault, festermight(3), commander_of_the_dead, corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6014 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3848 0 16397 15616 9166
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 327940 312320 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 21.57% 15.36% 1504
Haste 13.88% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6315 5922 0
Mastery 44.93% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +923 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +923 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Talents

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowUnholy Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=sizzling_seafood_medley
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2,if=!equipped.fyralath_the_dreamrender|raid_event.adds.exists
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
actions.precombat+=/variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl

# Executed every time the actor is available.
actions=auto_attack
# Call Action Lists
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup_complete=0
actions+=/call_action_list,name=cooldowns,if=variable.st_planning
actions+=/call_action_list,name=aoe_cooldowns,if=variable.adds_remain
actions+=/call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
actions+=/call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
actions+=/call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
actions+=/call_action_list,name=st,if=active_enemies<=3

# Generic AoE
actions.aoe=epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# AoE Burst
actions.aoe_burst=epidemic,if=(rune<1|talent.bursting_sores&death_knight.fwounded_targets=0|!talent.bursting_sores)&!variable.pooling_runic_power&(active_enemies>=6|runic_power.deficit<30|buff.festermight.stack=20)
actions.aoe_burst+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=1
actions.aoe_burst+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_burst+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe_burst+=/wound_spender

# AoE Cooldowns
actions.aoe_cooldowns=vile_contagion,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.aoe_cooldowns+=/summon_gargoyle
actions.aoe_cooldowns+=/abomination_limb,if=rune<2|buff.festermight.stack>10|!talent.festermight|buff.festermight.up&buff.festermight.remains<12
actions.aoe_cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=talent.bursting_sores&debuff.festering_wound.up&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
actions.aoe_cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=!talent.bursting_sores&debuff.festering_wound.stack>=4|set_bonus.tier31_2pc&debuff.festering_wound.stack>=1
actions.aoe_cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.stack<=2|buff.dark_transformation.up
actions.aoe_cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.aoe_cooldowns+=/dark_transformation,if=(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.aoe_cooldowns+=/empower_rune_weapon,if=buff.dark_transformation.up
actions.aoe_cooldowns+=/sacrificial_pact,if=!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# AoE Setup
actions.aoe_setup=any_dnd,if=(!talent.bursting_sores|death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets>=8|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5)
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies&talent.bursting_sores
actions.aoe_setup+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies
actions.aoe_setup+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=cooldown.apocalypse.remains<variable.apoc_timing&debuff.festering_wound.stack<4
actions.aoe_setup+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# ST/Cleave Cooldowns
actions.cooldowns=summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=cooldown.apocalypse.remains<5
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)

# Garg Setup
actions.garg_setup=apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.garg_setup+=/any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>1
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
actions.garg_setup+=/empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=23
actions.garg_setup+=/unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=23
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
actions.garg_setup+=/festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
actions.garg_setup+=/death_coil,if=rune<=1

# Priority Actions
actions.high_prio_actions=mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
actions.high_prio_actions+=/antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle))
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
actions.high_prio_actions+=/invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=22|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.army_ghoul.remains<=18|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+10>cooldown.invoke_external_buff_power_infusion.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))
actions.high_prio_actions+=/potion,if=(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
actions.high_prio_actions+=/army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
actions.high_prio_actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|cooldown.unholy_assault.ready|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
actions.high_prio_actions+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains|!talent.summon_gargoyle)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
actions.high_prio_actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration+3
actions.racials+=/berserking,if=(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(18>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=18|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|active_enemies>=2&death_and_decay.ticking)|fight_remains<=18
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration+3
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Single Target
actions.st=death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
actions.st+=/epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
actions.st+=/any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)
actions.st+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.st+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4
actions.st+=/death_coil
actions.st+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack>=4

# Trinkets
actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&(active_enemies<5|active_enemies>21|fight_remains<4)&(debuff.festering_wound.stack>2|time>15)
actions.trinkets+=/use_item,use_off_gcd=1,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<16|!talent.summon_gargoyle&pet.army_ghoul.active&pet.army_ghoul.remains<16)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(variable.damage_trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(variable.damage_trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
actions.variables+=/variable,name=garg_setup_complete,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&(cooldown.apocalypse.remains>1|!talent.apocalypse)|!talent.summon_gargoyle|time>20
actions.variables+=/variable,name=apoc_timing,op=setif,value=7,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
actions.variables+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
actions.variables+=/variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4|set_bonus.tier31_4pc&(pet.apoc_magus.active|pet.army_magus.active)&debuff.festering_wound.stack>=1)|fight_remains<5&debuff.festering_wound.stack>=1
actions.variables+=/variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions.variables+=/variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies=1&(!raid_event.adds.exists|raid_event.adds.in>15)
actions.variables+=/variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
actions.variables+=/variable,name=spend_rp,op=setif,value=1,value_else=0,condition=(!talent.rotten_touch|talent.rotten_touch&!debuff.rotten_touch.up|runic_power.deficit<20)&(!set_bonus.tier31_4pc|set_bonus.tier31_4pc&!(pet.apoc_magus.active|pet.army_magus.active)|runic_power.deficit<20|rune<3)&((talent.improved_death_coil&(active_enemies=2|talent.coil_of_devastation)|rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3|!variable.pop_wounds&debuff.festering_wound.stack>=4))

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=9166
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 18215 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
18215.5 18215.5 10.9 / 0.060% 1881.2 / 10.3% 176.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
100.3 99.8 Mana 0.00% 51.8 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 18215
Devouring Plague 4392 24.1% 20.9 14.29s 62831 53933 Direct 20.9 25038 50181 28414 13.4%
Periodic 64.9 9796 19600 11098 13.3% 41.3%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.94 20.94 64.94 64.94 0.00 1.1650 1.9094 1315588.69 1315588.69 0.00% 8866.23 53933.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.58% 18.13 8 25 25038.34 23608 34132 25042.49 24101 26516 453892 453892 0.00%
crit 13.42% 2.81 0 13 50181.09 47215 68264 47520.26 0 68264 141045 141045 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.72% 56.31 38 73 9796.45 2435 16211 9798.56 9181 10597 551677 551677 0.00%
crit 13.28% 8.62 0 20 19600.44 4870 32421 19601.88 0 27587 168974 168974 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.912450
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.06

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.908300
  • base_td:0.00
  • base_td_mult:1.06
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 191.2%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [K]:20.94
  • if_expr:remains<=gcd.max|insanity.deficit<=16
  • target_if_expr:!talent.distorted_reality|active_enemies=1|remains<=gcd.max

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Percent Cost Mind Devourer3732041-1.000Spell Data
Mind Blast 2682 14.7% 35.8 8.45s 22464 19174 Direct 35.8 19831 39740 22464 13.2%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.78 35.78 0.00 0.00 0.00 1.1716 0.0000 803794.69 803794.69 0.00% 19173.58 19173.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.77% 31.05 20 42 19830.73 18267 28539 19835.96 19183 20833 615732 615732 0.00%
crit 13.23% 4.73 0 15 39739.88 36535 57078 39442.41 0 52724 188063 188063 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:625.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.16

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage{$?s424509=false}[ and increases your spell damage to the target by {$424509s1=10}% for {$214621d=9 seconds}.][.]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s2=0}/100} Insanity.|r][]

Action Priority List

    main
    [M]:35.92
  • if_expr:(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703313PCT0.490
Spell Direct AmountShadow Priest13703322PCT0.370
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Mind Spike 6673 36.7% 176.6 1.69s 11324 9670 Direct 176.6 9994 20024 11324 13.3%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 176.64 176.64 0.00 0.00 0.00 1.1711 0.0000 2000303.54 2000303.54 0.00% 9669.56 9669.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.73% 153.20 114 194 9993.94 9238 14432 9996.63 9716 10406 1531119 1531119 0.00%
crit 13.27% 23.43 7 48 20023.53 18476 28864 20029.42 18917 21976 469185 469185 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.808652
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.06

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage. |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity.|r

Action Priority List

    filler
    [H]:177.28
  • target_if_expr:dot.devouring_plague.remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Shadow Weaving 61 0.3% 33.0 6.42s 546 0 Direct 33.0 546 0 546 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.00 33.00 0.00 0.00 0.00 0.0000 0.0000 18026.06 18026.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 33.00 33 33 546.25 326 1603 546.24 472 696 18026 18026 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:363.56
  • base_dd_max:363.56
  • base_dd_mult:1.06

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Shadow Word: Death 857 4.7% 6.2 10.34s 41468 34206 Direct 6.2 36287 73147 41468 14.1%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.19 6.19 0.00 0.00 0.00 1.2124 0.0000 256716.93 256716.93 0.00% 34206.12 34206.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.94% 5.32 1 8 36287.42 31539 49273 36311.33 31539 43605 193069 193069 0.00%
crit 14.06% 0.87 0 5 73147.31 63077 98545 44279.97 0 98545 63648 63648 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.98

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to your target. If your target is not killed by Shadow Word: Death, you take backlash damage equal to {$s5=8}% of your maximum health.{$?=}A364675[ Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][ Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s4=0}/100} Insanity.|r][]

Action Priority List

    filler
    [G]:6.20
  • target_if_expr:target.health.pct<20|(buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703315PCT0.600
Spell Direct AmountShadow Priest13703320PCT-0.420
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Soulseeker Arrow 1043 5.7% 7.0 37.85s 44424 0 Periodic 79.9 3916 0 3916 0.0% 37.7%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.04 0.00 79.90 79.90 2.36 0.0000 1.4171 312904.46 312904.46 0.00% 2763.61 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 79.90 18 184 3916.35 121 4407 3912.21 3806 4124 312904 312904 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3629.20
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1730}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 2011 11.0% 13.5 21.04s 44693 37939 Periodic 127.8 4161 8333 4716 13.3% 99.4%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.49 0.00 127.83 127.83 13.49 1.1781 2.3336 602852.75 602852.75 0.00% 1918.80 37939.13
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.69% 110.81 77 145 4160.74 9 5947 4161.78 4031 4368 461049 461049 0.00%
crit 13.31% 17.02 3 34 8332.82 19 11895 8335.08 7296 9180 141803 141803 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.59
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [L]:13.49
  • if_expr:refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
  • target_if_expr:remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Periodic AmountShadow Priest1370334PCT0.500
Spell Direct AmountShadow Priest1370335PCT0.500
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
pet - shadowfiend 4203 / 497
melee 4203 2.7% 33.0 6.42s 4457 4309 Direct 33.0 3934 7867 4457 13.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.00 33.00 0.00 0.00 0.00 1.0344 0.0000 147090.38 147090.38 0.00% 4309.20 4309.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.69% 28.61 20 33 3933.84 3718 4573 3933.88 3811 4275 112538 112538 0.00%
crit 13.31% 4.39 0 13 7866.80 7435 9147 7795.13 0 9147 34552 34552 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 1.0 0.00s

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    cds
    [E]:1.00
  • if_expr:buff.power_infusion.up|fight_remains<=15
Devouring Plague (_heal) 85.9 3.41s

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 85.87 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 191.2%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Percent Cost Mind Devourer3732041-1.000Spell Data
Phial of Static Empowerment 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [D]:1.00
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Shadowfiend 2.0 0.00s

Stats Details: Shadowfiend

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0800 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowfiend

  • id:34433
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:343726
  • description:Summons a shadowy fiend to attack the target for {$d=15 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$262485s1=200}/100} Insanity each time the Shadowfiend attacks.|r][ |cFFFFFFFFGenerates {$=}{{$s4=5}/10}.1% Mana each time the Shadowfiend attacks.|r]

Action Priority List

    main
    [J]:2.00
  • if_expr:variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
Shadowform 1.0 0.00s

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 1.0 0.00s

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 127.8 2.33s

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 127.83 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Periodic AmountShadow Priest1370334PCT0.500
Spell Direct AmountShadow Priest1370335PCT0.500
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 1.0 0.0 0.0s 0.0s 14.4s 4.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.5s / 15.0s
  • uptime_min/max:3.80% / 6.22%

Stack Uptimes

  • blood_fury_1:4.86%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Devoured Pride 1.0 0.0 0.0s 0.0s 15.0s 5.07% 5.84% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s
  • uptime_min/max:4.17% / 6.25%

Stack Uptimes

  • devoured_pride_1:5.07%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0s 0.0s 29.4s 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.5s / 30.0s
  • uptime_min/max:8.01% / 12.47%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0s 0.0s 300.0s 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 60.9s 45.8s 16.5s 23.59% 0.00% 1.1 (1.1) 4.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 208.3s
  • trigger_min/max:0.1s / 208.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:4.83% / 54.38%

Stack Uptimes

  • sophic_devotion_1:23.59%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.2 0.0 0.0s 0.0s 19.4s 1.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.6s / 20.0s
  • uptime_min/max:0.00% / 8.31%

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:1.64%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.2 0.0 0.0s 0.0s 19.4s 1.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.6s / 20.0s
  • uptime_min/max:0.00% / 8.30%

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:1.61%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.3 0.0 0.0s 0.0s 19.4s 1.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.6s / 20.0s
  • uptime_min/max:0.00% / 8.30%

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:1.68%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.2 0.0 0.0s 0.0s 19.4s 1.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.31%

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:1.63%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0s 0.0s 300.0s 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:Primary stat is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Idol of Y'Shaarj Devoured Violence procs 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 85.80% 83.58% 87.64% 6.3s 0.0s 9.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Shadow Word: Death39.2160.000289.508242.801193.012294.485
Shadowfiend0.4200.0000.8910.8410.7850.891
Mind Blast0.267-0.0001.9189.6548.00213.439

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Mana RegenMana715.8029937.50100.00%41.82736850.8796.10%
ShadowfiendInsanity33.0066.006.17%2.000.000.00%
Mind BlastInsanity35.78214.6920.07%6.000.000.00%
Mind SpikeInsanity176.64706.5566.04%4.000.000.00%
Shadow Word: DeathInsanity6.1924.762.31%4.000.000.00%
Vampiric TouchInsanity14.4957.965.42%4.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 20.941046.93100.00%50.0050.001256.61
Mind BlastMana 35.7822363.6874.29%625.00625.0035.94
Shadow Word: DeathMana 6.197738.3025.71%1250.001249.9933.17
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 273300.0 363.13 430.88 466587.1 252975.9 223297.2 273300.0
Mana 250000.0 99.79 100.34 736851.2 249835.5 248127.6 250000.0
Insanity 4.0 3.57 3.49 0.0 23.0 0.0 54.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 18215.49
Minimum 16628.86
Maximum 20633.07
Spread ( max - min ) 4004.21
Range [ ( max - min ) / 2 * 100% ] 10.99%
Standard Deviation 479.8156
5th Percentile 17463.95
95th Percentile 19037.15
( 95th Percentile - 5th Percentile ) 1573.19
Mean Distribution
Standard Deviation 5.5408
95.00% Confidence Interval ( 18204.63 - 18226.35 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2666
0.1 Scale Factor Error with Delta=300 1966
0.05 Scale Factor Error with Delta=300 7862
0.01 Scale Factor Error with Delta=300 196532
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 18215.49
Minimum 16628.86
Maximum 20633.07
Spread ( max - min ) 4004.21
Range [ ( max - min ) / 2 * 100% ] 10.99%
Standard Deviation 479.8156
5th Percentile 17463.95
95th Percentile 19037.15
( 95th Percentile - 5th Percentile ) 1573.19
Mean Distribution
Standard Deviation 5.5408
95.00% Confidence Interval ( 18204.63 - 18226.35 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2666
0.1 Scale Factor Error with Delta=300 1966
0.05 Scale Factor Error with Delta=300 7862
0.01 Scale Factor Error with Delta=300 196532
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 18215.49
Minimum 16628.86
Maximum 20633.07
Spread ( max - min ) 4004.21
Range [ ( max - min ) / 2 * 100% ] 10.99%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 5310187.13
Minimum 3990197.73
Maximum 6663423.93
Spread ( max - min ) 2673226.20
Range [ ( max - min ) / 2 * 100% ] 25.17%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 430.81
Minimum 374.50
Maximum 489.39
Spread ( max - min ) 114.88
Range [ ( max - min ) / 2 * 100% ] 13.33%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 363.30
Minimum 277.77
Maximum 436.20
Spread ( max - min ) 158.42
Range [ ( max - min ) / 2 * 100% ] 21.80%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 shadowform,if=!buff.shadowform.up
5 0.00 arcane_torrent
6 0.00 shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(!set_bonus.tier31_4pc|spell_targets.shadow_crash>1)
7 0.00 vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice|set_bonus.tier31_4pc&spell_targets.shadow_crash=1
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=holding_crash,op=set,value=raid_event.adds.in<15
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
8 0.00 run_action_list,name=aoe,if=active_enemies>2
9 0.00 run_action_list,name=main
actions.cds
# count action,conditions
D 1.00 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
TODO: Check VE/DA enter conditions based on dots
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
E 1.00 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 use_item,name=nymues_unraveling_spindle,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<3+gcd.max|fight_remains<15)
Use Nymue's before we go into our cooldowns
0.00 use_item,name=belorrelos_the_suncaller,use_off_gcd=1,if=gcd.remains>0&(!raid_event.adds.exists&!prev_gcd.1.mindbender|raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)|fight_remains<20
Use Belor'relos, the Suncaller before we go into our cooldowns
0.00 divine_star,if=(raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)&equipped.belorrelos_the_suncaller&trinket.belorrelos_the_suncaller.cooldown.remains<=gcd.max
Fit in a Divine Star as you cast Belor's for the free GCD.
0.00 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
Sync Power Infusion with Voidform or Dark Ascension
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
0.00 dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
F 0.00 call_action_list,name=trinkets
0.00 desperate_prayer,if=health.pct<=75
Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.filler
# count action,conditions
0.00 vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
G 6.20 shadow_word_death,target_if=target.health.pct<20|(buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking
0.00 mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=dot.devouring_plague.remains>cast_time
0.00 mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up
0.00 mindgames,target_if=max:dot.devouring_plague.remains
0.00 shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
0.00 halo,if=spell_targets>1
Save up to 20s if adds are coming soon.
H 177.28 mind_spike,target_if=max:dot.devouring_plague.remains
0.00 mind_flay,target_if=max:dot.devouring_plague.remains,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 divine_star
0.00 shadow_crash,if=raid_event.adds.in>20&!set_bonus.tier31_4pc
Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 shadow_word_death,target_if=max:dot.devouring_plague.remains
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain,target_if=max:dot.devouring_plague.remains,if=set_bonus.tier31_4pc
Use Shadow Word: Pain while moving as a low-priority action with T31 4pc
0.00 shadow_word_pain,target_if=min:remains,if=!set_bonus.tier31_4pc
Use Shadow Word: Pain while moving as a low-priority action without T31 4pc
actions.main
# count action,conditions
0.00 variable,name=dots_up,op=set,value=active_dot.vampiric_touch=active_enemies|action.shadow_crash.in_flight&talent.whispering_shadows
I 0.00 call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
J 2.00 mindbender,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active and sync with Dark Ascension
K 20.94 devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=remains<=gcd.max|insanity.deficit<=16
0.00 shadow_word_death,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)&dot.devouring_plague.ticking
0.00 mind_blast,target_if=dot.devouring_plague.remains>execute_time&(cooldown.mind_blast.full_recharge_time<=gcd.max+execute_time)|pet.fiend.remains<=execute_time+gcd.max,if=pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>execute_time&active_enemies<=7
High priority Mind Blast action when using Inescapable Torment
0.00 shadow_word_death,target_if=dot.devouring_plague.ticking&pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
0.00 void_bolt,if=variable.dots_up
0.00 devouring_plague,if=fight_remains<=duration+4
Spend your Insanity on Devouring Plague at will if the fight will end in less than 10s
0.00 devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=(remains<=gcd.max|remains<3&cooldown.void_torrent.up)|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2|buff.mind_devourer.up&pmultiplier<1.2
Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
0.00 shadow_word_death,if=set_bonus.tier31_2pc
0.00 shadow_crash,if=!variable.holding_crash&(dot.vampiric_touch.refreshable|buff.deaths_torment.stack>9&set_bonus.tier31_4pc)
Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
0.00 shadow_word_pain,if=buff.deaths_torment.stack>9&set_bonus.tier31_4pc&(!variable.holding_crash|!talent.shadow_crash)
Consume T31 4pc SWPs
0.00 shadow_word_death,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
L 13.49 vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
M 35.92 mind_blast,if=(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
0.00 void_torrent,if=!variable.holding_crash,target_if=dot.devouring_plague.remains>=2.5,interrupt_if=cooldown.shadow_word_death.ready&pet.fiend.active&set_bonus.tier31_2pc
Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
N 0.00 call_action_list,name=filler
Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=(buff.power_infusion.up|fight_remains<20)&equipped.voidmenders_shadowgem
0.00 use_item,name=iridal_the_earths_master,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
0.00 use_item,name=dreambinder_loom_of_the_great_cycle,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno,if=equipped.darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime,if=equipped.darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance,if=equipped.darkmoon_deck_box_dance
0.00 use_item,name=erupting_spear_fragment,if=(buff.power_infusion.up|raid_event.adds.up|fight_remains<20)&equipped.erupting_spear_fragment
Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
0.00 use_item,name=beacon_to_the_beyond,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20)&equipped.beacon_to_the_beyond
Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
O 1.00 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex,if=equipped.desperate_invokers_codex

Sample Sequence

01247JMHHHHHHKMHHHHHHLKMHHHHHHMHHHKHHMHHHHHLMHHKHHHMHHHHHHMKHHLHHMHHHHHHKMHHHHHLMHHHHKHMHHHHHHMHLKHHHMHHHHHHMHKHHLHMHHHHHHMKHHHHHMHLHHHKMHHHHHHMHHHHKLMHHHHHHMHHKHHJMLHHHHHKMHHHHHHKMHLHHHHMHHHHKHMHHHHLHMHHKHHHMHHHGHHMHKLHGHMHHHHHGMKHHLHHDMGHHHHKMOHGHHEHHLMHGHKHHMH

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 4 shadowform PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 7 vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment
0:00.000 main J shadowfiend Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, static_empowerment
0:00.943 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment
0:01.881 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
16.0/100: 16% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(2)
0:02.821 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(3)
0:03.761 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(4)
0:04.699 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:05.638 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:06.578 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:07.518 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:08.458 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:09.398 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
12.0/100: 12% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:10.338 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:11.280 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:12.220 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:13.160 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:14.102 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:15.040 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 bloodlust, shadowform, static_empowerment(5)
0:15.979 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, static_empowerment(5)
0:16.920 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 bloodlust, shadowform, static_empowerment(5)
0:17.859 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:18.798 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:19.737 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:20.674 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:21.614 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:22.554 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:23.494 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:24.434 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
38.0/100: 38% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:25.372 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:26.311 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:27.251 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:28.190 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:29.130 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:30.070 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:31.010 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
14.0/100: 14% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:31.949 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:32.890 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:33.828 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:34.767 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:35.703 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:36.642 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:37.582 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
44.0/100: 44% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:38.522 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:39.461 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:40.401 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:41.622 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5)
0:42.843 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
0:44.066 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
0:45.367 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
0:46.586 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
0:47.806 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
0:49.028 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
0:50.247 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
0:51.466 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
0:52.688 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
0:53.909 main K devouring_plague Fluffy_Pillow 249387.8/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
0:55.131 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
0:56.351 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
0:57.570 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
0:58.793 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
1:00.015 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
1:01.238 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
1:02.459 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
1:03.680 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:04.900 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
1:06.122 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
1:07.340 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:08.561 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
1:09.783 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
1:11.003 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
1:12.224 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:13.447 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
1:14.668 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
1:15.888 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
1:17.109 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
1:18.329 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
1:19.551 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:20.772 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
1:21.993 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
1:23.214 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
1:24.434 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
1:25.653 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
1:26.874 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
1:28.095 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:29.315 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
1:30.536 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
1:31.758 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
1:32.977 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
1:34.197 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
1:35.418 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
1:36.638 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
1:37.859 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:39.080 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
1:40.302 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
1:41.524 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
1:42.745 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
1:43.965 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
1:45.186 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
1:46.407 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
1:47.629 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
1:48.848 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
1:50.068 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:51.288 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
1:52.508 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
1:53.728 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:54.948 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
1:56.168 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
1:57.389 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
1:58.610 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:59.832 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
2:01.054 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
2:02.276 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
2:03.495 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
2:04.717 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
2:05.937 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
2:07.158 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
2:08.376 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
2:09.597 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
2:10.818 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
2:12.039 main K devouring_plague Fluffy_Pillow 249387.8/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
2:13.259 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
2:14.480 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
2:15.699 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
2:16.918 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
2:18.139 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
2:19.359 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
2:20.580 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
2:21.800 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
2:23.020 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
2:24.240 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
2:25.460 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
2:26.681 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
2:27.901 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
2:29.123 filler H mind_spike Fluffy_Pillow 249390.4/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
2:30.342 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
2:31.562 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
2:32.783 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
2:34.004 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
2:35.226 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
2:36.445 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
2:37.666 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
2:38.885 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
2:40.106 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
2:41.327 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
2:42.547 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
2:43.767 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
2:44.987 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:46.207 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:47.429 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:48.649 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:49.869 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:51.091 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:52.312 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:53.534 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:54.753 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
42.0/100: 42% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:55.972 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:57.194 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:58.414 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:59.633 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:00.853 main J shadowfiend Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:02.074 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:03.294 main L vampiric_touch Fluffy_Pillow 249385.2/250000: 100% mana
18.0/100: 18% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:04.513 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:05.734 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:06.955 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:08.174 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
3:09.395 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
3:10.615 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
3:11.836 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:13.059 filler H mind_spike Fluffy_Pillow 249392.9/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
3:14.281 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
3:15.500 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
3:16.721 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
3:17.941 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
3:19.161 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
3:20.382 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
3:21.602 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
3:22.822 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:24.041 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
3:25.263 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
3:26.482 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
3:27.702 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
3:28.924 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
3:30.143 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
3:31.363 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
3:32.585 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
3:33.806 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
3:35.027 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
3:36.247 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
3:37.467 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
3:38.687 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:39.909 filler H mind_spike Fluffy_Pillow 249390.4/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
3:41.130 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
3:42.350 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
3:43.572 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
3:44.793 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
3:46.013 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
3:47.234 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
3:48.453 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
3:49.674 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
3:50.896 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
3:52.117 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
3:53.339 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
3:54.560 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
3:55.778 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
3:56.998 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
3:58.217 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
3:59.438 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
4:00.658 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
4:01.880 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
4:03.103 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:04.323 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:05.543 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
48.0/100: 48% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:06.766 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:07.985 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:09.207 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:10.427 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:11.878 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:13.097 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:14.317 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:15.539 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:16.761 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:17.982 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:19.203 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:20.423 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:21.878 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:23.098 main K devouring_plague Fluffy_Pillow 249385.2/250000: 100% mana
54.0/100: 54% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:24.318 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:25.539 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, sophic_devotion, static_empowerment(5)
4:26.758 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
4:27.979 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
4:29.198 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
4:30.418 cds D potion Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
4:30.418 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:31.638 filler G shadow_word_death Fluffy_Pillow 249385.2/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:32.860 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:34.079 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:35.299 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:36.520 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:37.740 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:38.960 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.180 trinkets O use_items Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.180 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity		 shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:41.399 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:42.859 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:44.080 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.299 cds E blood_fury PR_Priest_Shadow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.299 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:46.520 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:47.740 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:48.960 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:50.183 filler H mind_spike Fluffy_Pillow 249392.9/250000: 100% mana
40.0/100: 40% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:51.405 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:52.859 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:54.078 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:55.299 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:56.520 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:57.741 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:58.963 filler H mind_spike Fluffy_Pillow 249390.4/250000: 100% mana
16.0/100: 16% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3848 1 13665 13015 9166
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 273300 260300 0
Mana 250000 250000 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 2560 2560 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +923 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +692 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +923 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +923 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +111 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +692 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +519 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +519 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +923 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Talents

RowPriest Talents [1]
1
2
3
4
5
6
7
8
9
10
RowShadow Talents [2]
1
2
3
4
5
6
7
8
9
10

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(!set_bonus.tier31_4pc|spell_targets.shadow_crash>1)
actions.precombat+=/vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice|set_bonus.tier31_4pc&spell_targets.shadow_crash=1

# Executed every time the actor is available.
actions=variable,name=holding_crash,op=set,value=raid_event.adds.in<15
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
actions+=/run_action_list,name=aoe,if=active_enemies>2
actions+=/run_action_list,name=main

actions.aoe=call_action_list,name=aoe_variables
# High Priority action to put out Vampiric Touch on enemies that will live at least 18 seconds, up to 12 targets manually while prepping AoE
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.dots_up),if=variable.max_vts>0&!variable.manual_vts_applied&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Crash to apply Vampiric Touch to as many adds as possible while being efficient with Vampiric Touch refresh windows
actions.aoe+=/shadow_crash,if=!variable.holding_crash,target_if=dot.vampiric_touch.refreshable|dot.vampiric_touch.remains<=target.time_to_die&!buff.voidform.up&(raid_event.adds.in-dot.vampiric_touch.remains)<15
actions.aoe+=/call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend or Mindbender on cooldown if DoTs are active and sync with Dark Ascension
actions.aoe+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.dots_up|action.shadow_crash.in_flight&talent.whispering_shadows)&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
actions.aoe+=/devouring_plague,target_if=max:target.time_to_die*(!dot.devouring_plague.ticking),if=talent.distorted_reality&(active_dot.devouring_plague=0|insanity.deficit<=20)
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff or if Inescapable Torment is talented with Mindbender active. Only use when facing 3-7 targets.
actions.aoe+=/mind_blast,target_if=max:dot.devouring_plague.remains,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&active_enemies<=7&!buff.mind_devourer.up&dot.devouring_plague.remains>execute_time
# High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
actions.aoe+=/void_bolt,target_if=max:target.time_to_die
# Use Devouring Plague on enemies that will live the longest with distorted reality.
actions.aoe+=/devouring_plague,target_if=max:target.time_to_die*(!dot.devouring_plague.ticking),if=talent.distorted_reality
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.aoe+=/devouring_plague,if=(remains<=gcd.max&!variable.pool_for_cds|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2)&!talent.distorted_reality
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.dots_up),if=variable.max_vts>0&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash)&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
# High Priority Mind Spike: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up&variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# # Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.aoe+=/mind_blast,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent action list for AoE
actions.aoe+=/void_torrent,target_if=max:dot.devouring_plague.remains,if=(!variable.holding_crash|raid_event.adds.count%(active_dot.vampiric_touch+raid_event.adds.count)<1.5)&(dot.devouring_plague.remains>=2.5|buff.voidform.up)
# High priority action for Mind Flay: Insanity to fish for Idol of C'Thun procs, cancel as soon as something else is more important and most of the channel has completed
actions.aoe+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up&talent.idol_of_cthun,interrupt_if=ticks>=2,interrupt_immediate=1
actions.aoe+=/call_action_list,name=filler

actions.aoe_variables=variable,name=max_vts,op=set,default=12,value=spell_targets.vampiric_touch>?12
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
# TODO: Revamp to fix undesired behaviour with unstacked fights
actions.aoe_variables+=/variable,name=dots_up,op=set,value=(active_dot.vampiric_touch+8*(action.shadow_crash.in_flight&talent.whispering_shadows))>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=holding_crash,op=set,value=(variable.max_vts-active_dot.vampiric_touch)<4|raid_event.adds.in<10&raid_event.adds.count>(variable.max_vts-active_dot.vampiric_touch),if=variable.holding_crash&talent.whispering_shadows
actions.aoe_variables+=/variable,name=manual_vts_applied,op=set,value=(active_dot.vampiric_touch+8*!variable.holding_crash)>=variable.max_vts|!variable.is_vt_possible

# TODO: Check VE/DA enter conditions based on dots
actions.cds=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
actions.cds+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions.cds+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions.cds+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions.cds+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
# Use Nymue's before we go into our cooldowns
actions.cds+=/use_item,name=nymues_unraveling_spindle,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<3+gcd.max|fight_remains<15)
# Use Belor'relos, the Suncaller before we go into our cooldowns
actions.cds+=/use_item,name=belorrelos_the_suncaller,use_off_gcd=1,if=gcd.remains>0&(!raid_event.adds.exists&!prev_gcd.1.mindbender|raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)|fight_remains<20
# Fit in a Divine Star as you cast Belor's for the free GCD.
actions.cds+=/divine_star,if=(raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)&equipped.belorrelos_the_suncaller&trinket.belorrelos_the_suncaller.cooldown.remains<=gcd.max
# Sync Power Infusion with Voidform or Dark Ascension
actions.cds+=/power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
# Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
# Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
actions.cds+=/call_action_list,name=trinkets
# Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.cds+=/desperate_prayer,if=health.pct<=75

# Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
actions.filler=vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
actions.filler+=/shadow_word_death,target_if=target.health.pct<20|(buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking
actions.filler+=/mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=dot.devouring_plague.remains>cast_time
actions.filler+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up
actions.filler+=/mindgames,target_if=max:dot.devouring_plague.remains
actions.filler+=/shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
# Save up to 20s if adds are coming soon.
actions.filler+=/halo,if=spell_targets>1
actions.filler+=/mind_spike,target_if=max:dot.devouring_plague.remains
actions.filler+=/mind_flay,target_if=max:dot.devouring_plague.remains,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
actions.filler+=/divine_star
# Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
actions.filler+=/shadow_crash,if=raid_event.adds.in>20&!set_bonus.tier31_4pc
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.filler+=/shadow_word_death,target_if=target.health.pct<20
# Use Shadow Word: Death while moving as a low-priority action
actions.filler+=/shadow_word_death,target_if=max:dot.devouring_plague.remains
# Use Shadow Word: Pain while moving as a low-priority action with T31 4pc
actions.filler+=/shadow_word_pain,target_if=max:dot.devouring_plague.remains,if=set_bonus.tier31_4pc
# Use Shadow Word: Pain while moving as a low-priority action without T31 4pc
actions.filler+=/shadow_word_pain,target_if=min:remains,if=!set_bonus.tier31_4pc

actions.main=variable,name=dots_up,op=set,value=active_dot.vampiric_touch=active_enemies|action.shadow_crash.in_flight&talent.whispering_shadows
actions.main+=/call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active and sync with Dark Ascension
actions.main+=/mindbender,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
actions.main+=/devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=remains<=gcd.max|insanity.deficit<=16
actions.main+=/shadow_word_death,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)&dot.devouring_plague.ticking
# High priority Mind Blast action when using Inescapable Torment
actions.main+=/mind_blast,target_if=dot.devouring_plague.remains>execute_time&(cooldown.mind_blast.full_recharge_time<=gcd.max+execute_time)|pet.fiend.remains<=execute_time+gcd.max,if=pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>execute_time&active_enemies<=7
# High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
actions.main+=/shadow_word_death,target_if=dot.devouring_plague.ticking&pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
actions.main+=/void_bolt,if=variable.dots_up
# Spend your Insanity on Devouring Plague at will if the fight will end in less than 10s
actions.main+=/devouring_plague,if=fight_remains<=duration+4
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.main+=/devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=(remains<=gcd.max|remains<3&cooldown.void_torrent.up)|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2|buff.mind_devourer.up&pmultiplier<1.2
actions.main+=/shadow_word_death,if=set_bonus.tier31_2pc
# Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
actions.main+=/shadow_crash,if=!variable.holding_crash&(dot.vampiric_touch.refreshable|buff.deaths_torment.stack>9&set_bonus.tier31_4pc)
# Consume T31 4pc SWPs
actions.main+=/shadow_word_pain,if=buff.deaths_torment.stack>9&set_bonus.tier31_4pc&(!variable.holding_crash|!talent.shadow_crash)
# Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
actions.main+=/shadow_word_death,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
# Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
actions.main+=/vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
# Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.main+=/mind_blast,if=(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
actions.main+=/void_torrent,if=!variable.holding_crash,target_if=dot.devouring_plague.remains>=2.5,interrupt_if=cooldown.shadow_word_death.ready&pet.fiend.active&set_bonus.tier31_2pc
# Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.main+=/call_action_list,name=filler

actions.trinkets=use_item,name=voidmenders_shadowgem,if=(buff.power_infusion.up|fight_remains<20)&equipped.voidmenders_shadowgem
actions.trinkets+=/use_item,name=iridal_the_earths_master,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
actions.trinkets+=/use_item,name=dreambinder_loom_of_the_great_cycle,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno,if=equipped.darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime,if=equipped.darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance,if=equipped.darkmoon_deck_box_dance
# Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
actions.trinkets+=/use_item,name=erupting_spear_fragment,if=(buff.power_infusion.up|raid_event.adds.up|fight_remains<20)&equipped.erupting_spear_fragment
# Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
actions.trinkets+=/use_item,name=beacon_to_the_beyond,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20)&equipped.beacon_to_the_beyond
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
actions.trinkets+=/use_item,name=desperate_invokers_codex,if=equipped.desperate_invokers_codex

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=9166
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 49829 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
49828.7 49828.7 52.7 / 0.106% 9132.7 / 18.3% 68.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
677.4 675.8 Mana 0.91% 52.0 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQJJSIAAAAAAAAAAAAgSESCJkioQSDAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 49829
Doom Winds 101 0.2% 3.7 90.43s 8099 7306 Direct 3.7 6672 13357 8099 21.3% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.1085 0.0000 30226.98 43182.51 30.00% 7306.50 7306.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.65% 2.94 0 4 6672.37 3768 12834 6664.99 0 9816 19585 27979 29.89%
crit 21.35% 0.80 0 4 13356.74 7535 25668 7876.32 0 25668 10642 15204 17.66%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.73
  • if_expr:raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Flame Shock 1531 3.1% 29.6 9.99s 15533 40909 Direct 29.6 2748 5498 3315 20.6% 0.0%
Periodic 184.2 1626 3251 1961 20.6% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.56 29.56 184.18 184.18 27.96 0.3797 1.5778 459123.85 459123.85 0.00% 1521.25 40909.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.36% 23.46 11 37 2747.56 2332 4416 2747.21 2462 3142 64446 64446 0.00%
crit 20.64% 6.10 0 16 5497.88 4664 8831 5494.26 0 7879 33550 33550 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.40% 146.23 102 193 1625.99 1 2616 1625.66 1492 1818 237772 237772 0.00%
crit 20.60% 37.94 16 63 3251.03 3 5231 3250.72 2861 3744 123356 123356 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Volcanic damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Volcanic damage and then an additional {$=}o2 Volcanic damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Volcanic damage and knocking them into the air.]

Action Priority List

    single
    [O]:1.60
  • if_expr:!ticking
    single
    [W]:7.94

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Spell Periodic AmountFire and Ice3828862PCT0.030
Flametongue Weapon 0 (1371) 0.0% (2.8%) 1.0 0.00s 410713 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFire and Ice3828861PCT0.030
    Flametongue Attack 1371 2.8% 992.9 0.68s 414 0 Direct 992.9 343 686 414 20.7% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 992.87 992.87 0.00 0.00 0.00 0.0000 0.0000 410713.34 410713.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.34% 787.73 535 1050 342.67 285 555 342.78 319 381 269936 269936 0.00%
crit 20.66% 205.14 121 317 686.24 569 1100 686.46 628 780 140778 140778 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Forgestorm Ignited (_damage) 1232 2.5% 28.4 7.75s 13026 0 Direct 28.4 10808 21617 13026 20.5% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.40 28.40 0.00 0.00 0.00 0.0000 0.0000 369883.63 369883.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.48% 22.57 2 60 10807.60 10705 11241 10799.65 10705 11187 243899 243899 0.00%
crit 20.52% 5.83 0 20 21617.27 21411 22481 21340.39 0 22481 125985 125985 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 967 1.9% 14.2 19.43s 20403 17042 Direct 14.2 16913 33886 20403 20.6% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.22 14.22 0.00 0.00 0.00 1.1972 0.0000 290058.51 290058.51 0.00% 17042.22 17042.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.43% 11.29 2 24 16912.66 7534 29687 16962.47 12174 22059 190986 190986 0.00%
crit 20.57% 2.92 0 11 33885.50 15068 59374 32205.45 0 54711 99073 99073 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [U]:14.22

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownEnhancement Shaman1370417ADD6000.000
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Ice Strike 1876 3.8% 21.5 13.79s 26135 22025 Direct 21.5 21695 43358 26135 20.5% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.53 21.53 0.00 0.00 0.00 1.1866 0.0000 562800.76 562800.76 0.00% 22024.84 22024.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.50% 17.12 7 25 21694.65 17718 35004 21691.47 18808 24987 371428 371428 0.00%
crit 20.50% 4.41 0 14 43357.71 35436 69815 42962.84 0 65491 191372 191372 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [P]:20.49
  • if_expr:!buff.ice_strike.up
    single
    [R]:1.05

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Lava Lash 1764 3.5% 20.0 14.71s 26429 22208 Direct 20.0 21874 43726 26429 20.8% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 0.00 0.00 0.00 1.1901 0.0000 529072.93 529072.93 0.00% 22207.56 22207.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.15% 15.85 7 24 21873.78 18660 35109 21865.76 19600 25143 346605 346605 0.00%
crit 20.85% 4.17 0 11 43726.19 37319 70218 43214.81 0 64744 182468 182468 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [Q]:20.02

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownMolten Assault3340331ADD-3000.000
Spell Direct AmountFire and Ice3828861PCT0.030
Lightning Bolt 13778 27.7% 68.1 4.37s 60696 51281 Direct 68.1 50273 100605 60696 20.7% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.07 68.07 0.00 0.00 0.00 1.1836 0.0000 4131745.64 4131745.64 0.00% 51281.44 51281.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.29% 53.98 32 79 50273.31 34015 101174 50283.61 43246 57580 2713577 2713577 0.00%
crit 20.71% 14.10 3 31 100604.92 68031 200376 100608.94 75509 132587 1418168 1418168 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.09

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [N]:68.07
  • if_expr:((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
Spell Direct AmountThorim's Invocation3844442PCT0.200
main_hand 1790 3.6% 193.5 1.81s 2774 1556 Direct 193.5 2660 5323 2774 20.7% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.48 193.48 0.00 0.00 0.00 1.7823 0.0000 536653.63 766667.58 30.00% 1556.27 1556.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.94% 121.77 80 170 2660.48 2257 4294 2660.52 2455 2971 323963 462816 30.00%
crit 20.65% 39.95 14 67 5323.41 4513 8506 5323.45 4794 6036 212690 303851 30.00%
miss 16.41% 31.76 11 59 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 897 1.8% 193.6 1.80s 1390 779 Direct 193.6 1331 2666 1390 20.6% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.57 193.57 0.00 0.00 0.00 1.7835 0.0000 268991.72 384283.69 30.00% 779.14 779.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.05% 122.05 76 171 1331.47 1128 2151 1331.42 1224 1496 162509 232161 30.00%
crit 20.63% 39.94 19 69 2666.33 2257 4302 2666.61 2340 3065 106483 152122 30.00%
miss 16.32% 31.59 12 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (9733) 0.0% (19.5%) 90.8 3.30s 32122 27359

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.78 0.00 0.00 0.00 0.00 1.1741 0.0000 0.00 0.00 0.00% 27358.70 27358.70

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:57.33
  • if_expr:buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
    single
    [S]:33.45

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
    Stormstrike (_mh) 5273 (6488) 10.6% (13.0%) 121.1 2.47s 16059 0 Direct 121.1 (173.7) 10813 21655 13051 20.6% (14.4%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 121.05 121.05 0.00 0.00 0.00 0.0000 0.0000 1579888.25 2257040.76 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 96.06 54 147 10812.54 3255 27399 10835.30 9099 12766 1038664 1483844 30.00%
crit 20.65% 24.99 6 48 21655.15 6510 53977 21700.35 14549 29033 541224 773197 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
        Stormblast (_stormstrike_mh) 1216 2.4% 52.6 5.65s 6916 0 Direct 52.6 6916 0 6916 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.65 52.65 0.00 0.00 0.00 0.0000 0.0000 364101.59 364101.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 52.65 20 86 6915.54 3572 24884 6919.85 5612 9095 364102 364102 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2637 (3245) 5.3% (6.5%) 121.1 2.47s 8031 0 Direct 121.1 (173.7) 5407 10822 6527 20.7% (14.4%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 121.05 121.05 0.00 0.00 0.00 0.0000 0.0000 790139.27 1128799.16 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.31% 96.01 56 153 5406.98 1628 13700 5418.44 4530 6418 519137 741643 30.00%
crit 20.69% 25.04 6 48 10822.13 3255 27074 10844.23 7332 14396 271002 387156 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
        Stormblast (_stormstrike_offhand) 608 1.2% 52.6 5.65s 3457 0 Direct 52.6 3457 0 3457 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.65 52.65 0.00 0.00 0.00 0.0000 0.0000 182006.98 182006.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 52.65 20 86 3456.96 1786 12232 3459.23 2774 4357 182007 182007 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 971 1.9% 6.0 50.53s 48430 40705 Direct 6.0 40259 80413 48429 20.3% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 6.01 0.00 0.00 0.00 1.1899 0.0000 291205.84 291205.84 0.00% 40705.32 40705.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 4.79 0 8 40259.16 26249 90449 40295.35 0 61817 192818 192818 0.00%
crit 20.35% 1.22 0 5 80413.25 52498 159186 59505.25 0 156257 98388 98388 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [T]:6.01
  • if_expr:raid_event.adds.in>=action.sundering.cooldown

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Tempest Strikes 3783 7.6% 162.6 1.84s 6975 0 Direct 162.6 5780 11568 6975 20.7% 0.0%

Stats Details: Tempest Strikes

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 162.56 162.56 0.00 0.00 0.00 0.0000 0.0000 1133903.24 1133903.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.34% 128.98 83 190 5779.53 4848 9379 5780.53 5292 6457 745459 745459 0.00%
crit 20.66% 33.58 13 61 11568.08 9695 18577 11570.17 10237 13582 388444 388444 0.00%

Action Details: Tempest Strikes

  • id:428078
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:428078
  • name:Tempest Strikes
  • school:nature
  • tooltip:
  • description:{$@spelldesc428071=Stormstrike, Ice Strike, and Lava Lash have a {$h=100}% chance to discharge electricity at your target, dealing {$428078s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Windfury Weapon 0 (6915) 0.0% (13.9%) 1.0 0.00s 2069523 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6915 13.9% 375.8 2.50s 5508 0 Direct 375.8 4560 9141 5508 20.7% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 375.75 375.75 0.00 0.00 0.00 0.0000 0.0000 2069523.04 2956536.87 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.31% 298.02 185 433 4559.80 1878 11455 4561.16 3974 5384 1358920 1941364 30.00%
crit 20.69% 77.74 37 125 9141.29 3756 22909 9143.29 7586 11112 710603 1015173 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
pet - greater_earth_elemental 431 / 89
melee 431 0.2% 38.9 2.23s 681 437 Direct 38.9 565 1130 681 20.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.91 38.91 0.00 0.00 0.00 1.5584 0.0000 26503.57 37863.20 30.00% 437.13 437.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.39% 30.89 0 57 564.81 488 915 563.91 0 737 17444 24921 30.00%
crit 20.61% 8.02 0 23 1129.70 976 1831 1126.78 0 1538 9059 12942 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4093 / 3030
melee 4093 6.1% 383.2 1.56s 2368 2041 Direct 383.2 1962 3927 2368 20.7% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 383.20 383.20 0.00 0.00 0.00 1.1606 0.0000 907571.76 1296564.15 30.00% 2040.73 2040.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.31% 303.90 210 417 1961.64 1630 3160 1962.04 1817 2223 596144 851656 30.00%
crit 20.69% 79.30 43 126 3927.40 3260 6321 3928.34 3553 4483 311428 444908 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.1 308.06s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.11 0.00 0.00 0.00 0.00 1.0415 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [V]:1.11
Feral Spirit 15.5 20.44s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.50 0.00 0.00 0.00 0.00 1.1698 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:15.50

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 301.99s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 3.1 113.78s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.09 0.00 0.00 0.00 0.00 0.5587 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Action Priority List

    single
    [M]:1.49
  • if_expr:!buff.windfury_totem.up
    single
    [X]:0.60
  • if_expr:buff.windfury_totem.remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.3s 58.7s 50.6s 80.39% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 332.0s
  • trigger_min/max:15.0s / 315.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.3s
  • uptime_min/max:50.35% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.39%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Crumbling Power 2.0 0.0 180.4s 5.4s 18.5s 12.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.3s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s
  • uptime_min/max:10.25% / 15.37%

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.36%
  • crumbling_power_3:0.72%
  • crumbling_power_4:0.75%
  • crumbling_power_5:0.75%
  • crumbling_power_6:0.71%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.68%
  • crumbling_power_19:0.69%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4s 90.4s 7.9s 9.88% 12.54% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.4s
  • trigger_min/max:90.0s / 92.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:8.73% / 11.44%

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 15.5 0.0 22.2s 19.9s 16.9s 74.01% 100.00% 0.0 (0.0) 12.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 100.3s
  • trigger_min/max:4.6s / 38.3s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 85.6s
  • uptime_min/max:60.31% / 87.41%

Stack Uptimes

  • earthen_weapon_2:72.28%
  • earthen_weapon_4:1.73%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 301.2s 302.0s 27.5s 13.45% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 317.6s
  • trigger_min/max:300.0s / 317.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.97% / 18.15%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.45%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 13.1 2.4 23.7s 20.4s 16.9s 74.01% 0.00% 62.2 (62.2) 12.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 100.3s
  • trigger_min/max:4.6s / 38.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 85.6s
  • uptime_min/max:60.32% / 87.42%

Stack Uptimes

  • feral_spirit_1:74.01%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 36.8 447.2 8.2s 0.6s 7.2s 88.18% 92.41% 447.2 (1085.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 72.8s
  • trigger_min/max:0.0s / 14.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.1s
  • uptime_min/max:77.37% / 95.51%

Stack Uptimes

  • flurry_1:18.94%
  • flurry_2:35.89%
  • flurry_3:33.34%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.1 108.1 18.0s 2.4s 14.6s 83.67% 100.00% 48.1 (48.1) 16.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 53.5s
  • trigger_min/max:0.0s / 43.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:68.50% / 93.56%

Stack Uptimes

  • forceful_winds_1:16.13%
  • forceful_winds_2:14.93%
  • forceful_winds_3:13.10%
  • forceful_winds_4:10.61%
  • forceful_winds_5:28.90%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=20}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.6s 46.3s 13.0s 19.52% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 210.8s
  • trigger_min/max:0.1s / 210.8s
  • trigger_pct:98.73%
  • duration_min/max:0.0s / 50.3s
  • uptime_min/max:3.51% / 49.49%

Stack Uptimes

  • forgestorm_ignited_1:19.52%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.5 1.0 14.5s 13.8s 8.9s 60.90% 87.65% 1.0 (1.0) 7.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.7s / 61.4s
  • trigger_min/max:8.7s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.3s
  • uptime_min/max:38.59% / 77.57%

Stack Uptimes

  • ice_strike_1:60.90%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 25.1 23.6 11.9s 6.1s 8.1s 67.90% 100.00% 23.6 (23.6) 24.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 71.1s
  • trigger_min/max:0.9s / 28.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.9s
  • uptime_min/max:55.53% / 83.14%

Stack Uptimes

  • legacy_of_the_frost_witch_1:67.90%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your Physical and Frost abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 68.9 400.6 4.4s 0.6s 3.7s 83.89% 100.00% 58.8 (58.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 25.0s
  • trigger_min/max:0.0s / 7.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.6s
  • uptime_min/max:78.47% / 89.42%

Stack Uptimes

  • maelstrom_weapon_1:9.83%
  • maelstrom_weapon_2:10.50%
  • maelstrom_weapon_3:11.48%
  • maelstrom_weapon_4:11.98%
  • maelstrom_weapon_5:9.96%
  • maelstrom_weapon_6:7.30%
  • maelstrom_weapon_7:5.08%
  • maelstrom_weapon_8:3.74%
  • maelstrom_weapon_9:2.85%
  • maelstrom_weapon_10:11.18%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.9s 45.5s 16.5s 23.68% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 213.8s
  • trigger_min/max:0.0s / 206.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 72.6s
  • uptime_min/max:4.68% / 61.28%

Stack Uptimes

  • sophic_devotion_1:23.68%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.5s 45.8s 32.2s 38.06% 0.00% 25.6 (25.6) 3.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 240.6s
  • trigger_min/max:0.0s / 203.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 214.1s
  • uptime_min/max:7.72% / 89.48%

Stack Uptimes

  • spiraling_winds_1:2.34%
  • spiraling_winds_2:2.31%
  • spiraling_winds_3:2.29%
  • spiraling_winds_4:2.27%
  • spiraling_winds_5:2.26%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.23%
  • spiraling_winds_8:2.22%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.70%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Stormbringer 52.8 15.2 5.6s 4.4s 1.1s 19.38% 57.78% 15.2 (15.2) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 73.4s
  • trigger_min/max:0.0s / 73.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.1s
  • uptime_min/max:9.39% / 34.60%

Stack Uptimes

  • stormbringer_1:19.38%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.4 36.0 66.0 18.0s 15.0s 53.5s
Windfury-ForcefulWinds: 2 50.5 33.0 66.0 18.2s 0.4s 68.3s
Windfury-ForcefulWinds: 3 48.3 30.0 66.0 19.0s 1.1s 84.4s
Windfury-ForcefulWinds: 4 43.8 21.0 63.0 20.9s 0.5s 92.7s
Windfury-ForcefulWinds: 5 181.7 84.0 300.0 5.0s 0.0s 89.9s
Windfury (Main Hand) 26.9 9.0 49.0 10.9s 1.3s 122.9s
Windfury (Off Hand) 26.9 9.0 48.0 10.9s 1.3s 159.1s
Windfury: Unruly Winds 125.3 78.0 176.0 2.5s 0.0s 43.0s
Stormflurry 30.3 6.0 64.0 9.5s 0.0s 185.5s
Flametongue: Windfury Attack 375.8 234.0 528.0 2.5s 0.0s 43.0s
Stormbringer: Windfury Attack 38.5 12.0 67.0 8.6s 0.0s 117.6s
Flametongue: main_hand 161.7 112.0 214.0 2.2s 1.3s 17.5s
Windfury: main_hand 61.1 31.0 96.0 5.3s 1.3s 76.4s
Flametongue: offhand 162.0 108.0 212.0 2.2s 1.3s 19.0s
Flametongue: Doom Winds 3.7 3.0 4.0 90.4s 90.0s 92.4s
Windfury: Doom Winds 3.7 3.0 4.0 90.4s 90.0s 92.4s
Flametongue: Lava Lash 20.0 13.0 27.0 14.7s 8.8s 54.6s
Stormbringer: Lava Lash 2.0 0.0 8.0 77.4s 8.8s 338.5s
Flametongue: Sundering 6.0 3.0 8.0 50.5s 40.0s 155.6s
Stormbringer: Sundering 0.6 0.0 4.0 114.5s 40.0s 320.3s
Windfury: Sundering 1.8 0.0 7.0 94.6s 40.0s 339.8s
Flametongue: Ice Strike 21.5 15.0 28.0 13.8s 8.7s 39.6s
Stormbringer: Ice Strike 2.2 0.0 9.0 75.9s 8.7s 329.1s
Windfury: Ice Strike 7.2 0.0 16.0 38.4s 8.7s 279.9s
Flametongue: Stormstrike 121.1 70.0 184.0 2.5s 0.0s 22.9s
Stormbringer: Stormstrike 12.4 1.0 30.0 22.3s 0.1s 250.2s
Windfury: Stormstrike 51.4 23.0 85.0 5.8s 0.0s 84.4s
Flametongue: Stormstrike Off-Hand 121.1 70.0 184.0 2.5s 0.0s 22.9s
Stormbringer: Stormstrike Off-Hand 12.3 1.0 32.0 22.4s 0.1s 253.7s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 36.51% 22.43% 45.20% 0.6s 0.0s 5.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike
Stormstrike		1.3170.0007.642120.08370.469174.319
Feral Spirit0.7870.0001.48812.2132.80520.655
Doom Winds0.5480.0002.3922.0480.8646.142
Lava Lash3.2720.00042.25966.28323.278124.960
Sundering12.0480.000115.58075.11815.433180.936
Ice Strike2.2620.00027.38649.11416.35294.084
Frost Shock15.4540.000220.895232.543151.510324.938
Flame Shock24.3630.000277.644255.440177.950349.260
Earth Elemental32.4340.000315.25037.49010.393315.250

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack73.716.514.88%28.02%
main_hand34.64.16.98%7.04%
offhand34.54.46.96%7.50%
Feral Spirit76.19.315.37%15.85%
Doom Winds0.80.10.17%0.11%
Lightning Bolt98.20.019.82%0.00%
Lava Lash24.80.05.01%0.00%
Sundering1.40.00.29%0.00%
Ice Strike26.70.05.39%0.00%
Stormstrike75.914.915.32%25.38%
Stormstrike (_mh)24.44.64.93%7.90%
Stormstrike Off-Hand24.24.84.88%8.21%
Overflow Stacks0.058.80.00%10.61%
Actual Stacks495.30.089.39%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt491.2100.00%
Total Spent491.2100.00%
Casts per Maelstrom Weapon Stack Consumed
Ability 0 1 2 3 4 5 6 7 8 9 10
Lightning Bolt          18.39 13.37 9.02 6.24 4.57 16.48
Total           18.39
(27.01%)		 13.37
(19.64%)		 9.02
(13.25%)		 6.24
(9.17%)		 4.57
(6.72%)		 16.48
(24.21%)

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
Mana RegenMana650.02202739.17100.00%311.89564284.9873.57%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 270980.0 0.00 864.76 0.0 11553.1 -459565.5 270980.0
Mana 250000.0 675.80 677.42 564284.1 249515.1 247000.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.001000.000.49%1000.001000.000.00
Flame ShockMana 9.547154.653.52%750.00242.0564.17
Frost ShockMana 14.227107.853.50%500.00499.9740.81
Ice StrikeMana 21.5335531.8617.48%1650.001649.9915.84
Lava LashMana 20.028007.473.94%400.00400.0066.07
Lightning BoltMana 68.0734037.0616.75%500.00500.01121.39
StormstrikeMana 90.7890782.0344.67%1000.001000.0032.12
SunderingMana 6.0118038.398.88%3000.002999.9316.14
Windfury TotemMana 3.091564.690.77%506.99506.980.00

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 49828.66
Minimum 41686.67
Maximum 60429.91
Spread ( max - min ) 18743.24
Range [ ( max - min ) / 2 * 100% ] 18.81%
Standard Deviation 2328.7550
5th Percentile 46133.40
95th Percentile 53745.06
( 95th Percentile - 5th Percentile ) 7611.66
Mean Distribution
Standard Deviation 26.8919
95.00% Confidence Interval ( 49775.95 - 49881.36 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 84
0.1% Error 8391
0.1 Scale Factor Error with Delta=300 46295
0.05 Scale Factor Error with Delta=300 185179
0.01 Scale Factor Error with Delta=300 4629470
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 49828.66
Minimum 41686.67
Maximum 60429.91
Spread ( max - min ) 18743.24
Range [ ( max - min ) / 2 * 100% ] 18.81%
Standard Deviation 2328.7550
5th Percentile 46133.40
95th Percentile 53745.06
( 95th Percentile - 5th Percentile ) 7611.66
Mean Distribution
Standard Deviation 26.8919
95.00% Confidence Interval ( 49775.95 - 49881.36 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 84
0.1% Error 8391
0.1 Scale Factor Error with Delta=300 46295
0.05 Scale Factor Error with Delta=300 185179
0.01 Scale Factor Error with Delta=300 4629470
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 49828.66
Minimum 41686.67
Maximum 60429.91
Spread ( max - min ) 18743.24
Range [ ( max - min ) / 2 * 100% ] 18.81%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 14000039.21
Minimum 10023426.66
Maximum 19028840.22
Spread ( max - min ) 9005413.56
Range [ ( max - min ) / 2 * 100% ] 32.16%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 863.69
Minimum 0.00
Maximum 2198.09
Spread ( max - min ) 2198.09
Range [ ( max - min ) / 2 * 100% ] 127.25%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
0.00 primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
G 15.50 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
H 3.73 doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
J 0.00 call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
K 0.00 call_action_list,name=funnel,if=active_enemies>1&rotation.funnel
actions.single
# count action,conditions
0.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
L 57.33 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
0.00 lava_lash,if=buff.hot_hand.up
M 1.49 windfury_totem,if=!buff.windfury_totem.up
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
N 68.07 lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
0.00 primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
O 1.60 flame_shock,if=!ticking
0.00 ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
0.00 lava_lash,if=talent.lashing_flames.enabled
P 20.49 ice_strike,if=!buff.ice_strike.up
0.00 frost_shock,if=buff.hailstorm.up
Q 20.02 lava_lash
R 1.05 ice_strike
0.00 windstrike
S 33.45 stormstrike
T 6.01 sundering,if=raid_event.adds.in>=action.sundering.cooldown
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
0.00 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
U 14.22 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
V 1.11 earth_elemental
W 7.94 flame_shock
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
X 0.60 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGHLLLNLNLNLLNNGOPQNSTUNLVUPNQSNUWSLNPQSUWSGNNNPQNSUWSLNGPQSNNSTUWNNNPNGQSNUWSNNHLLLLLGNPNNQSLNSLLLGNNNMPQNSLGNNSNPQTLNSUWNSLGNPQNSUWNSLLLNPQSUWSLGLLEFLHNLLLLNLLNNOGPQNSNSTUWNPQNSUWXNNSGPLNQLUNNSUPLNQGNSLNTPUNQSUWNSPNSQNUGSNHLLLLLLNPLLLGNOQNNPSLLN

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 250000.0/250000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 2 augmentation PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 3 windfury_weapon PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 4 flametongue_weapon PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 6 windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
0:00.000 default B bloodlust Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), corrupting_rage
0:00.000 default C potion Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage
0:00.000 default D auto_attack Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(2), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default F berserking PR_Shaman_Enhancement 249000.0/250000: 100% mana bloodlust, flurry(2), crumbling_power(20), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, berserking, flurry(2), crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:00.867 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:01.732 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), doom_winds, crumbling_power(18), corrupting_rage, elemental_potion_of_ultimate_power
0:02.600 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds, crumbling_power(17), corrupting_rage, elemental_potion_of_ultimate_power
0:03.466 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(16), corrupting_rage, elemental_potion_of_ultimate_power
0:04.333 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(15), corrupting_rage, elemental_potion_of_ultimate_power
0:05.200 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), doom_winds, legacy_of_the_frost_witch, crumbling_power(14), corrupting_rage, elemental_potion_of_ultimate_power
0:06.066 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), doom_winds, legacy_of_the_frost_witch, crumbling_power(13), spiraling_winds, corrupting_rage, elemental_potion_of_ultimate_power
0:06.932 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, legacy_of_the_frost_witch, crumbling_power(12), spiraling_winds, corrupting_rage, elemental_potion_of_ultimate_power
0:07.799 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), doom_winds, legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds(2), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:08.666 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds(2), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:09.530 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(3), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:10.397 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(3), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:11.262 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(3), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:12.128 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(4), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:13.081 single O flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(4), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:14.035 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(5), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:14.989 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), spiraling_winds(5), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:15.943 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(2), spiraling_winds(6), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:16.896 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power, spiraling_winds(6), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:17.849 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:18.802 single U frost_shock Fluffy_Pillow 249439.7/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:19.755 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:20.708 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:21.661 single V earth_elemental Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), spiraling_winds(9), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:22.615 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(9), corrupting_rage, elemental_potion_of_ultimate_power
0:23.569 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(10), corrupting_rage, elemental_potion_of_ultimate_power
0:24.523 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(10), corrupting_rage, elemental_potion_of_ultimate_power
0:25.476 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage, elemental_potion_of_ultimate_power
0:26.428 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage, elemental_potion_of_ultimate_power
0:27.380 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds(5), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage, elemental_potion_of_ultimate_power
0:28.333 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage, elemental_potion_of_ultimate_power
0:29.286 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage, elemental_potion_of_ultimate_power
0:30.238 Waiting     0.801s 250000.0/250000: 100% mana bloodlust, forceful_winds(5), maelstrom_weapon(2), spiraling_winds(10), corrupting_rage
0:31.039 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, forceful_winds(5), maelstrom_weapon(2), corrupting_rage
0:32.126 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds, stormbringer, maelstrom_weapon(4), corrupting_rage
0:33.080 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds, maelstrom_weapon(6), corrupting_rage
0:34.034 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds, legacy_of_the_frost_witch, corrupting_rage
0:34.988 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:35.942 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:36.896 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:37.851 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
0:38.803 Waiting     1.863s 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds, maelstrom_weapon(3), corrupting_rage
0:40.666 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds, maelstrom_weapon(3), corrupting_rage
0:42.027 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(6), corrupting_rage
0:43.265 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), corrupting_rage
0:44.502 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, corrupting_rage
0:45.741 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, corrupting_rage
0:46.979 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, corrupting_rage
0:48.215 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:49.453 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
0:50.691 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), corrupting_rage
0:51.930 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), corrupting_rage
0:53.170 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(3), corrupting_rage
0:54.409 Waiting     2.259s 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(4), corrupting_rage
0:56.668 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(5), corrupting_rage
0:58.099 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds, stormbringer, maelstrom_weapon(9), spiraling_winds(5), corrupting_rage
0:59.337 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(10), spiraling_winds(6), corrupting_rage
1:00.574 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds, legacy_of_the_frost_witch, spiraling_winds(7), corrupting_rage
1:01.812 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(7), corrupting_rage
1:03.052 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), corrupting_rage
1:04.289 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), corrupting_rage
1:05.528 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(9), corrupting_rage
1:06.766 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
1:08.002 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
1:09.240 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
1:10.480 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
1:11.720 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(10), corrupting_rage
1:12.958 Waiting     0.097s 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
1:13.055 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(10), corrupting_rage
1:14.295 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, corrupting_rage
1:15.533 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, corrupting_rage
1:16.773 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
1:18.011 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:19.249 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:20.487 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:21.727 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:22.965 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:24.204 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, corrupting_rage
1:25.442 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, forgestorm_ignited, corrupting_rage
1:26.680 Waiting     1.064s 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, forgestorm_ignited, corrupting_rage
1:27.744 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, forgestorm_ignited, corrupting_rage
1:29.135 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), forgestorm_ignited, corrupting_rage
1:30.372 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:31.610 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:32.847 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), doom_winds, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:34.085 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:35.324 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, forgestorm_ignited, corrupting_rage
1:36.564 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, forgestorm_ignited, corrupting_rage
1:37.802 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, forgestorm_ignited, corrupting_rage
1:39.040 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(10), doom_winds, forgestorm_ignited, corrupting_rage
1:40.279 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), forgestorm_ignited, corrupting_rage
1:41.517 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:42.756 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:43.996 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:45.234 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:46.472 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:47.712 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:48.952 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), ice_strike, corrupting_rage
1:50.189 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:51.428 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:52.666 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:53.904 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, corrupting_rage
1:55.143 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(10), corrupting_rage
1:56.383 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), corrupting_rage
1:57.622 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch
1:58.862 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch
2:00.101 single M windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch
2:00.927 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch
2:02.167 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch
2:03.405 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch
2:04.643 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch
2:05.882 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch
2:07.122 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch
2:08.361 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(4), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch
2:09.598 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(4), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch
2:10.836 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch
2:12.076 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:13.314 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:14.553 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:15.791 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), ice_strike, sophic_devotion, corrupting_rage
2:17.031 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, corrupting_rage
2:18.269 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, sophic_devotion, corrupting_rage
2:19.507 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:20.748 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:21.985 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:23.223 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:24.462 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:25.701 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion
2:26.939 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion
2:28.359 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), sophic_devotion
2:29.598 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, sophic_devotion
2:30.837 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, sophic_devotion
2:32.075 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike
2:33.313 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch
2:34.552 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch
2:35.790 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch
2:37.027 Waiting     0.693s 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch
2:37.720 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5)
2:38.959 Waiting     0.294s 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2)
2:39.253 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon
2:40.723 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(5), corrupting_rage
2:41.961 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(7)
2:43.198 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(9)
2:44.436 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(10)
2:45.675 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds
2:46.913 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2)
2:48.153 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2)
2:49.392 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3)
2:50.630 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(5), maelstrom_weapon(4), spiraling_winds(4)
2:51.866 Waiting     2.276s 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(4), spiraling_winds(4)
2:54.142 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(4), spiraling_winds(5)
2:55.562 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds, stormbringer, maelstrom_weapon(7), spiraling_winds(6)
2:56.799 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, stormbringer, maelstrom_weapon(10), spiraling_winds(7), corrupting_rage
2:58.039 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(7), corrupting_rage
2:59.279 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(8), corrupting_rage
3:00.518 default E use_item_irideus_fragment Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(9), corrupting_rage
3:00.518 default F berserking PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), crumbling_power(20), spiraling_winds(9), corrupting_rage
3:00.518 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), crumbling_power(19), spiraling_winds(9), corrupting_rage
3:01.644 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), crumbling_power(19), spiraling_winds(9), corrupting_rage
3:02.767 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(18), spiraling_winds(10), corrupting_rage
3:03.892 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, crumbling_power(17), spiraling_winds(10), corrupting_rage
3:05.017 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, legacy_of_the_frost_witch, crumbling_power(16), spiraling_winds(10), corrupting_rage
3:06.142 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, legacy_of_the_frost_witch, crumbling_power(15), spiraling_winds(10), corrupting_rage
3:07.267 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, crumbling_power(14), spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:08.392 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(13), spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:09.516 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, crumbling_power(12), forgestorm_ignited, corrupting_rage
3:10.642 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, crumbling_power(11), forgestorm_ignited, corrupting_rage
3:11.768 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, crumbling_power(10), forgestorm_ignited, corrupting_rage
3:12.893 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(7), legacy_of_the_frost_witch, crumbling_power(9), forgestorm_ignited, corrupting_rage
3:14.131 single O flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds, maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power(8), forgestorm_ignited, corrupting_rage
3:15.370 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(7), forgestorm_ignited, corrupting_rage
3:16.608 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, crumbling_power(6), forgestorm_ignited, corrupting_rage
3:17.848 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds, forgestorm_ignited, corrupting_rage
3:19.088 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), ice_strike, crumbling_power(4), spiraling_winds(2), forgestorm_ignited, corrupting_rage
3:20.327 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, crumbling_power(3), spiraling_winds(2), forgestorm_ignited, corrupting_rage
3:21.565 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(3), forgestorm_ignited, corrupting_rage
3:22.804 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, corrupting_rage
3:24.043 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), corrupting_rage
3:25.281 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), corrupting_rage
3:26.520 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(5), corrupting_rage
3:27.757 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(6), corrupting_rage
3:28.996 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(2), spiraling_winds(7), corrupting_rage
3:30.234 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, spiraling_winds(7), corrupting_rage
3:31.473 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(5), ice_strike, spiraling_winds(8), corrupting_rage
3:32.712 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, corrupting_rage
3:33.949 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, corrupting_rage
3:35.187 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:36.424 single X windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:37.251 Waiting     1.274s 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(3), spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:38.525 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:39.762 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:41.000 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, corrupting_rage
3:42.236 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(3), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:43.477 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
3:44.715 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:45.953 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), ice_strike, corrupting_rage
3:47.192 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:48.431 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:49.671 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:50.909 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, corrupting_rage
3:52.147 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), corrupting_rage
3:53.387 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, corrupting_rage
3:54.624 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, corrupting_rage
3:55.863 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, corrupting_rage
3:57.100 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:58.338 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(10), ice_strike, corrupting_rage
3:59.576 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:00.814 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(3), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:02.051 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:03.289 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:04.527 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:05.765 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:07.002 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:08.240 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), sophic_devotion, corrupting_rage
4:09.478 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, sophic_devotion, corrupting_rage
4:10.716 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), sophic_devotion, corrupting_rage
4:11.953 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:13.191 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:14.430 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:15.667 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:16.904 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(5), sophic_devotion, corrupting_rage
4:18.143 Waiting     1.065s 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon, sophic_devotion, corrupting_rage
4:19.208 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon, sophic_devotion, corrupting_rage
4:20.599 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(3), maelstrom_weapon(4), sophic_devotion, corrupting_rage
4:21.839 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(5), ice_strike, sophic_devotion, corrupting_rage
4:23.078 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:24.315 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(3), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:25.554 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:26.792 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:28.032 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(4), maelstrom_weapon(2), corrupting_rage
4:29.269 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), corrupting_rage
4:30.508 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), corrupting_rage
4:31.747 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
4:32.985 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), doom_winds, legacy_of_the_frost_witch, spiraling_winds, corrupting_rage
4:34.225 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, legacy_of_the_frost_witch, spiraling_winds(2), corrupting_rage
4:35.463 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, corrupting_rage
4:36.704 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds, spiraling_winds(4), sophic_devotion, corrupting_rage
4:37.940 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, spiraling_winds(4), sophic_devotion, corrupting_rage
4:39.177 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, spiraling_winds(5), sophic_devotion, corrupting_rage
4:40.415 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(6), sophic_devotion, corrupting_rage
4:41.652 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, corrupting_rage
4:42.891 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage
4:44.129 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, corrupting_rage
4:45.367 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, corrupting_rage
4:46.605 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(10), ice_strike, spiraling_winds(9), sophic_devotion, corrupting_rage
4:47.845 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(9), sophic_devotion, corrupting_rage
4:49.084 single O flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
4:50.323 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
4:51.562 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
4:52.800 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
4:54.039 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
4:55.277 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
4:56.516 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
4:57.755 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
4:58.994 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 250000 250000 0
Spell Power 6635 6149 0
Crit 21.84% 15.63% 1013
Haste 21.55% 21.55% 3663
Versatility 3.93% 0.93% 191
Mana Regen 2560 2560 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [16]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [29]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQJJSIAAAAAAAAAAAAgSESCJkioQSDAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
actions+=/primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
actions+=/call_action_list,name=funnel,if=active_enemies>1&rotation.funnel

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.funnel=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.funnel+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.funnel+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/windstrike,if=(talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1)|buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/stormstrike,if=buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&buff.crackling_thunder.up
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)|(talent.converging_storms.enabled&buff.converging_storms.stack<buff.converging_storms.max_stack)
actions.funnel+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.funnel+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.funnel+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.funnel+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.funnel+=/sundering
actions.funnel+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.funnel+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=3
actions.funnel+=/stormstrike,if=buff.crash_lightning.up&talent.deeply_rooted_elements.enabled
actions.funnel+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.funnel+=/windstrike
actions.funnel+=/stormstrike
actions.funnel+=/ice_strike
actions.funnel+=/lava_lash
actions.funnel+=/crash_lightning
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=2
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5
actions.funnel+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.funnel+=/flame_shock,if=!ticking
actions.funnel+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
actions.single+=/primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
actions.single+=/lava_lash,if=talent.lashing_flames.enabled
actions.single+=/ice_strike,if=!buff.ice_strike.up
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/ice_strike
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=action.sundering.cooldown
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Ele : 59261 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
59260.8 59260.8 55.3 / 0.093% 9496.4 / 16.0% 107.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
525.5 524.3 Mana 0.32% 53.6 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkESSSDlEAAAAAAAAAAAAAKRIJkQKiCJNAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Ele 59261
Elemental Blast 11363 19.2% 24.8 12.22s 137465 120053 Direct 24.8 113573 227429 137516 21.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.78 24.77 0.00 0.00 0.00 1.1451 0.0000 3406130.76 3406130.76 0.00% 120052.54 120052.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.97% 19.56 10 29 113572.51 46821 264053 113580.49 91491 136089 2221551 2221551 0.00%
crit 21.03% 5.21 0 14 227429.34 93643 515709 226605.51 0 408459 1184579 1184579 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:0.29
  • if_expr:buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
    single
    [O]:6.39
  • if_expr:buff.maelstrom_weapon.stack>=5&charges=max_charges
    single
    [Q]:18.09
  • if_expr:buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Resource Cost 2Enhancement Shaman13704112PCT-1.000
Spell Direct AmountEnhancement Shaman13704122PCT-0.090
Spell Direct AmountEnhancement Shaman13704123PCT0.100
Spell Direct AmountFire and Ice3828861PCT0.030
Flame Shock 5862 9.9% 90.2 3.33s 19483 152760 Direct 90.2 7008 14031 8532 21.7% 0.0%
Periodic 195.9 4143 8301 5041 21.6% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.19 90.19 195.93 195.93 89.19 0.1275 1.5217 1757196.92 1757196.92 0.00% 5674.86 152759.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.30% 70.62 43 105 7007.75 3928 17647 7008.18 6117 8170 494889 494889 0.00%
crit 21.70% 19.57 3 39 14031.40 7856 35459 14030.41 11336 18643 274587 274587 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 78.39% 153.59 110 198 4142.95 2271 10498 4143.08 3611 4715 636326 636326 0.00%
crit 21.61% 42.33 17 72 8300.96 4542 20713 8301.53 7101 10457 351396 351396 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Volcanic damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Volcanic damage and then an additional {$=}o2 Volcanic damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Volcanic damage and knocking them into the air.]

Action Priority List

    single
    [a]:9.73

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Spell Periodic AmountFire and Ice3828862PCT0.030
Flametongue Weapon 0 (969) 0.0% (1.6%) 1.0 0.00s 290399 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFire and Ice3828861PCT0.030
    Flametongue Attack 969 1.6% 610.0 0.74s 476 0 Direct 610.0 391 783 476 21.6% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 610.04 610.04 0.00 0.00 0.00 0.0000 0.0000 290398.76 290398.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.38% 478.13 341 624 391.20 297 1035 391.24 342 451 187042 187042 0.00%
crit 21.62% 131.92 80 202 783.49 594 2000 783.62 659 924 103357 103357 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Forgestorm Ignited (_damage) 1266 2.1% 28.9 7.63s 13156 0 Direct 28.9 10809 21617 13156 21.7% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.87 28.87 0.00 0.00 0.00 0.0000 0.0000 379847.78 379847.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.28% 22.60 3 63 10808.51 10705 11241 10800.32 10705 11196 244279 244279 0.00%
crit 21.72% 6.27 0 21 21616.66 21411 22481 21408.96 0 22481 135569 135569 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 6494 11.0% 42.8 6.94s 45438 39824 Direct 42.8 37317 74641 45437 21.8% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.84 42.84 0.00 0.00 0.00 1.1410 0.0000 1946573.20 1946573.20 0.00% 39824.33 39824.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.24% 33.52 17 51 37317.13 7863 118777 37375.21 28684 47269 1250869 1250869 0.00%
crit 21.76% 9.32 1 22 74640.83 15726 218377 74810.42 32448 145568 695704 695704 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [V]:42.58
  • if_expr:buff.hailstorm.up
    single
    [Y]:0.26

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownEnhancement Shaman1370417ADD6000.000
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Ice Strike 2406 4.1% 24.1 12.55s 29874 26183 Direct 24.1 24491 49205 29873 21.8% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.14 24.14 0.00 0.00 0.00 1.1410 0.0000 721010.09 721010.09 0.00% 26183.32 26183.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.22% 18.88 10 27 24490.67 18491 52323 24496.64 20779 29584 462355 462355 0.00%
crit 21.78% 5.26 0 13 49204.87 36982 104647 49003.33 0 87952 258655 258655 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [T]:24.14
  • if_expr:talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Lava Lash 12574 21.2% 73.5 4.05s 51292 45011 Direct 73.5 (73.5) 42198 84351 51292 21.6% (21.6%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 73.49 73.49 0.00 0.00 0.00 1.1396 0.0000 3769267.49 3769267.49 0.00% 45011.02 45011.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.43% 57.63 27 96 42198.41 21811 127713 42191.08 35894 50367 2431942 2431942 0.00%
crit 21.57% 15.85 1 33 84351.34 43621 220526 84360.48 64870 111784 1337326 1337326 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [M]:48.34
  • if_expr:buff.hot_hand.up
    single
    [U]:25.14
  • if_expr:talent.lashing_flames.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownMolten Assault3340331ADD-6000.000
Spell Direct AmountFire and Ice3828861PCT0.030
Lightning Bolt 6051 10.2% 28.7 10.36s 63278 53740 Direct 28.7 52026 104251 63278 21.5% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.66 28.66 0.00 0.00 0.00 1.1775 0.0000 1813574.00 1813574.00 0.00% 53740.30 53740.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.45% 22.49 11 35 52025.50 29583 130069 52069.67 43527 63098 1169831 1169831 0.00%
crit 21.55% 6.18 0 17 104251.37 59166 255697 104344.82 0 191673 643743 643743 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.91

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [P]:6.93
  • if_expr:buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [R]:12.43
  • if_expr:((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
    single
    [X]:9.30
  • if_expr:talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
main_hand 1811 3.1% 194.0 1.80s 2799 1607 Direct 194.0 2660 5319 2799 21.6% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.97 193.97 0.00 0.00 0.00 1.7417 0.0000 542819.61 775476.36 30.00% 1606.75 1606.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.01% 120.28 78 167 2659.52 2257 4253 2659.44 2440 2978 319893 457002 30.00%
crit 21.61% 41.91 18 70 5319.17 4513 8587 5319.33 4762 6250 222927 318475 30.00%
miss 16.38% 31.78 12 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 928 1.6% 198.2 1.76s 1404 807 Direct 198.2 1333 2669 1404 21.7% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 198.18 198.18 0.00 0.00 0.00 1.7387 0.0000 278248.11 397507.43 30.00% 807.48 807.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.97% 122.82 81 173 1332.88 1128 2151 1332.90 1227 1472 163699 233861 30.00%
crit 21.66% 42.92 21 72 2668.59 2257 4244 2668.60 2401 3024 114549 163646 30.00%
miss 16.37% 32.44 13 61 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 0 (3750) 0.0% (6.3%) 7.0 46.16s 160852 134485

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 0.00 0.00 0.00 0.00 1.1961 0.0000 0.00 0.00 0.00% 134485.48 134485.48

Action Details: Primordial Wave

  • id:375982
  • school:elemental
  • range:40.0
  • travel_speed:34.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:elemental
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:1.00
  • if_expr:!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
    single
    [S]:5.98
  • if_expr:raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
    Primordial Wave (_damage) 1105 1.9% 7.0 46.16s 47383 0 Direct 7.0 38961 77896 47383 21.6% 0.0%

Stats Details: Primordial Wave Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 0.00 0.0000 0.0000 330702.45 330702.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.37% 5.47 0 8 38961.45 31064 60101 38977.30 0 54935 213107 213107 0.00%
crit 21.63% 1.51 0 6 77895.73 62128 119044 63991.97 0 119044 117596 117596 0.00%

Action Details: Primordial Wave Damage

  • id:375984
  • school:elemental
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:6.00

Spelldata

  • id:375984
  • name:Primordial Wave
  • school:elemental
  • tooltip:
  • description:{$@spelldesc375982=Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman13704121PCT5.000
    Lightning Bolt (_pw) 2645 4.5% 6.9 45.75s 114293 0 Direct 6.9 93846 187495 114300 21.8% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 0.00 0.0000 0.0000 792385.83 792385.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.16% 5.42 1 8 93846.16 59166 191773 93872.18 65740 154813 508553 508553 0.00%
crit 21.84% 1.51 0 7 187494.90 118331 371947 152605.76 0 371947 283833 283833 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.91

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
Stormstrike 0 (1899) 0.0% (3.2%) 32.4 9.11s 17578 15367

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.39 0.00 0.00 0.00 0.00 1.1438 0.0000 0.00 0.00 0.00% 15367.41 15367.41

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [W]:32.39

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
    Stormstrike (_mh) 1266 2.1% 32.4 9.11s 11721 0 Direct 32.4 9628 19288 11721 21.7% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.39 32.39 0.00 0.00 0.00 0.0000 0.0000 379661.19 542386.96 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.33% 25.37 11 44 9628.02 8138 15312 9628.28 8480 10854 244293 348999 30.00%
crit 21.67% 7.02 0 19 19287.70 16276 30624 19261.94 0 27128 135368 193387 29.97%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
    Stormstrike Off-Hand 633 1.1% 32.4 9.11s 5857 0 Direct 32.4 4815 9637 5856 21.6% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.39 32.39 0.00 0.00 0.00 0.0000 0.0000 189701.53 271009.10 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.40% 25.39 9 43 4814.95 4069 7656 4815.04 4342 5516 122276 174684 30.00%
crit 21.60% 7.00 0 17 9637.06 8138 15312 9627.59 0 13641 67426 96325 29.98%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
Windfury Weapon 0 (901) 0.0% (1.5%) 1.0 0.00s 270189 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 901 1.5% 119.7 5.15s 2257 0 Direct 119.7 1856 3715 2257 21.6% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.71 119.71 0.00 0.00 0.00 0.0000 0.0000 270189.01 385994.14 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.41% 93.86 50 151 1855.61 1565 3028 1855.79 1656 2131 174172 248824 30.00%
crit 21.59% 25.85 7 53 3714.96 3130 5997 3714.73 3208 4459 96017 137170 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
pet - greater_earth_elemental 500 / 107
melee 500 0.2% 44.2 2.53s 721 508 Direct 44.2 593 1187 721 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.22 44.22 0.00 0.00 0.00 1.4203 0.0000 31877.02 45539.75 30.00% 507.56 507.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.42% 34.68 20 64 592.62 488 905 590.23 488 756 20549 29357 30.00%
crit 21.58% 9.54 1 25 1186.85 976 1810 1181.70 976 1562 11328 16183 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2464 / 957
melee 2464 1.6% 119.8 2.69s 2390 2142 Direct 119.8 1964 3935 2390 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.84 119.84 0.00 0.00 0.00 1.1156 0.0000 286381.87 409127.39 30.00% 2142.02 2142.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.40% 93.96 6 206 1963.95 1630 3124 1961.60 1630 2435 184525 263614 30.00%
crit 21.60% 25.89 3 62 3934.67 3260 6247 3930.05 3260 5220 101857 145514 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2465 / 962
melee 2465 1.6% 120.5 2.68s 2390 2142 Direct 120.5 1964 3937 2390 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.55 120.55 0.00 0.00 0.00 1.1159 0.0000 288099.80 411581.64 30.00% 2141.66 2141.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.41% 94.52 11 218 1963.95 1630 3124 1962.02 1630 2408 185630 265193 30.00%
crit 21.59% 26.03 3 70 3936.52 3260 6247 3932.09 3260 4941 102470 146389 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2467 / 964
melee 2467 1.6% 120.8 2.67s 2389 2139 Direct 120.8 1963 3933 2389 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.79 120.79 0.00 0.00 0.00 1.1167 0.0000 288577.79 412264.49 30.00% 2139.31 2139.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.36% 94.65 12 202 1962.64 1630 3160 1960.85 1630 2385 185760 265378 30.00%
crit 21.64% 26.14 1 66 3932.61 3260 6321 3928.32 3260 4917 102818 146887 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Ele
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.2 311.33s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.20 0.00 0.00 0.00 0.00 0.9281 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Z]:1.20
Feral Spirit 14.4 22.13s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.36 0.00 0.00 0.00 0.00 1.1345 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:14.36

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 303.43s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 3.0 117.33s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.00 0.5479 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Action Priority List

    single
    [N]:1.67
  • if_expr:!buff.windfury_totem.up
    single
    [b]:0.37
  • if_expr:buff.windfury_totem.remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 73.0 122.9 4.1s 1.5s 3.3s 80.13% 98.33% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 15.8s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.9s
  • uptime_min/max:69.99% / 88.16%

Stack Uptimes

  • ashen_catalyst_1:33.57%
  • ashen_catalyst_2:18.11%
  • ashen_catalyst_3:12.75%
  • ashen_catalyst_4:10.17%
  • ashen_catalyst_5:4.27%
  • ashen_catalyst_6:0.99%
  • ashen_catalyst_7:0.23%
  • ashen_catalyst_8:0.04%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.2s 58.7s 50.4s 80.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 348.0s
  • trigger_min/max:15.0s / 309.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 349.5s
  • uptime_min/max:46.90% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.28%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Crackling Surge 8.0 0.0 37.1s 36.7s 15.0s 39.01% 43.91% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.7s / 308.2s
  • trigger_min/max:10.7s / 308.2s
  • trigger_pct:84.55%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:5.02% / 71.66%

Stack Uptimes

  • crackling_surge_1:31.18%
  • crackling_surge_2:7.80%
  • crackling_surge_3:0.02%
  • crackling_surge_4:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases Nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4s 5.3s 17.9s 12.06% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 165.7s
  • trigger_pct:100.00%
  • duration_min/max:15.2s / 20.0s
  • uptime_min/max:9.83% / 15.10%

Stack Uptimes

  • crumbling_power_1:0.42%
  • crumbling_power_2:0.63%
  • crumbling_power_3:0.65%
  • crumbling_power_4:0.64%
  • crumbling_power_5:0.63%
  • crumbling_power_6:0.62%
  • crumbling_power_7:0.62%
  • crumbling_power_8:0.61%
  • crumbling_power_9:0.59%
  • crumbling_power_10:0.60%
  • crumbling_power_11:0.61%
  • crumbling_power_12:0.64%
  • crumbling_power_13:0.66%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.68%
  • crumbling_power_16:0.69%
  • crumbling_power_17:0.69%
  • crumbling_power_18:0.70%
  • crumbling_power_19:0.70%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Elemental Blast: Critical Strike 8.3 0.0 35.1s 35.1s 9.8s 27.18% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 246.0s
  • trigger_min/max:10.0s / 246.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:5.83% / 52.26%

Stack Uptimes

  • elemental_blast_critical_strike_1:27.18%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 8.2 0.0 35.6s 35.6s 9.8s 26.81% 0.00% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 311.5s
  • trigger_min/max:10.0s / 311.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:6.61% / 49.72%

Stack Uptimes

  • elemental_blast_haste_1:26.81%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 8.3 0.0 35.0s 35.0s 9.8s 27.27% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 263.3s
  • trigger_min/max:10.0s / 263.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.51% / 50.90%

Stack Uptimes

  • elemental_blast_mastery_1:27.27%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.0s 303.5s 27.5s 13.45% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 314.3s
  • trigger_min/max:300.0s / 314.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.97% / 18.15%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.45%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 13.8 0.6 22.6s 22.1s 15.2s 70.03% 0.00% 56.8 (56.8) 13.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 45.6s
  • trigger_min/max:13.7s / 34.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:64.67% / 76.39%

Stack Uptimes

  • feral_spirit_1:70.03%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 44.5 281.7 6.8s 0.9s 5.6s 83.32% 89.81% 281.7 (617.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 63.7s
  • trigger_min/max:0.0s / 17.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 62.7s
  • uptime_min/max:71.41% / 92.81%

Stack Uptimes

  • flurry_1:21.73%
  • flurry_2:36.68%
  • flurry_3:24.91%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.4s 46.4s 12.9s 19.52% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 195.8s
  • trigger_min/max:0.2s / 195.8s
  • trigger_pct:98.79%
  • duration_min/max:0.0s / 47.0s
  • uptime_min/max:3.78% / 52.96%

Stack Uptimes

  • forgestorm_ignited_1:19.52%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 43.1 10.3 7.0s 5.6s 3.6s 51.94% 99.40% 10.3 (78.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 35.8s
  • trigger_min/max:1.1s / 16.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 31.5s
  • uptime_min/max:37.36% / 67.52%

Stack Uptimes

  • hailstorm_5:4.17%
  • hailstorm_6:3.89%
  • hailstorm_7:3.57%
  • hailstorm_8:10.55%
  • hailstorm_9:7.70%
  • hailstorm_10:22.05%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.6 5.8 27.6s 17.4s 9.9s 35.22% 86.35% 5.8 (5.8) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 217.2s
  • trigger_min/max:0.0s / 217.2s
  • trigger_pct:4.99%
  • duration_min/max:0.0s / 50.9s
  • uptime_min/max:10.31% / 63.34%

Stack Uptimes

  • hot_hand_1:35.22%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.1 0.0 12.6s 12.5s 3.4s 27.67% 55.48% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 31.7s
  • trigger_min/max:7.7s / 31.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.4s
  • uptime_min/max:16.60% / 42.18%

Stack Uptimes

  • ice_strike_1:27.67%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 8.0 0.0 37.2s 36.9s 15.0s 38.84% 100.00% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.4s / 254.6s
  • trigger_min/max:11.4s / 249.0s
  • trigger_pct:84.60%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:5.93% / 72.35%

Stack Uptimes

  • icy_edge_1:31.08%
  • icy_edge_2:7.74%
  • icy_edge_3:0.02%
  • icy_edge_4:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases Frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 54.3 379.0 5.6s 0.7s 4.6s 83.99% 100.00% 28.3 (41.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 16.3s
  • trigger_min/max:0.0s / 7.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.3s
  • uptime_min/max:79.41% / 88.35%

Stack Uptimes

  • maelstrom_weapon_1:9.70%
  • maelstrom_weapon_2:9.97%
  • maelstrom_weapon_3:10.20%
  • maelstrom_weapon_4:10.15%
  • maelstrom_weapon_5:9.07%
  • maelstrom_weapon_6:8.13%
  • maelstrom_weapon_7:7.22%
  • maelstrom_weapon_8:6.32%
  • maelstrom_weapon_9:4.16%
  • maelstrom_weapon_10:9.06%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 8.0 0.0 37.0s 36.6s 15.0s 39.07% 100.00% 0.0 (0.0) 7.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.3s / 243.9s
  • trigger_min/max:11.3s / 243.9s
  • trigger_pct:84.45%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:5.22% / 71.59%

Stack Uptimes

  • molten_weapon_1:31.16%
  • molten_weapon_2:7.89%
  • molten_weapon_3:0.02%
  • molten_weapon_4:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases Fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Wave 7.0 0.0 46.2s 46.2s 2.7s 6.28% 24.30% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 58.0s
  • trigger_min/max:45.0s / 58.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:3.09% / 15.63%

Stack Uptimes

  • primordial_wave_1:6.28%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Elemental damage and applying Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.2 61.0s 45.6s 16.5s 23.75% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 231.0s
  • trigger_min/max:0.0s / 222.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.3s
  • uptime_min/max:4.95% / 58.56%

Stack Uptimes

  • sophic_devotion_1:23.75%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.7s 45.4s 32.3s 38.61% 0.00% 26.1 (26.1) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 251.1s
  • trigger_min/max:0.0s / 210.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 179.5s
  • uptime_min/max:8.14% / 94.93%

Stack Uptimes

  • spiraling_winds_1:2.36%
  • spiraling_winds_2:2.33%
  • spiraling_winds_3:2.32%
  • spiraling_winds_4:2.30%
  • spiraling_winds_5:2.29%
  • spiraling_winds_6:2.27%
  • spiraling_winds_7:2.25%
  • spiraling_winds_8:2.24%
  • spiraling_winds_9:2.22%
  • spiraling_winds_10:18.04%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 6.9 0.0 45.8s 45.8s 11.8s 27.28% 31.08% 0.0 (0.0) 6.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:32.0s / 87.9s
  • trigger_min/max:32.0s / 87.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:21.89% / 29.87%

Stack Uptimes

  • splintered_elements_1:27.28%

Spelldata

  • id:354648
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc354647=Each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave increases your Haste by {$s1=10}% for {$354648d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 15.9 5.0 18.2s 13.7s 5.6s 29.47% 44.03% 5.0 (5.0) 1.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 182.4s
  • trigger_min/max:0.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.0s
  • uptime_min/max:5.66% / 59.89%

Stack Uptimes

  • stormbringer_1:29.47%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 26.8 9.0 51.0 10.9s 1.1s 132.4s
Windfury (Off Hand) 27.3 9.0 50.0 10.7s 1.1s 137.7s
Elemental Blast: Critical Strike 8.3 2.0 17.0 35.1s 10.0s 246.0s
Elemental Blast: Haste 8.2 2.0 16.0 35.6s 10.0s 311.5s
Elemental Blast: Mastery 8.3 1.0 18.0 35.0s 10.0s 263.3s
Maelstrom Weapon Swing Reset 6.9 5.0 8.0 45.8s 32.0s 87.9s
Flametongue: Windfury Attack 119.7 64.0 186.0 5.1s 0.0s 71.3s
Stormbringer: Windfury Attack 8.8 0.0 24.0 31.3s 0.0s 281.9s
Flametongue: main_hand 162.2 109.0 218.0 2.2s 1.1s 16.5s
Hot Hand: main_hand 8.1 0.0 21.0 32.9s 1.1s 290.0s
Windfury: main_hand 44.4 20.0 74.0 7.0s 1.1s 76.9s
Flametongue: offhand 165.7 119.0 226.0 2.2s 1.1s 17.7s
Hot Hand: offhand 8.3 0.0 21.0 32.3s 1.1s 283.2s
Flametongue: Lava Lash 73.5 43.0 113.0 4.1s 0.8s 15.3s
Stormbringer: Lava Lash 5.4 0.0 17.0 44.1s 0.8s 316.8s
Flametongue: Ice Strike 24.1 17.0 30.0 12.5s 7.7s 31.7s
Stormbringer: Ice Strike 1.8 0.0 9.0 82.7s 7.9s 341.9s
Windfury: Ice Strike 6.6 0.0 16.0 40.7s 7.8s 293.8s
Flametongue: Stormstrike 32.4 16.0 52.0 9.1s 0.8s 76.2s
Stormbringer: Stormstrike 2.4 0.0 11.0 68.8s 0.8s 335.2s
Windfury: Stormstrike 8.8 0.0 21.0 30.8s 0.8s 279.0s
Flametongue: Stormstrike Off-Hand 32.4 16.0 52.0 9.1s 0.8s 76.2s
Stormbringer: Stormstrike Off-Hand 2.4 0.0 10.0 68.7s 0.8s 318.7s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 42.57% 34.31% 49.58% 0.7s 0.0s 5.1s
Hot Hand 35.22% 10.31% 63.34% 9.9s 0.0s 50.9s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike
Stormstrike		3.8820.00050.983128.15261.829220.635
Primordial Wave1.1240.00012.9807.8750.98925.725
Feral Spirit0.7750.0001.49011.1514.06618.969
Lava Lash0.5750.0007.67042.37319.52668.030
Elemental Blast0.5080.00015.61812.6671.78739.993
Ice Strike1.2030.00019.22229.1906.93764.936
Frost Shock2.4260.00030.661104.94359.203163.020
Flame Shock23.8200.000258.062253.973168.511337.758
Earth Elemental19.0790.000201.23625.0116.152201.236

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack26.52.25.83%5.28%
main_hand35.53.47.82%8.14%
offhand36.63.38.06%7.85%
Primordial Wave50.119.711.03%47.06%
Feral Spirit76.76.416.88%15.19%
Lava Lash84.46.818.57%16.15%
Ice Strike54.00.111.89%0.16%
Frost Shock42.60.09.37%0.00%
Stormstrike32.30.17.12%0.16%
Stormstrike (_mh)7.80.01.71%0.00%
Stormstrike Off-Hand7.70.01.70%0.00%
Overflow Stacks0.041.80.00%8.43%
Actual Stacks454.30.091.57%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt234.252.04%
Elemental Blast215.947.96%
Total Spent450.1100.00%
Casts per Maelstrom Weapon Stack Consumed
Ability 0 1 2 3 4 5 6 7 8 9 10
Lightning Bolt          3.13 3.08 3.08 5.64 3.88 9.84
Elemental Blast          1.09 1.01 0.84 7.17 5.52 9.14
Total           4.22
(7.90%)		 4.10
(7.66%)		 3.93
(7.35%)		 12.81
(23.97%)		 9.41
(17.61%)		 18.98
(35.52%)

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Ele
Mana RegenMana630.35157298.36100.00%249.54609711.7879.49%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 270980.0 0.00 869.18 0.0 10226.4 -525978.7 270980.0
Mana 250000.0 524.33 525.52 609712.4 249641.7 248350.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement_Ele
BloodlustMana 1.001000.000.63%1000.001000.000.00
Flame ShockMana 9.737294.034.63%750.0080.87240.91
Frost ShockMana 42.8421420.0813.59%500.00500.0090.88
Ice StrikeMana 24.1439823.0525.26%1650.001650.0118.11
Lava LashMana 73.4929394.1618.64%400.00399.99128.23
Lightning BoltMana 28.6614330.499.09%500.00500.01126.55
Primordial WaveMana 6.9810473.206.64%1500.001500.00107.23
StormstrikeMana 32.3932391.6820.55%1000.001000.0117.58
Windfury TotemMana 3.041530.000.97%503.29503.290.00

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Ele Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Ele Damage Per Second
Count 7499
Mean 59260.84
Minimum 51738.81
Maximum 69780.89
Spread ( max - min ) 18042.08
Range [ ( max - min ) / 2 * 100% ] 15.22%
Standard Deviation 2444.7684
5th Percentile 55458.96
95th Percentile 63388.27
( 95th Percentile - 5th Percentile ) 7929.32
Mean Distribution
Standard Deviation 28.2316
95.00% Confidence Interval ( 59205.51 - 59316.17 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 66
0.1% Error 6538
0.1 Scale Factor Error with Delta=300 51023
0.05 Scale Factor Error with Delta=300 204089
0.01 Scale Factor Error with Delta=300 5102220
Priority Target DPS
PR_Shaman_Enhancement_Ele Priority Target Damage Per Second
Count 7499
Mean 59260.84
Minimum 51738.81
Maximum 69780.89
Spread ( max - min ) 18042.08
Range [ ( max - min ) / 2 * 100% ] 15.22%
Standard Deviation 2444.7684
5th Percentile 55458.96
95th Percentile 63388.27
( 95th Percentile - 5th Percentile ) 7929.32
Mean Distribution
Standard Deviation 28.2316
95.00% Confidence Interval ( 59205.51 - 59316.17 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 66
0.1% Error 6538
0.1 Scale Factor Error with Delta=300 51023
0.05 Scale Factor Error with Delta=300 204089
0.01 Scale Factor Error with Delta=300 5102220
DPS(e)
PR_Shaman_Enhancement_Ele Damage Per Second (Effective)
Count 7499
Mean 59260.84
Minimum 51738.81
Maximum 69780.89
Spread ( max - min ) 18042.08
Range [ ( max - min ) / 2 * 100% ] 15.22%
Damage
PR_Shaman_Enhancement_Ele Damage
Count 7499
Mean 16867706.74
Minimum 11851594.49
Maximum 22323531.10
Spread ( max - min ) 10471936.60
Range [ ( max - min ) / 2 * 100% ] 31.04%
DTPS
PR_Shaman_Enhancement_Ele Damage Taken Per Second
Count 7499
Mean 868.96
Minimum 0.00
Maximum 2351.14
Spread ( max - min ) 2351.14
Range [ ( max - min ) / 2 * 100% ] 135.29%
HPS
PR_Shaman_Enhancement_Ele Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Ele Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Ele Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Ele Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Ele Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_EleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Ele Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
0.00 primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
G 14.36 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
0.00 doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
I 0.00 call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
J 0.00 call_action_list,name=funnel,if=active_enemies>1&rotation.funnel
actions.single
# count action,conditions
K 1.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
L 0.29 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
0.00 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
M 48.34 lava_lash,if=buff.hot_hand.up
N 1.67 windfury_totem,if=!buff.windfury_totem.up
O 6.39 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
P 6.93 lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
Q 18.09 elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
R 12.43 lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
S 5.98 primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
0.00 flame_shock,if=!ticking
T 24.14 ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
U 25.14 lava_lash,if=talent.lashing_flames.enabled
0.00 ice_strike,if=!buff.ice_strike.up
V 42.58 frost_shock,if=buff.hailstorm.up
0.00 lava_lash
0.00 ice_strike
0.00 windstrike
W 32.39 stormstrike
0.00 sundering,if=raid_event.adds.in>=action.sundering.cooldown
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
X 9.30 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 0.26 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Z 1.20 earth_elemental
a 9.73 flame_shock
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
b 0.37 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGKOTUVWPZVUWXTVUWOVGaUWQTVMRMVMWMQMTVWWGMRMVMTMMQMSMPMVMGMTQVUWRVWWQTUVWRaVUGWTQVaUWXMVMRMSPTGUOVWaXUVTQWVWUXVaNWTUXVGWaOUVTWQMVMSMPVGTUQVWaYUQTVMRMVMWMXMTGMVQEFWXUVaMTMQMMSGMMPMTMVMOWVUXaTVMWMOMVGUTQVWabUXVWMTMRMSMGOVWPTUVWXaVUOWMTMVMRUGVWOTVUMQMVMWRSPTUGVWMQMVCM

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 2 augmentation PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 3 windfury_weapon PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 4 flametongue_weapon PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 6 windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana corrupting_rage
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
0:00.000 default B bloodlust Fluffy_Pillow 250000.0/250000: 100% mana corrupting_rage
0:00.000 default C potion Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, corrupting_rage
0:00.000 default D auto_attack Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(2), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default F berserking PR_Shaman_Enhancement_Ele 249000.0/250000: 100% mana bloodlust, flurry(3), stormbringer, maelstrom_weapon, crumbling_power(20), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, berserking, flurry(3), stormbringer, maelstrom_weapon, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:00.894 single K primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, molten_weapon, crackling_surge, stormbringer, maelstrom_weapon(2), crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:01.788 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), primordial_wave, feral_spirit, molten_weapon, crackling_surge, stormbringer, maelstrom_weapon(10), crumbling_power(18), corrupting_rage, elemental_potion_of_ultimate_power
0:02.681 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_mastery, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, hailstorm(10), crumbling_power(17), corrupting_rage, elemental_potion_of_ultimate_power
0:03.576 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, crumbling_power(16), corrupting_rage, elemental_potion_of_ultimate_power
0:04.471 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, primordial_wave, feral_spirit, molten_weapon, crackling_surge, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, crumbling_power(15), corrupting_rage, elemental_potion_of_ultimate_power
0:05.367 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), elemental_blast_mastery, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(6), crumbling_power(14), corrupting_rage, elemental_potion_of_ultimate_power
0:06.262 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(9), crumbling_power(13), corrupting_rage, elemental_potion_of_ultimate_power
0:07.157 single Z earth_elemental Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hailstorm(9), crumbling_power(12), corrupting_rage, elemental_potion_of_ultimate_power
0:07.912 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hailstorm(9), crumbling_power(11), corrupting_rage, elemental_potion_of_ultimate_power
0:08.666 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon, crumbling_power(10), corrupting_rage, elemental_potion_of_ultimate_power
0:09.420 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(5), crumbling_power(9), corrupting_rage, elemental_potion_of_ultimate_power
0:10.174 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(7), crumbling_power(8), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:10.929 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon, hailstorm(7), crumbling_power(7), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:11.683 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), hailstorm(7), ice_strike, crumbling_power(6), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:12.435 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(6), crumbling_power(5), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:13.480 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(7), crumbling_power(4), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:14.300 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(8), crumbling_power(3), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:15.119 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, splintered_elements, ashen_catalyst(3), maelstrom_weapon, hailstorm(8), crumbling_power(2), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:15.938 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, splintered_elements, ashen_catalyst(3), maelstrom_weapon(2), crumbling_power, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:16.819 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), sophic_devotion, elemental_potion_of_ultimate_power
0:17.638 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(4), sophic_devotion, elemental_potion_of_ultimate_power
0:18.459 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(6), sophic_devotion, elemental_potion_of_ultimate_power
0:19.443 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(10), sophic_devotion, elemental_potion_of_ultimate_power
0:20.426 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, hailstorm(10), sophic_devotion, elemental_potion_of_ultimate_power
0:21.381 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, sophic_devotion, forgestorm_ignited, elemental_potion_of_ultimate_power
0:22.337 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), hot_hand, stormbringer, maelstrom_weapon(7), sophic_devotion, forgestorm_ignited, elemental_potion_of_ultimate_power
0:23.291 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(8), sophic_devotion, forgestorm_ignited, elemental_potion_of_ultimate_power
0:24.245 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(8), sophic_devotion, forgestorm_ignited, elemental_potion_of_ultimate_power
0:25.200 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(8), forgestorm_ignited, elemental_potion_of_ultimate_power
0:26.153 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), spiraling_winds, forgestorm_ignited, elemental_potion_of_ultimate_power
0:27.108 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds, forgestorm_ignited, elemental_potion_of_ultimate_power
0:28.064 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), spiraling_winds(2), forgestorm_ignited, elemental_potion_of_ultimate_power
0:29.018 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), spiraling_winds(2), forgestorm_ignited, elemental_potion_of_ultimate_power
0:29.970 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, hailstorm(9), spiraling_winds(3), forgestorm_ignited, elemental_potion_of_ultimate_power
0:30.953 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, stormbringer, maelstrom_weapon, hailstorm(9), spiraling_winds(3), forgestorm_ignited
0:31.936 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_mastery, ashen_catalyst, stormbringer, maelstrom_weapon(4), hailstorm(9), ice_strike, spiraling_winds(4), forgestorm_ignited, corrupting_rage
0:32.921 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(6), spiraling_winds(4), corrupting_rage
0:33.904 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, ashen_catalyst(3), stormbringer, maelstrom_weapon(7), spiraling_winds(5), corrupting_rage
0:34.888 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_mastery, ashen_catalyst(3), hot_hand, maelstrom_weapon(10), spiraling_winds(5), corrupting_rage
0:35.871 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(4), hot_hand, maelstrom_weapon(10), spiraling_winds(6), corrupting_rage
0:36.855 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), spiraling_winds(6), corrupting_rage
0:37.838 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, hailstorm(10), spiraling_winds(7), corrupting_rage
0:38.822 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, molten_weapon(2), hot_hand, maelstrom_weapon(2), hailstorm(10), spiraling_winds(7), corrupting_rage
0:39.806 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(4), spiraling_winds(8), corrupting_rage
0:40.789 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(6), spiraling_winds(8), corrupting_rage
0:42.244 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(10), ice_strike, spiraling_winds(9), corrupting_rage
0:43.521 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, molten_weapon(2), hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10)
0:44.798 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10)
0:46.074 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, hailstorm(10), ice_strike, spiraling_winds(10)
0:47.314 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, spiraling_winds(10)
0:48.554 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(10), ice_strike, spiraling_winds(10)
0:49.793 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(10), ice_strike, spiraling_winds(10)
0:51.034 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike
0:52.068 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike
0:53.101 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4)
0:54.133 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, hot_hand, stormbringer, maelstrom_weapon(5)
0:55.166 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(6)
0:56.230 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(7)
0:57.295 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(10), ice_strike
0:58.359 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hailstorm(10), ice_strike, corrupting_rage
0:59.424 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon, corrupting_rage
1:00.487 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(3), corrupting_rage
1:01.552 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(8), corrupting_rage
1:02.616 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, hailstorm(8), corrupting_rage
1:04.040 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(3), corrupting_rage
1:05.317 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), stormbringer, maelstrom_weapon(6), spiraling_winds, corrupting_rage
1:06.593 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_weapon(9), spiraling_winds, sophic_devotion, corrupting_rage
1:07.870 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), hailstorm(9), spiraling_winds(2), sophic_devotion, corrupting_rage
1:09.145 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, icy_edge, molten_weapon, ashen_catalyst(6), maelstrom_weapon(3), hailstorm(9), ice_strike, spiraling_winds(2), sophic_devotion, corrupting_rage
1:10.421 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(5), hailstorm(9), ice_strike, spiraling_winds(3), sophic_devotion, corrupting_rage
1:11.697 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(6), spiraling_winds(4), sophic_devotion, corrupting_rage
1:12.972 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(9), spiraling_winds(4), sophic_devotion, corrupting_rage
1:14.250 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), hailstorm(9), spiraling_winds(5), sophic_devotion, corrupting_rage
1:15.530 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst(4), hailstorm(9), spiraling_winds(6), sophic_devotion, corrupting_rage
1:16.807 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(5), maelstrom_weapon, spiraling_winds(6), sophic_devotion, corrupting_rage
1:18.104 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(3), spiraling_winds(7), sophic_devotion, corrupting_rage
1:19.380 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(8), sophic_devotion, corrupting_rage
1:20.657 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5), spiraling_winds(8), sophic_devotion, corrupting_rage
1:21.933 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(10), ice_strike, spiraling_winds(9), corrupting_rage
1:23.209 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hailstorm(10), ice_strike, spiraling_winds(10), corrupting_rage
1:24.485 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(2), spiraling_winds(10), corrupting_rage
1:25.761 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(3), spiraling_winds(10), corrupting_rage
1:27.038 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
1:28.314 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), spiraling_winds(10), corrupting_rage
1:29.592 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(6), spiraling_winds(10), corrupting_rage
1:30.868 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(4), hailstorm(6), corrupting_rage
1:32.144 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), corrupting_rage
1:33.420 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(9), corrupting_rage
1:34.697 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, hailstorm(9), corrupting_rage
1:35.974 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(9), corrupting_rage
1:37.250 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana primordial_wave, ashen_catalyst(2), maelstrom_weapon(10), hailstorm(9), corrupting_rage
1:38.527 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, ashen_catalyst(3), hailstorm(10), corrupting_rage
1:39.592 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(3), maelstrom_weapon(3), hailstorm(10), ice_strike, corrupting_rage
1:40.657 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(4), hailstorm(10), ice_strike, spiraling_winds, corrupting_rage
1:41.721 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(5), hailstorm(10), ice_strike, spiraling_winds(2), corrupting_rage
1:42.787 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon, hailstorm(10), ice_strike, spiraling_winds(2), corrupting_rage
1:43.821 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(2), spiraling_winds(3), corrupting_rage
1:44.855 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(3), corrupting_rage
1:45.889 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(6), spiraling_winds(4), corrupting_rage
1:46.923 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(5), hailstorm(6), spiraling_winds(4), corrupting_rage
1:47.956 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), maelstrom_weapon(2), hailstorm(6), spiraling_winds(5), corrupting_rage
1:48.990 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(6), spiraling_winds(5), corrupting_rage
1:50.023 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(6), corrupting_rage
1:51.261 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), stormbringer, hailstorm(8), ice_strike, spiraling_winds(6), corrupting_rage
1:52.500 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(2), hailstorm(8), ice_strike, spiraling_winds(7), corrupting_rage
1:53.942 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(3), spiraling_winds(8), corrupting_rage
1:55.216 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(5), maelstrom_weapon(6), spiraling_winds(8), sophic_devotion, corrupting_rage
1:56.492 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(7), spiraling_winds(9), sophic_devotion, corrupting_rage
1:57.769 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, hailstorm(7), spiraling_winds(10), sophic_devotion, corrupting_rage
1:59.045 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon, spiraling_winds(10), sophic_devotion, corrupting_rage
2:00.322 single N windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(3), maelstrom_weapon, spiraling_winds(10), sophic_devotion, corrupting_rage
2:01.175 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(3), maelstrom_weapon, spiraling_winds(10), sophic_devotion, corrupting_rage
2:02.451 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds(10), sophic_devotion, corrupting_rage
2:03.728 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst(5), maelstrom_weapon(5), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
2:05.005 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(7), ice_strike, sophic_devotion, corrupting_rage
2:06.281 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst, hailstorm(7), ice_strike, sophic_devotion, corrupting_rage
2:07.556 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(2), maelstrom_weapon, sophic_devotion, corrupting_rage
2:08.867 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), sophic_devotion, corrupting_rage
2:10.142 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), corrupting_rage
2:11.419 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(5), corrupting_rage
2:12.695 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), hailstorm(5), corrupting_rage
2:13.973 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(3), hailstorm(5), corrupting_rage
2:15.249 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), corrupting_rage
2:16.525 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), ice_strike, corrupting_rage
2:17.803 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(10), ice_strike, corrupting_rage
2:19.080 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, corrupting_rage
2:20.356 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, corrupting_rage
2:21.633 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), corrupting_rage
2:22.909 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), corrupting_rage
2:24.184 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, primordial_wave, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), spiraling_winds, corrupting_rage
2:25.460 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, primordial_wave, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), spiraling_winds(2), corrupting_rage
2:26.739 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst, stormbringer, hailstorm(10), spiraling_winds(2), corrupting_rage
2:27.805 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), spiraling_winds(3), corrupting_rage
2:28.868 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(5), spiraling_winds(3), forgestorm_ignited, corrupting_rage
2:29.933 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(7), ice_strike, spiraling_winds(4), forgestorm_ignited, corrupting_rage
2:30.998 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(5), forgestorm_ignited, corrupting_rage
2:32.060 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, hailstorm(9), ice_strike, spiraling_winds(5), forgestorm_ignited, corrupting_rage
2:33.125 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon, spiraling_winds(6), forgestorm_ignited, corrupting_rage
2:34.188 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(3), spiraling_winds(6), forgestorm_ignited, corrupting_rage
2:35.254 Waiting     0.883s 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(3), spiraling_winds(7), forgestorm_ignited, corrupting_rage
2:36.137 single Y frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(4), spiraling_winds(7), forgestorm_ignited, corrupting_rage
2:37.367 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(5), spiraling_winds(8), forgestorm_ignited, corrupting_rage
2:38.431 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(8), spiraling_winds(8), forgestorm_ignited, corrupting_rage
2:39.708 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, hailstorm(8), spiraling_winds(9), forgestorm_ignited, corrupting_rage
2:41.074 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(3), hailstorm(8), ice_strike, spiraling_winds(10), corrupting_rage
2:42.321 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), hot_hand, maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
2:43.558 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(8), spiraling_winds(10), corrupting_rage
2:44.796 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(2), hot_hand, hailstorm(8), spiraling_winds(10), corrupting_rage
2:46.035 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, hot_hand, maelstrom_weapon(3), hailstorm(8), spiraling_winds(10)
2:47.275 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(4), spiraling_winds(10)
2:48.514 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst, hot_hand, maelstrom_weapon(5)
2:49.790 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(6)
2:51.067 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, hot_hand, maelstrom_weapon(7)
2:52.342 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, hot_hand, hailstorm(7), sophic_devotion
2:53.618 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(7), sophic_devotion
2:54.895 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(5), hailstorm(7), ice_strike, sophic_devotion, forgestorm_ignited
2:56.171 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(6), hailstorm(7), ice_strike, sophic_devotion, forgestorm_ignited
2:57.447 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(7), hailstorm(7), ice_strike, sophic_devotion, forgestorm_ignited
2:58.724 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(10), sophic_devotion, forgestorm_ignited
3:00.001 default E use_item_irideus_fragment Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), hailstorm(10), sophic_devotion, forgestorm_ignited, corrupting_rage
3:00.001 default F berserking PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), hailstorm(10), crumbling_power(20), sophic_devotion, forgestorm_ignited, corrupting_rage
3:00.001 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), hailstorm(10), crumbling_power(19), sophic_devotion, forgestorm_ignited, corrupting_rage
3:01.162 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(5), hailstorm(10), crumbling_power(19), sophic_devotion, forgestorm_ignited, corrupting_rage
3:02.322 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon, hailstorm(10), crumbling_power(18), sophic_devotion, forgestorm_ignited, corrupting_rage
3:03.486 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(2), hailstorm(10), crumbling_power(17), sophic_devotion, forgestorm_ignited, corrupting_rage
3:04.648 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(4), crumbling_power(16), sophic_devotion, forgestorm_ignited, corrupting_rage
3:05.811 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(5), crumbling_power(15), sophic_devotion, corrupting_rage
3:06.972 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), crumbling_power(14), sophic_devotion, corrupting_rage
3:08.135 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(10), ice_strike, crumbling_power(13), corrupting_rage
3:09.296 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, crumbling_power(12), corrupting_rage
3:10.457 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, crumbling_power(11), corrupting_rage
3:11.583 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), ice_strike, crumbling_power(10), corrupting_rage
3:12.711 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(10), ice_strike, crumbling_power(9), corrupting_rage
3:13.949 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, primordial_wave, ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(10), ice_strike, crumbling_power(8), corrupting_rage
3:15.189 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), hailstorm(10), ice_strike, crumbling_power(7), corrupting_rage
3:16.429 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(10), ice_strike, crumbling_power(6), corrupting_rage
3:17.668 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(10), ice_strike, crumbling_power(5), corrupting_rage
3:18.909 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, hailstorm(10), ice_strike, crumbling_power(4), corrupting_rage
3:19.942 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, hot_hand, maelstrom_weapon, hailstorm(10), crumbling_power(3), corrupting_rage
3:21.006 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(10), ice_strike, sophic_devotion, corrupting_rage
3:22.072 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), hailstorm(10), ice_strike, sophic_devotion, corrupting_rage
3:23.134 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(9), sophic_devotion, corrupting_rage
3:24.198 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, hot_hand, maelstrom_weapon(10), sophic_devotion, corrupting_rage
3:25.262 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hailstorm(10), spiraling_winds, sophic_devotion, corrupting_rage
3:26.325 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(10), spiraling_winds(2), sophic_devotion, corrupting_rage
3:27.389 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(2), sophic_devotion, corrupting_rage
3:28.454 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(5), spiraling_winds(3), sophic_devotion, corrupting_rage
3:29.518 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, ashen_catalyst, maelstrom_weapon(2), hailstorm(5), spiraling_winds(3), sophic_devotion, corrupting_rage
3:30.581 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(5), spiraling_winds(4), sophic_devotion, corrupting_rage
3:32.002 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(5), hailstorm(5), ice_strike, spiraling_winds(4), sophic_devotion, corrupting_rage
3:33.276 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, ashen_catalyst(3), hot_hand, maelstrom_weapon(6), spiraling_winds(5), sophic_devotion, corrupting_rage
3:34.551 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(7), spiraling_winds(6), sophic_devotion, corrupting_rage
3:35.826 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(2), hot_hand, maelstrom_weapon(8), spiraling_winds(6), sophic_devotion, corrupting_rage
3:37.103 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(9), spiraling_winds(7), corrupting_rage
3:38.379 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, hailstorm(9), spiraling_winds(8), corrupting_rage
3:39.655 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(9), spiraling_winds(8), corrupting_rage
3:40.931 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), spiraling_winds(9), corrupting_rage
3:42.208 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
3:43.484 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, stormbringer, maelstrom_weapon(5), spiraling_winds(10), corrupting_rage
3:44.760 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(10), corrupting_rage
3:46.037 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, hailstorm(8), ice_strike, spiraling_winds(10), corrupting_rage
3:47.277 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(3), spiraling_winds(10), corrupting_rage
3:48.517 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(10), corrupting_rage
3:49.756 single b windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), corrupting_rage
3:50.582 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(5), corrupting_rage
3:51.822 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, maelstrom_weapon(7), corrupting_rage
3:53.063 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon, hailstorm(7), corrupting_rage
3:54.302 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), corrupting_rage
3:55.541 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hot_hand, maelstrom_weapon(4), corrupting_rage
3:56.819 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), hot_hand, maelstrom_weapon(7), corrupting_rage
3:58.095 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(9), ice_strike, corrupting_rage
3:59.371 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, corrupting_rage
4:00.646 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(2), hot_hand, hailstorm(10), ice_strike, corrupting_rage
4:01.921 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry, hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, corrupting_rage
4:03.198 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(10), ice_strike, corrupting_rage
4:04.476 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, ashen_catalyst, maelstrom_weapon(10), hailstorm(10), ice_strike, corrupting_rage
4:05.753 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(10), hailstorm(10), ice_strike, corrupting_rage
4:07.029 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(2), hailstorm(10), ice_strike, corrupting_rage
4:08.307 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(4), corrupting_rage
4:09.583 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(8), corrupting_rage
4:10.861 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon, hailstorm(8), corrupting_rage
4:11.926 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon(3), hailstorm(8), ice_strike, corrupting_rage
4:12.990 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(4), hailstorm(8), ice_strike, corrupting_rage
4:14.055 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(6), corrupting_rage
4:15.116 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(7), corrupting_rage
4:16.181 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), hailstorm(7), corrupting_rage
4:17.245 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon, hailstorm(7), corrupting_rage
4:18.310 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon(2), corrupting_rage
4:19.374 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(5), corrupting_rage
4:20.438 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, ashen_catalyst, maelstrom_weapon, hailstorm(5), corrupting_rage
4:21.502 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, ashen_catalyst(2), hot_hand, maelstrom_weapon(2), hailstorm(5), corrupting_rage
4:22.568 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(5), corrupting_rage
4:23.845 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), hailstorm(5), ice_strike, corrupting_rage
4:25.123 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, hot_hand, maelstrom_weapon(6), hailstorm(5), ice_strike, corrupting_rage
4:26.397 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(8), corrupting_rage
4:27.673 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(9)
4:28.951 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon, hailstorm(9), forgestorm_ignited
4:30.227 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(2), hailstorm(9), forgestorm_ignited
4:31.504 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(3), hailstorm(9), forgestorm_ignited
4:32.780 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(4), forgestorm_ignited
4:34.057 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(7), forgestorm_ignited
4:35.334 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hailstorm(7), forgestorm_ignited
4:36.573 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon(4), hailstorm(7), ice_strike, forgestorm_ignited
4:37.812 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_weapon(5), forgestorm_ignited
4:39.049 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(6), forgestorm_ignited
4:40.288 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(8), forgestorm_ignited
4:41.528 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, hailstorm(8)
4:42.768 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(8), corrupting_rage
4:44.009 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), corrupting_rage
4:45.248 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(6), corrupting_rage
4:46.525 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(8), corrupting_rage
4:47.802 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), hailstorm(8), forgestorm_ignited, corrupting_rage
4:49.079 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, primordial_wave, ashen_catalyst(3), maelstrom_weapon(10), hailstorm(8), forgestorm_ignited, corrupting_rage
4:50.355 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, ashen_catalyst(3), hailstorm(10), forgestorm_ignited, corrupting_rage
4:51.419 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst(4), maelstrom_weapon(2), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
4:52.484 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst, maelstrom_weapon(4), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
4:53.549 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
4:54.614 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), forgestorm_ignited, corrupting_rage
4:55.680 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(8), forgestorm_ignited, corrupting_rage
4:56.744 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), forgestorm_ignited, corrupting_rage
4:57.809 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(9), forgestorm_ignited, corrupting_rage
4:58.843 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(9), forgestorm_ignited, corrupting_rage
4:59.877 default C potion Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), forgestorm_ignited, corrupting_rage
5:00.000 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 250000 250000 0
Spell Power 6635 6149 0
Crit 22.03% 15.82% 1047
Haste 17.84% 17.84% 3032
Versatility 3.93% 0.93% 191
Mana Regen 2560 2560 0
Attack Power 5440 5012 0
Mastery 58.69% 58.69% 3842
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +519 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [16]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement_Ele"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkESSSDlEAAAAAAAAAAAAAKRIJkQKiCJNAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
actions+=/primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
actions+=/call_action_list,name=funnel,if=active_enemies>1&rotation.funnel

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.funnel=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.funnel+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.funnel+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/windstrike,if=(talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1)|buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/stormstrike,if=buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&buff.crackling_thunder.up
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)|(talent.converging_storms.enabled&buff.converging_storms.stack<buff.converging_storms.max_stack)
actions.funnel+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.funnel+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.funnel+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.funnel+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.funnel+=/sundering
actions.funnel+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.funnel+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=3
actions.funnel+=/stormstrike,if=buff.crash_lightning.up&talent.deeply_rooted_elements.enabled
actions.funnel+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.funnel+=/windstrike
actions.funnel+=/stormstrike
actions.funnel+=/ice_strike
actions.funnel+=/lava_lash
actions.funnel+=/crash_lightning
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=2
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5
actions.funnel+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.funnel+=/flame_shock,if=!ticking
actions.funnel+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
actions.single+=/primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
actions.single+=/lava_lash,if=talent.lashing_flames.enabled
actions.single+=/ice_strike,if=!buff.ice_strike.up
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/ice_strike
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=action.sundering.cooldown
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1047
# gear_haste_rating=3032
# gear_mastery_rating=3842
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:
Total Events Processed: 234991235
Max Event Queue: 287
Sim Seconds: 2250297
CPU Seconds: 235.8757
Physical Seconds: 118.2785
Speed Up: 9540

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.97sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 183037 610 7.60 3650 7324 38.0 38.0 31.7% 0.0% 0.0% 0.0% 6.76sec 183037 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost antimagic_shell 48707 51549 172 0.64 16014 0 6.8 3.2 0.0% 0.0% 0.0% 0.0% 42.80sec 51549 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 146.97sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 800480 2668 38.31 3616 7244 191.5 191.5 31.8% 16.3% 0.0% 0.0% 1.83sec 1143572 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 389280 1298 37.41 1808 3620 187.0 187.0 31.8% 16.8% 0.0% 0.0% 1.83sec 556128 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost blood_draw 374606 30488 102 0.40 11568 23095 2.0 2.0 31.9% 0.0% 0.0% 0.0% 180.11sec 30488 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.65sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_damage 155166 3167396 10558 26.33 18260 36461 131.7 131.7 31.9% 0.0% 0.0% 0.0% 2.03sec 3167396 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 220276 734 0.56 60361 120295 3.0 2.8 31.5% 0.0% 0.0% 0.0% 119.69sec 220276 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay ticks -43265 4458 15 0.00 419 840 0.7 0.0 31.8% 0.0% 0.0% 0.0% 75.61sec 4458 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 307990 1027 1.39 33769 67534 6.9 6.9 31.5% 0.0% 0.0% 0.0% 29.34sec 439996 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 83.32sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 382156 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 788965 2630 19.74 6073 12118 60.3 98.7 31.8% 0.0% 0.0% 0.0% 4.95sec 788965 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 222026 779031 2597 8.87 13343 26601 44.4 44.4 31.8% 0.0% 0.0% 0.0% 4.90sec 779031 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 389568 1299 8.87 6672 13300 44.4 44.4 31.8% 0.0% 0.0% 0.0% 4.90sec 389568 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 78.20sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 2095535 6985 12.06 26350 52685 60.3 60.3 31.9% 0.0% 0.0% 0.0% 4.95sec 2095535 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 414213 1381 12.06 5214 10411 60.3 60.3 31.8% 0.0% 0.0% 0.0% 4.95sec 414213 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 427758 1426 9.61 6758 13540 48.1 48.1 31.6% 0.0% 0.0% 0.0% 6.12sec 611099 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 214033 713 9.61 3379 6771 48.1 48.1 31.7% 0.0% 0.0% 0.0% 6.12sec 305770 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1920678 6402 11.52 0 33355 57.6 57.6 100.0% 0.0% 0.0% 0.0% 5.15sec 1920678 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 960339 3201 11.52 0 16677 57.6 57.6 100.0% 0.0% 0.0% 0.0% 5.15sec 960339 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost overwhelming_rage ticks -374037 264251 881 3.94 13400 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 58.95sec 326142 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 35.73sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 305.34sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.55sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul auto_attack 0 278325 1714 35.01 2226 4461 94.8 94.8 31.8% 0.0% 0.0% 0.0% 2.91sec 397617 162.42sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 135714 836 19.22 1978 3963 52.0 52.0 31.7% 0.0% 0.0% 0.0% 5.38sec 193882 162.42sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 253 2 1.07 66 133 2.9 2.9 31.7% 0.0% 0.0% 0.0% 121.56sec 362 162.42sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 20.39sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1776946 5923 47.73 5652 11311 238.6 238.6 31.7% 0.0% 0.0% 0.0% 1.26sec 1776946 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 61789 206 4.04 2323 4646 20.2 20.2 31.7% 0.0% 0.0% 0.0% 14.46sec 88273 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 61889 206 4.04 2323 4645 20.2 20.2 31.9% 0.0% 0.0% 0.0% 14.38sec 88416 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.1 0.0 0.0% 0.0% 0.0% 0.0% 14.44sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy algethar_puzzle_box_channel 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy antimagic_shell 48707 49082 164 0.62 15824 0 7.0 3.1 0.0% 0.0% 0.0% 0.0% 45.45sec 49082 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 72479 242 1.36 8833 17657 6.8 6.8 20.4% 0.0% 0.0% 0.0% 46.27sec 72479 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 1247810 9440 117.31 4012 8017 258.4 258.4 20.4% 0.0% 0.0% 0.0% 4.33sec 1782631 132.18sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 297855 2253 86.08 1306 2613 189.6 189.6 20.2% 0.0% 0.0% 0.0% 5.97sec 425518 132.18sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_magus frostbolt 317792 194730 1473 9.00 8170 16352 19.8 19.8 20.2% 0.0% 0.0% 0.0% 14.91sec 194730 132.18sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_magus shadow_bolt 317791 620303 4693 28.42 8229 16453 62.6 62.6 20.4% 0.0% 0.0% 0.0% 4.53sec 620303 132.18sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1165620 19031 334.53 2835 5665 341.5 341.5 20.4% 0.0% 0.0% 0.0% 0.74sec 1665214 61.25sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 223203 3644 203.73 891 1778 208.0 208.0 20.5% 0.0% 0.0% 0.0% 1.32sec 318870 61.25sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_magus frostbolt 317792 84728 1412 8.00 8811 17547 8.0 8.0 20.4% 0.0% 0.0% 0.0% 30.96sec 84728 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_magus shadow_bolt 317791 390726 6512 35.78 9073 18106 35.8 35.8 20.5% 0.0% 0.0% 0.0% 6.30sec 390726 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 812601 2709 29.42 4590 9177 147.1 147.1 20.4% 0.0% 0.0% 0.0% 2.46sec 1160888 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.60sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy blood_draw 374606 28529 95 0.40 11782 23501 2.0 2.0 21.2% 0.0% 0.0% 0.0% 0.00sec 28529 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy clawing_shadows 207311 2365784 7886 14.20 27688 55452 71.0 71.0 20.3% 0.0% 0.0% 0.0% 4.10sec 2365784 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 46.15sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation_damage 344955 63393 211 1.39 7563 15102 0.0 6.9 20.8% 0.0% 0.0% 0.0% 0.00sec 63393 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_and_decay ticks -43265 81213 271 0.00 734 1466 8.5 0.0 20.4% 0.0% 0.0% 0.0% 36.55sec 81213 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 2195739 7319 19.26 18952 37872 96.3 96.3 20.3% 0.0% 0.0% 0.0% 3.08sec 2195739 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 647062 2157 27.39 4724 0 0.0 137.0 0.0% 0.0% 0.0% 0.0% 0.00sec 647062 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 279703 932 1.37 33982 67984 6.8 6.8 20.5% 0.0% 0.0% 0.0% 46.65sec 399586 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 168.38sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 468146 1560 4.53 17178 34304 22.7 22.7 20.3% 0.0% 0.0% 0.0% 13.25sec 668797 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 755074 2517 19.65 6382 12766 98.3 98.3 20.4% 0.0% 0.0% 0.0% 3.78sec 755074 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound_application 197147 0 0 0.00 0 0 102.0 0.0 0.0% 0.0% 0.0% 0.0% 5.28sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 382154 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 26100 87 2.32 1869 3724 11.6 11.6 20.3% 0.0% 0.0% 0.0% 27.01sec 26100 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak_aoe 196780 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 27.01sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy overwhelming_rage ticks -374037 261209 871 3.92 13321 0 4.0 19.6 0.0% 0.0% 0.0% 0.0% 59.20sec 321529 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.93sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul auto_attack 0 1640937 5470 37.21 7330 14656 186.0 186.0 20.3% 0.0% 0.0% 0.0% 1.61sec 2344256 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 597086 1990 12.57 7891 15775 62.9 62.9 20.4% 0.0% 0.0% 0.0% 4.67sec 597086 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 130198 434 7.88 2744 5488 39.4 39.4 20.4% 0.0% 0.0% 0.0% 7.73sec 186002 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 424 1 0.75 94 188 3.7 3.7 21.0% 0.0% 0.0% 0.0% 90.14sec 606 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 219946 733 3.08 11856 23742 15.4 15.4 20.4% 0.0% 0.0% 0.0% 6.95sec 219946 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 1020596 3402 3.08 54990 109899 15.4 15.4 20.6% 0.0% 0.0% 0.0% 6.95sec 1020596 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.23sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 902641 18053 32.54 27674 55238 27.1 27.1 20.3% 0.0% 0.0% 0.0% 7.85sec 902641 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 117027 390 0.73 26735 53408 3.6 3.6 20.2% 0.0% 0.0% 0.0% 91.69sec 117027 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 20.7 0.0 0.0% 0.0% 0.0% 0.0% 14.05sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 381427 1271 19.90 3183 6369 11.6 99.5 20.4% 0.0% 0.0% 0.0% 27.01sec 381427 300.00sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 594938 1983 4.19 25038 50181 20.9 20.9 13.4% 0.0% 0.0% 0.0% 14.29sec 1315589 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 720651 2402 12.99 9796 19600 20.9 64.9 13.3% 0.0% 0.0% 0.0% 14.29sec 1315589 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 85.9 0.0 0.0% 0.0% 0.0% 0.0% 3.41sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 803795 2679 7.16 19831 39740 35.8 35.8 13.2% 0.0% 0.0% 0.0% 8.45sec 803795 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 2000304 6668 35.33 9994 20024 176.6 176.6 13.3% 0.0% 0.0% 0.0% 1.69sec 2000304 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 18026 60 6.60 546 0 33.0 33.0 0.0% 0.0% 0.0% 0.0% 6.42sec 18026 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 256717 856 1.24 36287 73147 6.2 6.2 14.1% 0.0% 0.0% 0.0% 10.34sec 256717 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage 32409 129264 431 1.22 21197 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 10.34sec 133333 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowfiend 34433 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 312904 1043 15.98 3916 0 7.0 79.9 0.0% 0.0% 0.0% 0.0% 37.85sec 312904 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 602853 2010 25.57 4161 8333 13.5 127.8 13.3% 0.0% 0.0% 0.0% 21.04sec 602853 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 127.8 0.0 0.0% 0.0% 0.0% 0.0% 2.33sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_shadowfiend melee 0 147090 4203 56.57 3934 7867 33.0 33.0 13.3% 0.0% 0.0% 0.0% 6.42sec 147090 35.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement doom_winds 384352 30227 101 0.75 6672 13357 3.7 3.7 21.3% 0.0% 0.0% 0.0% 90.43sec 43183 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 308.06sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 15.5 0.0 0.0% 0.0% 0.0% 0.0% 20.44sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 97996 327 5.91 2748 5498 29.6 29.6 20.6% 0.0% 0.0% 0.0% 9.99sec 459124 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 361127 1204 36.84 1626 3251 29.6 184.2 20.6% 0.0% 0.0% 0.0% 9.99sec 459124 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 410713 1369 198.58 343 686 992.9 992.9 20.7% 0.0% 0.0% 0.0% 0.68sec 410713 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 369884 1233 5.68 10808 21617 28.4 28.4 20.5% 0.0% 0.0% 0.0% 7.75sec 369884 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 290059 967 2.84 16913 33886 14.2 14.2 20.6% 0.0% 0.0% 0.0% 19.43sec 290059 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 562801 1876 4.31 21695 43358 21.5 21.5 20.5% 0.0% 0.0% 0.0% 13.79sec 562801 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 529073 1764 4.00 21874 43726 20.0 20.0 20.8% 0.0% 0.0% 0.0% 14.71sec 529073 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 4131746 13773 13.61 50273 100605 68.1 68.1 20.7% 0.0% 0.0% 0.0% 4.37sec 4131746 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 1 536654 1789 38.70 2660 5323 193.5 193.5 20.7% 16.4% 0.0% 0.0% 1.81sec 766668 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 2 268992 897 38.71 1331 2666 193.6 193.6 20.6% 16.3% 0.0% 0.0% 1.80sec 384284 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement overwhelming_rage ticks -374037 259427 865 3.91 13283 0 4.0 19.5 0.0% 0.0% 0.0% 0.0% 60.29sec 264629 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 301.99sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 90.8 0.0 0.0% 0.0% 0.0% 0.0% 3.30sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 1579888 5266 24.21 10813 21655 121.1 121.1 20.6% 0.0% 0.0% 0.0% 2.47sec 2257041 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_mh 390287 364102 1214 10.53 6916 0 52.6 52.6 0.0% 0.0% 0.0% 0.0% 5.65sec 364102 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 790139 2634 24.21 5407 10822 121.1 121.1 20.7% 0.0% 0.0% 0.0% 2.47sec 1128799 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_offhand 390287 182007 607 10.53 3457 0 52.6 52.6 0.0% 0.0% 0.0% 0.0% 5.65sec 182007 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 291206 971 1.20 40259 80413 6.0 6.0 20.3% 0.0% 0.0% 0.0% 50.53sec 291206 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement tempest_strikes 428078 1133903 3780 32.51 5780 11568 162.6 162.6 20.7% 0.0% 0.0% 0.0% 1.84sec 1133903 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_totem 8512 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 113.78sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 2069523 6898 75.15 4560 9141 375.8 375.8 20.7% 0.0% 0.0% 0.0% 2.50sec 2956537 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 26504 431 37.95 565 1130 38.9 38.9 20.6% 0.0% 0.0% 0.0% 2.23sec 37863 61.52sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_spirit_wolf melee 0 907572 8431 213.57 1962 3927 383.2 383.2 20.7% 0.0% 0.0% 0.0% 1.56sec 1296564 107.65sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 311.33sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele elemental_blast 117014 3406131 11354 4.95 113573 227429 24.8 24.8 21.0% 0.0% 0.0% 0.0% 12.22sec 3406131 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele feral_spirit 51533 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 22.13sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock 188389 769475 2565 18.04 7008 14031 90.2 90.2 21.7% 0.0% 0.0% 0.0% 3.33sec 1757197 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock ticks -188389 987722 3292 39.19 4143 8301 90.2 195.9 21.6% 0.0% 0.0% 0.0% 3.33sec 1757197 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_attack 10444 290399 968 122.01 391 783 610.0 610.0 21.6% 0.0% 0.0% 0.0% 0.74sec 290399 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele forgestorm_ignited_damage 381700 379848 1266 5.77 10809 21617 28.9 28.9 21.7% 0.0% 0.0% 0.0% 7.63sec 379848 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele frost_shock 196840 1946573 6489 8.57 37317 74641 42.8 42.8 21.8% 0.0% 0.0% 0.0% 6.94sec 1946573 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele ice_strike 342240 721010 2403 4.83 24491 49205 24.1 24.1 21.8% 0.0% 0.0% 0.0% 12.55sec 721010 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lava_lash 60103 3769267 12564 14.70 42198 84351 73.5 73.5 21.6% 0.0% 0.0% 0.0% 4.05sec 3769267 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt 188196 1813574 6045 5.73 52026 104251 28.7 28.7 21.5% 0.0% 0.0% 0.0% 10.36sec 1813574 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele main_hand 1 542820 1809 38.79 2660 5319 194.0 194.0 21.6% 16.4% 0.0% 0.0% 1.80sec 775476 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele offhand 2 278248 927 39.64 1333 2669 198.2 198.2 21.7% 16.4% 0.0% 0.0% 1.76sec 397507 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele overwhelming_rage ticks -374037 260754 869 3.93 13283 0 4.0 19.6 0.0% 0.0% 0.0% 0.0% 59.57sec 265982 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 303.43sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave 375982 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 46.16sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave_damage 375984 330702 1102 1.40 38961 77896 7.0 7.0 21.6% 0.0% 0.0% 0.0% 46.16sec 330702 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt_pw 188196 792386 2641 1.39 93846 187495 6.9 6.9 21.8% 0.0% 0.0% 0.0% 45.75sec 792386 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike 17364 0 0 0.00 0 0 32.4 0.0 0.0% 0.0% 0.0% 0.0% 9.11sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_mh 32175 379661 1266 6.48 9628 19288 32.4 32.4 21.7% 0.0% 0.0% 0.0% 9.11sec 542387 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_offhand 32176 189702 632 6.48 4815 9637 32.4 32.4 21.6% 0.0% 0.0% 0.0% 9.11sec 271009 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_totem 8512 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 117.33sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_attack 25504 270189 901 23.94 1856 3715 119.7 119.7 21.6% 0.0% 0.0% 0.0% 5.15sec 385994 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_greater_earth_elemental melee 0 31877 501 41.66 593 1187 44.2 44.2 21.6% 0.0% 0.0% 0.0% 2.53sec 45540 63.68sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_frost_wolf melee 0 286382 7073 177.60 1964 3935 119.8 119.8 21.6% 0.0% 0.0% 0.0% 2.69sec 409127 40.49sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_lightning_wolf melee 0 288100 8972 225.24 1964 3937 120.5 120.5 21.6% 0.0% 0.0% 0.0% 2.68sec 411582 32.11sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_fiery_wolf melee 0 288578 8926 224.17 1963 3933 120.8 120.8 21.6% 0.0% 0.0% 0.0% 2.67sec 412264 32.33sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
232036.2 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.6 2.2 22.2s 18.7s 5.5s 23.05% 0.00% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.1s / 216.0s
  • trigger_min/max:3.0s / 216.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s
  • uptime_min/max:4.06% / 46.55%

Stack Uptimes

  • brittle_1:23.05%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.8 2.2 22.2s 18.7s 5.5s 23.31% 0.00% 2.2 (2.2) 12.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 210.0s
  • trigger_min/max:3.0s / 210.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s
  • uptime_min/max:4.57% / 43.56%

Stack Uptimes

  • brittle_1:23.31%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 114.9 162.5s 2.6s 293.0s 98.52% 0.00% 105.8 (105.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.4s / 330.2s
  • trigger_min/max:0.0s / 14.0s
  • trigger_pct:100.00%
  • duration_min/max:21.2s / 355.6s
  • uptime_min/max:96.66% / 98.80%

Stack Uptimes

  • death_rot_1:0.28%
  • death_rot_2:0.29%
  • death_rot_3:0.68%
  • death_rot_4:0.49%
  • death_rot_5:1.06%
  • death_rot_6:0.65%
  • death_rot_7:0.55%
  • death_rot_8:0.55%
  • death_rot_9:0.53%
  • death_rot_10:93.45%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% from you for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 6.5 232.2 49.4s 1.3s 45.6s 98.27% 0.00% 175.1 (175.1) 5.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 245.5s
  • trigger_min/max:0.0s / 16.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 244.8s
  • uptime_min/max:92.47% / 99.94%

Stack Uptimes

  • everfrost_1:2.15%
  • everfrost_2:2.15%
  • everfrost_3:2.14%
  • everfrost_4:2.13%
  • everfrost_5:2.12%
  • everfrost_6:2.11%
  • everfrost_7:2.10%
  • everfrost_8:2.10%
  • everfrost_9:2.09%
  • everfrost_10:79.18%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 23.5 33.5 12.8s 5.3s 10.4s 81.23% 0.00% 1.8 (2.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 115.3s
  • trigger_min/max:0.0s / 33.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 111.6s
  • uptime_min/max:65.94% / 91.56%

Stack Uptimes

  • festering_wound_1:23.51%
  • festering_wound_2:26.10%
  • festering_wound_3:18.02%
  • festering_wound_4:7.66%
  • festering_wound_5:3.35%
  • festering_wound_6:2.60%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 72.5 2.2s 4.1s 296.7s 98.90% 99.06% 72.5 (72.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 2.7s
  • trigger_min/max:0.8s / 15.3s
  • trigger_pct:100.00%
  • duration_min/max:236.4s / 358.1s
  • uptime_min/max:98.14% / 99.50%

Stack Uptimes

  • lashing_flames_1:98.90%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.1 59.2 186.3s 4.9s 279.1s 99.11% 0.00% 55.0 (55.0) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.1s / 350.2s
  • trigger_min/max:0.9s / 50.2s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 357.9s
  • uptime_min/max:89.69% / 99.43%

Stack Uptimes

  • razorice_1:1.09%
  • razorice_2:0.88%
  • razorice_3:0.80%
  • razorice_4:0.92%
  • razorice_5:95.42%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Rotten Touch 11.9 7.7 25.2s 15.0s 13.6s 53.63% 0.00% 7.7 (7.7) 11.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rotten_touch
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 90.1s
  • trigger_min/max:0.8s / 58.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 74.3s
  • uptime_min/max:28.89% / 78.10%

Stack Uptimes

  • rotten_touch_1:53.63%

Spelldata

  • id:390276
  • name:Rotten Touch
  • tooltip:Scourge Strike damage taken from {$@=}auracaster is increased by {$s1=50}%.
  • description:{$@spelldesc390275=Sudden Doom causes your next Death Coil to also increase your {$?s207311=true}[Clawing Shadows][Scourge Strike] damage against the target by {$390276s1=50}% for {$390276d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 235677.56
Minimum 217384.89
Maximum 260354.52
Spread ( max - min ) 42969.63
Range [ ( max - min ) / 2 * 100% ] 9.12%
Standard Deviation 5232.3747
5th Percentile 227120.20
95th Percentile 244377.20
( 95th Percentile - 5th Percentile ) 17257.00
Mean Distribution
Standard Deviation 60.4223
95.00% Confidence Interval ( 235559.14 - 235795.99 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1894
0.1 Scale Factor Error with Delta=300 233713
0.05 Scale Factor Error with Delta=300 934849
0.01 Scale Factor Error with Delta=300 23371219
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3756
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 55617111 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.