SimulationCraft 1020-01

for World of Warcraft 10.2.0.52649 Live (hotfix 2024-01-08/52649, git build 33a83cd61f)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 49739 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
49738.7 49738.7 54.5 / 0.110% 9349.4 / 18.8% 3923.9
APS APS Error APS Range APR
168.7 3.9 / 2.287% 435.7 / 258.2% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.6 Runic Power 2.44% 53.7 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 49739
Abomination Limb 0 (592) 0.0% (1.2%) 3.0 120.98s 59196 47766

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.00 1.2394 0.0000 0.00 0.00 0.00% 47765.80 47765.80

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [f]:0.13
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
    cooldowns
    [g]:2.85
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
    Abomination Limb (_damage) 592 1.2% 38.0 6.76s 4630 0 Direct 38.0 3511 7048 4631 31.7% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.02 38.02 0.00 0.00 0.00 0.0000 0.0000 176064.74 176064.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.34% 25.99 9 36 3510.74 2365 6808 3512.86 2915 4407 91234 91234 0.00%
crit 31.66% 12.04 3 24 7047.53 4731 13616 7052.95 5092 9782 84831 84831 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
auto_attack_mh 2672 5.4% 191.5 1.83s 4183 2303 Direct 191.5 3617 7248 4183 31.8% 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 191.50 191.50 0.00 0.00 0.00 1.8160 0.0000 801036.47 1144367.00 30.00% 2303.38 2303.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.86% 99.31 60 141 3616.69 2527 7436 3617.32 3350 3921 359175 513120 30.00%
crit 31.84% 60.96 31 95 7247.98 5053 15037 7247.17 6461 8081 441862 631247 30.00%
miss 16.31% 31.22 12 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1302 2.6% 187.1 1.83s 2085 1148 Direct 187.1 1809 3623 2085 31.8% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 187.13 187.13 0.00 0.00 0.00 1.8158 0.0000 390211.28 557458.90 30.00% 1148.37 1148.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.51% 96.39 55 138 1809.26 1263 3677 1809.58 1677 1955 174395 249142 30.00%
crit 31.84% 59.57 30 92 3622.61 2527 7518 3622.45 3287 4113 215816 308316 30.00%
miss 16.65% 31.17 11 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 99 0.2% 2.0 179.84s 14670 0 Direct 2.0 11133 22312 14670 31.6% 0.0%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 29342.95 29342.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.37% 1.37 0 2 11133.20 9995 17693 10041.46 0 17693 15225 15225 0.00%
crit 31.63% 0.63 0 2 22311.74 19989 35836 11916.56 0 34935 14118 14118 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Breath of Sindragosa 0 (10205) 0.0% (20.5%) 2.9 120.65s 1034769 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [j]:2.95
  • if_expr:!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
    Breath of Sindragosa (_damage) 10205 20.5% 131.7 2.03s 23149 0 Direct 131.7 17575 35106 23149 31.8% 0.0%

Stats Details: Breath Of Sindragosa Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.70 131.70 0.00 0.00 0.00 0.0000 0.0000 3048835.68 3048835.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.20% 89.83 38 142 17574.94 9234 39439 17608.44 15646 20086 1578732 1578732 0.00%
crit 31.80% 41.88 13 71 35106.00 18468 79783 35169.09 29209 41705 1470104 1470104 0.00%

Action Details: Breath Of Sindragosa Damage

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Burnout Wave 735 1.5% 3.0 119.72s 74647 0 Direct 2.8 60255 120967 79327 31.4% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 2.78 0.00 0.00 0.00 0.0000 0.0000 220537.19 220537.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.59% 1.91 0 3 60254.99 22015 69346 57551.78 0 69346 114896 114896 0.00%
crit 31.41% 0.87 0 3 120966.63 46231 138692 78263.42 0 138692 105641 105641 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 14 0.0% 0.7 77.06s 5787 4476 Periodic 8.1 405 809 534 31.9% 0.0% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.74 0.00 0.00 8.06 0.00 1.2940 0.0000 4300.98 4300.98 0.00% 4475.52 4475.52
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.14% 5.49 0 43 404.97 300 676 210.83 0 562 2224 2224 0.00%
crit 31.86% 2.57 0 26 809.07 601 1352 414.41 0 1140 2077 2077 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    breath
    [X]:0.74
  • if_expr:runic_power<36&rune.time_to_2>runic_power%18

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Dragon Games Equipment 1029 2.1% 6.9 29.34s 44477 0 Direct 6.9 33771 67528 44505 31.8% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.94 6.94 0.00 0.00 0.00 0.0000 0.0000 308868.36 441251.77 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.20% 4.73 0 9 33770.62 33171 34829 33760.32 0 34829 159828 228332 29.98%
crit 31.80% 2.21 0 8 67527.64 66341 69658 61593.30 0 69658 149040 212920 27.36%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 2530 5.1% 60.3 4.95s 12587 0 Periodic 98.7 5842 11661 7690 31.8% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.30 0.00 98.70 98.70 59.29 0.0000 2.9998 759018.59 759018.59 0.00% 2563.70 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.23% 67.34 43 97 5842.05 101 14555 5841.87 5374 6347 393417 393417 0.00%
crit 31.77% 31.35 11 57 11660.86 127 28786 11662.46 9744 13736 365601 365601 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.28
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountFrost Death Knight1370065PCT0.280

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Frost Strike 2485 (3727) 5.0% (7.5%) 44.3 4.90s 25327 18904 Direct 44.3 (88.7) 12824 25579 16888 31.9% (31.8%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.35 44.35 0.00 0.00 0.00 1.3398 0.0000 748939.95 748939.95 0.00% 18903.95 18903.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.14% 30.22 12 65 12824.40 7828 24151 12805.83 11263 14275 387550 387550 0.00%
crit 31.86% 14.13 2 32 25578.86 15656 47493 25528.66 21138 30802 361389 361389 0.00%

Action Details: Frost Strike

  • id:222026
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}

Action Priority List

    high_prio_actions
    [m]:2.44
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [o]:30.67
  • if_expr:buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
    single_target
    [r]:4.08
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [v]:7.15
  • if_expr:!variable.pooling_runic_power

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountImproved Frost Strike3168031PCT0.200
    Frost Strike Off-Hand 1242 2.5% 44.3 4.90s 8440 0 Direct 44.3 6413 12787 8440 31.8% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.35 44.35 0.00 0.00 0.00 0.0000 0.0000 374294.92 374294.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.20% 30.24 13 58 6412.75 3914 12076 6403.88 5628 7160 193950 193950 0.00%
crit 31.80% 14.10 2 33 12786.99 7828 23137 12762.24 10559 15755 180345 180345 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountImproved Frost Strike3168031PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Howling Blast 6736 (8068) 13.5% (16.2%) 60.3 4.95s 40035 33077 Direct 60.3 (120.6) 25358 50654 33427 31.9% (31.9%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.30 60.30 0.00 0.00 0.00 1.2104 0.0000 2015655.22 2015655.22 0.00% 33076.75 33076.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.10% 41.06 17 62 25357.81 4116 60245 25364.93 22512 28975 1041304 1041304 0.00%
crit 31.90% 19.24 5 39 50653.79 8650 119123 50657.49 41860 63157 974352 974352 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [T]:37.84
  • if_expr:variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
    breath
    [Y]:0.26
  • if_expr:runic_power<36&rune.time_to_2>runic_power%18
    breath
    [a]:0.30
  • if_expr:buff.rime.react
    single_target
    [q]:21.90
  • if_expr:buff.rime.react&talent.icebreaker.rank=2

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Rime5905223.000Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Percent Cost Rime590521-1.000Spell Data
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
    Avalanche 1332 2.7% 60.3 4.95s 6608 0 Direct 60.3 5014 10027 6608 31.8% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.29 60.29 0.00 0.00 0.00 0.0000 0.0000 398451.25 398451.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.19% 41.11 20 62 5013.58 2733 11807 5014.97 4427 5740 206127 206127 0.00%
crit 31.81% 19.18 3 37 10026.76 5466 23880 10029.30 7939 12324 192324 192324 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Obliterate 1375 (11315) 2.8% (22.8%) 48.1 6.11s 70561 26189 Direct 48.1 (211.3) 6504 13046 8565 31.5% (68.9%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 48.06 48.06 0.00 0.00 0.00 2.6944 0.0000 411609.84 588029.04 30.00% 26188.55 26188.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.50% 32.92 11 52 6504.00 4305 13430 6511.32 5715 7663 214120 305894 30.00%
crit 31.50% 15.14 3 32 13046.27 8610 27158 13050.83 10516 17777 197490 282135 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]

Action Priority List

    breath
    [V]:23.81
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [W]:30.10
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Z]:6.39
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [p]:27.39
  • if_expr:buff.killing_machine.react
    single_target
    [s]:17.98
  • if_expr:!variable.pooling_runes

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
    Obliterate Off-Hand 689 1.4% 48.1 6.11s 4288 0 Direct 48.1 3252 6523 4288 31.7% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 48.06 48.06 0.00 0.00 0.00 0.0000 0.0000 206080.63 294408.41 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.33% 32.84 11 54 3251.96 2152 6715 3255.60 2858 3786 106784 152553 30.00%
crit 31.67% 15.22 3 35 6523.19 4305 13579 6522.49 5313 8557 99296 141855 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
    Obliterate (_km) 6167 12.4% 57.6 5.15s 32095 0 Direct 57.6 0 32095 32095 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.61 57.61 0.00 0.00 0.00 0.0000 0.0000 1848941.66 1848941.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 57.61 34 89 32095.14 17962 78470 32073.72 28723 35613 1848942 1848942 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
    Obliterate Off-Hand (_km) 3084 6.2% 57.6 5.15s 16048 0 Direct 57.6 0 16048 16048 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.61 57.61 0.00 0.00 0.00 0.0000 0.0000 924470.83 924470.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 57.61 34 89 16047.57 8981 39235 16036.86 14362 17806 924471 924471 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]{$?a134735=false}&a51128[ Damage increased by {$s6=75}% in PvP Combat when Killing Machine is not active.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountImproved Obliterate3171981PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Periodic Damage Chilling Rage42416520.040Spell Data
Critical Strike Chance Killing Machine5112411000.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Raise Dead 0 (1331) 0.0% (2.7%) 3.0 121.57s 134943 0

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [k]:2.96
    auto_attack 1654  / 894 1.8% 94.8 2.91s 2828 1830 Direct 94.8 2143 4294 2828 31.9% 0.0%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.76 94.76 0.00 0.00 0.00 1.5452 0.0000 268008.40 382878.91 30.00% 1830.32 1830.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.14% 64.57 36 89 2142.66 1371 4278 2145.58 1900 2404 138359 197661 30.00%
crit 31.86% 30.19 9 53 4294.33 2743 8368 4300.45 3557 5218 129649 185218 30.00%

Action Details: Auto Attack

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:2.92
    Claw 807  / 436 0.9% 52.1 5.38s 2512 2512 Direct 52.1 1904 3812 2512 31.9% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.06 52.06 0.00 0.00 0.00 1.0000 0.0000 130762.68 186808.59 30.00% 2511.91 2511.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.15% 35.47 17 50 1903.95 1234 3851 1905.88 1637 2226 67543 96492 30.00%
crit 31.85% 16.58 4 31 3812.34 2468 7701 3816.59 3074 5188 63220 90317 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.06
  • if_expr:energy>70
    Gnaw 2  / 1 0.0% 2.9 121.58s 84 84 Direct 2.9 64 128 84 32.0% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.90 2.90 0.00 0.00 0.00 1.0000 0.0000 244.57 349.40 30.00% 84.28 84.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.02% 1.97 0 3 63.86 44 106 61.56 0 104 126 180 28.88%
crit 31.98% 0.93 0 3 127.64 87 214 86.04 0 214 118 169 20.23%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.90
Remorseless Winter 0 (5707) 0.0% (11.5%) 15.2 20.39s 112295 88973

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.23 0.00 0.00 0.00 0.00 1.2621 0.0000 0.00 0.00 0.00% 88972.68 88972.68

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    high_prio_actions
    [n]:15.23
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5707 11.5% 238.6 1.26s 7166 0 Direct 238.6 5440 10874 7166 31.8% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 238.58 238.58 0.00 0.00 0.00 0.0000 0.0000 1709699.05 1709699.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.24% 162.81 108 220 5440.43 1206 16858 5442.00 4497 6302 885737 885737 0.00%
crit 31.76% 75.78 41 112 10873.80 2412 33340 10877.41 8718 13015 823962 823962 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountBiting Cold3770562PCT0.350
Spell Direct AmountBiting Cold3770563PCT0.350

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Chilling Rage42416510.040Spell Data
Gathering Storm21180510.100Spell Data
Mastery: Frozen Heart7751412.000Spell DataMastery
Periodic Damage Chilling Rage42416520.040Spell Data
Mastery: Frozen Heart7751422.000Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Everfrost37697410.060
Brittle37455710.060
Strike Twice 206 0.4% 20.2 14.42s 3061 0 Direct 20.2 2323 4646 3061 31.8% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.16 20.16 0.00 0.00 0.00 0.0000 0.0000 61705.53 88153.01 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.22% 13.75 2 29 2322.71 2296 2411 2322.57 2296 2382 31946 45638 30.00%
crit 31.78% 6.41 0 17 4645.59 4593 4822 4640.16 0 4822 29760 42515 29.97%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 206 0.4% 20.1 14.49s 3060 0 Direct 20.1 2323 4645 3060 31.8% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.15 20.15 0.00 0.00 0.00 0.0000 0.0000 61660.03 88088.00 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.25% 13.75 4 30 2322.99 2296 2411 2322.98 2296 2382 31940 45630 30.00%
crit 31.75% 6.40 0 16 4645.38 4593 4822 4640.56 0 4822 29720 42458 29.97%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Frost 0
Anti-Magic Shell 170 100.5% 6.8 42.81s 7498 0 Direct 3.2 16014 0 16014 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.78 3.17 0.00 0.00 0.00 0.0000 0.0000 50823.32 50823.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.17 0 13 16013.62 16014 16014 13724.43 0 16014 50823 50823 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [l]:6.78
  • if_expr:runic_power.deficit>40&death_knight.first_ams_cast<time

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownAnti-Magic Barrier2057271ADD-20000.000
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Arcane Torrent 1.9 146.59s

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.93 0.00 0.00 0.00 0.00 1.2731 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [b]:0.91
  • if_expr:runic_power<60
    single_target
    [u]:1.02
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 4.0 83.39s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [d]:0.30
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [e]:3.65
  • if_expr:buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929621SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929631SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382156
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 3.8 78.35s

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.84 0.00 0.00 0.00 0.00 1.1863 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [U]:2.95
  • if_expr:rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
    single_target
    [t]:0.90
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Pillar of Frost 8.7 35.72s

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [h]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [i]:8.42
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Elemental Potion of Ultimate Power 1.5 305.17s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [c]:1.45
  • if_expr:(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
Unholy Strength 20.2 14.44s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.20 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 121.0s 121.0s 11.8s 11.80% 0.00% 32.2 (32.2) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 123.8s
  • trigger_min/max:120.0s / 123.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:9.79% / 14.22%

Stack Uptimes

  • abomination_limb_1:11.80%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Anti-Magic Shell 6.8 0.0 42.8s 42.8s 6.9s 15.60% 18.69% 0.0 (0.0) 6.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.40
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 93.3s
  • trigger_min/max:40.0s / 93.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:11.39% / 17.84%

Stack Uptimes

  • antimagic_shell_1:15.60%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 10.5 37.3 29.2s 6.2s 18.8s 66.10% 0.00% 0.0 (0.0) 3.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 67.2s
  • trigger_min/max:0.9s / 44.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.2s
  • uptime_min/max:50.41% / 81.37%

Stack Uptimes

  • bonegrinder_crit_1:17.12%
  • bonegrinder_crit_2:14.87%
  • bonegrinder_crit_3:12.86%
  • bonegrinder_crit_4:11.26%
  • bonegrinder_crit_5:9.99%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 6.0 0.0 48.2s 48.2s 9.8s 19.74% 16.71% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:17.6s / 232.0s
  • trigger_min/max:17.6s / 232.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.87% / 30.95%

Stack Uptimes

  • bonegrinder_frost_1:19.74%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 3.0 14.7 120.6s 15.1s 19.4s 19.24% 0.00% 2.0 (2.0) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 125.7s
  • trigger_min/max:0.0s / 116.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:16.23% / 22.68%

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.87%
  • bound_by_fire_and_blaze_2:4.29%
  • bound_by_fire_and_blaze_3:4.25%
  • bound_by_fire_and_blaze_4:3.74%
  • bound_by_fire_and_blaze_5:2.74%
  • bound_by_fire_and_blaze_6:3.35%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.6s 120.6s 44.6s 44.00% 0.00% 131.4 (131.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 125.7s
  • trigger_min/max:120.0s / 125.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 110.0s
  • uptime_min/max:22.85% / 64.03%

Stack Uptimes

  • breath_of_sindragosa_1:44.00%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.2s 50.2s 80.23% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 337.0s
  • trigger_min/max:15.0s / 329.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 351.0s
  • uptime_min/max:47.93% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.23%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dragon Games Equipment 2.8 0.0 120.6s 120.6s 0.8s 0.71% 0.00% 6.9 (6.9) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.83
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 125.7s
  • trigger_min/max:120.0s / 125.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s
  • uptime_min/max:0.52% / 0.94%

Stack Uptimes

  • dragon_games_equipment_1:0.71%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 305.2s 305.2s 27.0s 12.85% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.3s
  • trigger_min/max:300.0s / 329.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.72% / 17.93%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.85%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 83.6s 83.2s 19.6s 25.87% 0.00% 11.6 (11.6) 3.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 285.3s
  • trigger_min/max:0.0s / 285.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.4s
  • uptime_min/max:17.77% / 30.13%

Stack Uptimes

  • empower_rune_weapon_1:25.87%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 8.4 0.0 35.7s 35.7s 12.8s 35.84% 0.00% 0.0 (0.0) 8.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.0s / 49.4s
  • trigger_min/max:26.0s / 49.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 26.0s
  • uptime_min/max:26.10% / 47.06%

Stack Uptimes

  • enduring_strength_1:35.84%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 8.6 21.6 36.0s 9.6s 10.0s 28.91% 98.89% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.5s / 112.2s
  • trigger_min/max:0.9s / 102.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:18.70% / 36.17%

Stack Uptimes

  • enduring_strength_builder_1:10.27%
  • enduring_strength_builder_2:8.83%
  • enduring_strength_builder_3:5.61%
  • enduring_strength_builder_4:2.64%
  • enduring_strength_builder_5:1.08%
  • enduring_strength_builder_6:0.37%
  • enduring_strength_builder_7:0.09%
  • enduring_strength_builder_8:0.01%
  • enduring_strength_builder_9:0.00%
  • enduring_strength_builder_10:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storm 12.9 120.2 24.2s 2.2s 15.3s 65.74% 85.70% 67.8 (107.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.7s / 86.0s
  • trigger_min/max:0.9s / 35.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.2s
  • uptime_min/max:53.35% / 77.63%

Stack Uptimes

  • gathering_storm_1:2.49%
  • gathering_storm_2:5.49%
  • gathering_storm_3:4.90%
  • gathering_storm_4:3.96%
  • gathering_storm_5:5.18%
  • gathering_storm_6:3.73%
  • gathering_storm_7:3.67%
  • gathering_storm_8:2.82%
  • gathering_storm_9:2.22%
  • gathering_storm_10:31.28%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 1.0 174.7 177.9s 1.7s 291.8s 97.94% 0.00% 172.7 (172.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:116.2s / 245.5s
  • trigger_min/max:0.9s / 12.7s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 354.8s
  • uptime_min/max:96.48% / 98.57%

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.26%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 45.4 14.5 6.6s 5.0s 2.4s 35.82% 54.51% 1.8 (1.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 54.8s
  • trigger_min/max:0.0s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.0s
  • uptime_min/max:19.13% / 58.80%

Stack Uptimes

  • killing_machine_1:30.19%
  • killing_machine_2:5.63%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 8.7 0.0 35.7s 35.7s 11.8s 34.33% 36.46% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.0s / 49.4s
  • trigger_min/max:26.0s / 49.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:30.71% / 38.46%

Stack Uptimes

  • pillar_of_frost_1:34.33%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 8.7 57.4 35.8s 4.4s 11.4s 33.22% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.2s / 49.4s
  • trigger_min/max:0.9s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:26.43% / 38.08%

Stack Uptimes

  • pillar_of_frost_bonus_1:1.91%
  • pillar_of_frost_bonus_2:3.32%
  • pillar_of_frost_bonus_3:3.49%
  • pillar_of_frost_bonus_4:2.86%
  • pillar_of_frost_bonus_5:3.45%
  • pillar_of_frost_bonus_6:3.25%
  • pillar_of_frost_bonus_7:2.98%
  • pillar_of_frost_bonus_8:2.73%
  • pillar_of_frost_bonus_9:1.96%
  • pillar_of_frost_bonus_10:1.37%
  • pillar_of_frost_bonus_11:1.15%
  • pillar_of_frost_bonus_12:1.02%
  • pillar_of_frost_bonus_13:0.93%
  • pillar_of_frost_bonus_14:0.83%
  • pillar_of_frost_bonus_15:0.63%
  • pillar_of_frost_bonus_16:0.45%
  • pillar_of_frost_bonus_17:0.29%
  • pillar_of_frost_bonus_18:0.21%
  • pillar_of_frost_bonus_19:0.18%
  • pillar_of_frost_bonus_20:0.14%
  • pillar_of_frost_bonus_21:0.07%
  • pillar_of_frost_bonus_22:0.02%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 13.0 2.3 24.2s 20.4s 17.3s 74.53% 0.00% 218.9 (218.9) 12.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 86.1s
  • trigger_min/max:20.0s / 27.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 82.2s
  • uptime_min/max:65.53% / 84.52%

Stack Uptimes

  • remorseless_winter_1:74.53%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 60.7 11.4 4.9s 4.2s 2.0s 40.85% 99.99% 11.4 (11.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 51.1s
  • trigger_min/max:0.0s / 47.7s
  • trigger_pct:63.10%
  • duration_min/max:0.0s / 36.3s
  • uptime_min/max:23.18% / 55.97%

Stack Uptimes

  • rime_1:40.85%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.5 13.8 22.3s 10.7s 11.6s 52.47% 0.00% 13.8 (13.8) 13.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 141.5s
  • trigger_min/max:0.9s / 138.8s
  • trigger_pct:15.02%
  • duration_min/max:0.0s / 72.5s
  • uptime_min/max:24.99% / 81.66%

Stack Uptimes

  • rune_mastery_1:52.47%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.4 23.3s 14.4s 10.1s 43.17% 41.83% 7.4 (7.4) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 84.1s
  • trigger_min/max:0.0s / 63.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.8s
  • uptime_min/max:24.13% / 68.98%

Stack Uptimes

  • rune_of_hysteria_1:43.17%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Ground 0.7 0.1 127.2s 77.6s 10.2s 2.20% 0.00% 0.1 (0.1) 0.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.2s / 246.9s
  • trigger_min/max:1.2s / 246.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 242.9s
  • uptime_min/max:0.00% / 12.46%

Stack Uptimes

  • unholy_ground_1:2.20%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 11.8 36.1s 14.4s 23.6s 66.10% 0.00% 11.8 (11.8) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 150.7s
  • trigger_min/max:0.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 142.9s
  • uptime_min/max:42.84% / 93.34%

Stack Uptimes

  • unholy_strength_1:66.10%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 1.0 174.7 177.9s 1.7s 291.8s 97.94% 0.00% 172.7 (172.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:116.2s / 245.5s
  • trigger_min/max:0.9s / 12.7s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 354.8s
  • uptime_min/max:96.48% / 98.57%

Stack Uptimes

  • unleashed_frenzy_1:0.34%
  • unleashed_frenzy_2:0.34%
  • unleashed_frenzy_3:97.26%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=10 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (thousandbone_tongueslicer)

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_thousandbone_tongueslicer
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382156
  • name:Well Fed
  • tooltip:Critical strike and mastery increased by {$=}w1.
  • description:Increases Critical Strike and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 26.7 9.0 48.0 10.9s 1.3s 122.5s
Windfury (Off Hand) 22.3 7.0 44.0 13.0s 1.3s 136.8s
Killing Machine spent on Obliterate 57.6 34.0 89.0 5.1s 0.9s 38.7s
Killing Machine: Critical auto attacks 58.1 35.0 89.0 5.5s 1.3s 40.5s
Killing Machine wasted: Critical auto attacks 1.8 0.0 12.0 61.5s 1.3s 330.3s
Rune ready 223.6 160.0 281.0 1.5s 0.0s 13.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.57% 0.00% 8.22% 0.7s 0.0s 7.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Horn of Winter29.8590.000241.884137.52160.040304.968
Death and Decay112.5740.000321.076279.003134.192359.984
Remorseless Winter0.3560.0007.3025.4241.27617.403
Empower Rune Weapon1.3810.00068.3385.4584.13573.516
Abomination Limb1.0040.0003.7722.9921.0337.869
Pillar of Frost1.3870.00010.29712.1435.36424.690
Breath of Sindragosa2.1570.0006.2206.3614.13911.937
Raise Dead1.7400.0004.4525.1522.3779.038
Anti-Magic Shell6.9090.00053.31847.35622.077101.498

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=461026)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0821.414 / 1.1713.89323.169
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
15.85447.10686.901 / 84.911133.600212.766

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Anti-Magic ShellRunic Power3.1715.440.41%4.870.422.68%
Breath of SindragosaRune11.1310.764.81%0.970.373.29%
Empower Rune WeaponRunic Power19.1889.402.36%4.666.486.76%
Empower Rune WeaponRune19.1818.978.48%0.990.211.10%
Frost FeverRunic Power32.70156.444.14%4.787.054.31%
Horn of WinterRunic Power3.8496.052.54%25.000.000.00%
Horn of WinterRune7.687.683.44%1.000.000.00%
Murderous EfficiencyRune28.8328.8312.89%1.000.000.00%
Rage of the Frozen ChampionRunic Power60.30476.1412.59%7.906.221.29%
Rune RegenerationRune84.1384.1337.62%1.000.000.00%
Rune of HysteriaRunic Power156.14322.548.53%2.0723.756.86%
Runic AttenuationRunic Power71.30344.909.12%4.8411.583.25%
Runic EmpowermentRune73.9373.2632.76%0.990.660.90%
Arcane TorrentRunic Power1.9338.671.02%20.000.000.00%
Death and DecayRunic Power0.747.430.20%10.000.000.00%
Howling BlastRunic Power60.300.050.00%0.000.000.00%
ObliterateRunic Power105.672088.2255.21%19.7625.141.19%
Remorseless WinterRunic Power15.23146.693.88%9.645.563.65%
pet - ghoul
Energy RegenEnergy1098.141916.43100.00%1.75165.817.96%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_damage)Runic Power 131.382364.8364.00%18.0017.961289.24
Death and DecayRune 0.740.740.33%1.001.005786.84
Frost StrikeRunic Power 44.351330.4336.00%30.0030.00844.27
Howling BlastRune 60.300.010.00%0.000.00476531910.79
ObliterateRune 105.67211.3492.97%2.004.4016046.04
Remorseless WinterRune 15.2315.236.70%1.001.00112295.23
pet - ghoul
ClawEnergy 52.062082.37100.00%40.0040.0062.80
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 330760.0 756.76 881.04 253959.5 293477.4 -72871.7 330760.0
Runic Power 0.0 12.61 12.32 86.2 86.7 0.0 124.0
Rune 6.0 0.75 0.76 0.0 2.3 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 49738.65
Minimum 40545.19
Maximum 57958.69
Spread ( max - min ) 17413.50
Range [ ( max - min ) / 2 * 100% ] 17.50%
Standard Deviation 2406.7355
5th Percentile 45857.18
95th Percentile 53777.56
( 95th Percentile - 5th Percentile ) 7920.38
Mean Distribution
Standard Deviation 27.7924
95.00% Confidence Interval ( 49684.18 - 49793.12 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 90
0.1% Error 8995
0.1 Scale Factor Error with Delta=300 49448
0.05 Scale Factor Error with Delta=300 197789
0.01 Scale Factor Error with Delta=300 4944705
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 49738.65
Minimum 40545.19
Maximum 57958.69
Spread ( max - min ) 17413.50
Range [ ( max - min ) / 2 * 100% ] 17.50%
Standard Deviation 2406.7355
5th Percentile 45857.18
95th Percentile 53777.56
( 95th Percentile - 5th Percentile ) 7920.38
Mean Distribution
Standard Deviation 27.7924
95.00% Confidence Interval ( 49684.18 - 49793.12 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 90
0.1% Error 8995
0.1 Scale Factor Error with Delta=300 49448
0.05 Scale Factor Error with Delta=300 197789
0.01 Scale Factor Error with Delta=300 4944705
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 49738.65
Minimum 40545.19
Maximum 57958.69
Spread ( max - min ) 17413.50
Range [ ( max - min ) / 2 * 100% ] 17.50%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 14499725.14
Minimum 10010121.92
Maximum 18430176.01
Spread ( max - min ) 8420054.10
Range [ ( max - min ) / 2 * 100% ] 29.04%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 880.55
Minimum 0.00
Maximum 2405.13
Spread ( max - min ) 2405.13
Range [ ( max - min ) / 2 * 100% ] 136.57%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 754.69
Minimum 0.00
Maximum 1911.11
Spread ( max - min ) 1911.11
Range [ ( max - min ) / 2 * 100% ] 126.61%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
B 0.00 variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
E 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
F 0.00 variable,name=2h_check,value=main_hand.2h
G 0.00 variable,name=erw_pooling_time,op=setif,value=30,value_else=45,condition=death_knight.ams_absorb_percent>0.59
Protects Breath from starving itself on ERW charges depending on anticipated resource gains. More resources enable more aggressive use.
Default action list Executed every time the actor is available.
# count action,conditions
H 1.00 auto_attack
I 0.00 call_action_list,name=variables
Choose Action list to run
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=high_prio_actions
L 0.00 call_action_list,name=cooldowns
M 0.00 call_action_list,name=racials
N 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
O 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
P 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
Q 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
R 0.00 call_action_list,name=aoe,if=active_enemies>=2
S 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
T 37.84 howling_blast,if=variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
Breath Active Rotation
U 2.95 horn_of_winter,if=rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
V 23.81 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&(buff.killing_machine.react|runic_power>45)
W 30.10 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up
X 0.74 death_and_decay,if=runic_power<36&rune.time_to_2>runic_power%18
0.00 remorseless_winter,if=runic_power<36&rune.time_to_2>runic_power%18
Y 0.26 howling_blast,if=runic_power<36&rune.time_to_2>runic_power%18
Z 6.39 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
a 0.30 howling_blast,if=buff.rime.react
b 0.91 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
c 1.45 potion,if=(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
Cooldowns
d 0.30 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
e 3.65 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
f 0.13 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
g 2.85 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=set_bonus.tier31_2pc&buff.chilling_rage.remains<3
0.00 chill_streak,if=!set_bonus.tier31_2pc&active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
h 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
i 8.42 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
j 2.95 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
k 2.96 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react&rune>2|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>50|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.high_prio_actions
# count action,conditions
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
l 6.78 antimagic_shell,if=runic_power.deficit>40&death_knight.first_ams_cast<time
0.00 antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.ready|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up))
0.00 antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!cooldown.pillar_of_frost.ready|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
m 2.44 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
n 15.23 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target
# count action,conditions
o 30.67 frost_strike,if=buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
Single Target Rotation
0.00 howling_blast,if=buff.rime.react&set_bonus.tier30_2pc&buff.killing_machine.stack<2
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
p 27.39 obliterate,if=buff.killing_machine.react
q 21.90 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)&talent.obliteration&talent.breath_of_sindragosa
r 4.08 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
s 17.98 obliterate,if=!variable.pooling_runes
t 0.90 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
u 1.02 arcane_torrent,if=runic_power.deficit>20
v 7.15 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.pillar_of_frost.up&!buff.bloodlust.up&!buff.empower_rune_weapon.up&!variable.rp_buffs
Trinkets
0.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
w 2.95 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&cooldown.empower_rune_weapon.charges<1|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&cooldown.empower_rune_weapon.charges<1|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&((variable.damage_trinket_priority=1|trinket.2.cooldown.remains)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
x 2.78 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&((variable.damage_trinket_priority=2|trinket.1.cooldown.remains)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGHngkqpqjweicWWTTVVWTWTUWTWTVTnZTVTxZZlWVVeVZiVWTVnTWWTWWZTZZTZZZUnVTZTlViWWTbVTVWWnssqvsqvpqvsqponsoisolsvsqrpqosgnkojwTVTWWTWTeWWTVTVniVxWTVTVTlWVTWWTVWnVZVVTVTVWTiWWTWnVWWTVlWTUWTsqssqmnprsuopoiqrsqosqnosolqpopqpgmkqjwVnTVVTiTWTWWeTVUWxTWnVValppqsoosopoppnhrrpqoppoq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 4 trinket_1_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 5 trinket_2_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 6 trinket_1_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 7 trinket_2_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat A trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat B damage_trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat E rw_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat F 2h_check PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat G erw_pooling_time PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
0:00.000 default H auto_attack Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
0:00.000 high_prio_actions n remorseless_winter Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune		 bloodlust, corrupting_rage
0:01.036 cooldowns g abomination_limb Fluffy_Pillow 10.0/124: 8% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, remorseless_winter, corrupting_rage
0:02.072 cooldowns k raise_dead PR_Death_Knight_Frost 10.0/124: 8% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, abomination_limb, killing_machine, remorseless_winter, rime, corrupting_rage
0:02.072 single_target q howling_blast Fluffy_Pillow 10.0/124: 8% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, abomination_limb, killing_machine, remorseless_winter, rime, corrupting_rage
0:03.105 single_target p obliterate Fluffy_Pillow 18.0/124: 15% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, abomination_limb, gathering_storm, killing_machine, remorseless_winter, corrupting_rage
0:04.140 single_target q howling_blast Fluffy_Pillow 43.0/124: 35% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, gathering_storm(3), remorseless_winter, rime, bonegrinder_crit, corrupting_rage
0:05.176 cooldowns j breath_of_sindragosa Fluffy_Pillow 56.0/124: 45% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, gathering_storm(4), remorseless_winter, bonegrinder_crit, corrupting_rage
0:05.176 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 56.0/124: 45% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(4), remorseless_winter, bonegrinder_crit, corrupting_rage
0:05.176 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 56.0/124: 45% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(4), remorseless_winter, bonegrinder_crit, bound_by_fire_and_blaze, corrupting_rage
0:05.176 cooldowns i pillar_of_frost PR_Death_Knight_Frost 61.0/124: 49% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(4), remorseless_winter, bonegrinder_crit, bound_by_fire_and_blaze, corrupting_rage
0:05.176 cooldowns c potion Fluffy_Pillow 61.0/124: 49% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(4), pillar_of_frost, remorseless_winter, bonegrinder_crit, bound_by_fire_and_blaze, corrupting_rage
0:05.176 breath W obliterate Fluffy_Pillow 61.0/124: 49% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(4), pillar_of_frost, remorseless_winter, bonegrinder_crit, bound_by_fire_and_blaze, corrupting_rage, elemental_potion_of_ultimate_power
0:06.076 breath W obliterate Fluffy_Pillow 86.0/124: 69% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(6), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit, enduring_strength_builder, bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:06.977 breath T howling_blast Fluffy_Pillow 93.0/124: 75% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons, breath_of_sindragosa, gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy, bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:07.876 breath T howling_blast Fluffy_Pillow 83.0/124: 67% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(2), breath_of_sindragosa, gathering_storm(9), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(2), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:08.777 breath V obliterate Fluffy_Pillow 78.0/124: 63% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:09.676 breath V obliterate Fluffy_Pillow 85.0/124: 69% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:10.577 breath W obliterate Fluffy_Pillow 92.0/124: 74% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:11.479 breath T howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:12.380 breath W obliterate Fluffy_Pillow 84.0/124: 68% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:13.279 breath T howling_blast Fluffy_Pillow 90.8/124: 73% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:14.179 breath U horn_of_winter PR_Death_Knight_Frost 82.7/124: 67% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:15.079 breath W obliterate Fluffy_Pillow 113.7/124: 92% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:15.980 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(6), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:16.881 breath W obliterate Fluffy_Pillow 104.1/124: 84% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(19), remorseless_winter, bonegrinder_frost, enduring_strength_builder(6), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage, elemental_potion_of_ultimate_power
0:17.780 breath T howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage, elemental_potion_of_ultimate_power
0:18.680 breath V obliterate Fluffy_Pillow 97.9/124: 79% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage, elemental_potion_of_ultimate_power
0:19.581 Waiting     0.121s 104.7/124: 84% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage, elemental_potion_of_ultimate_power
0:19.702 breath T howling_blast Fluffy_Pillow 104.7/124: 84% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage, elemental_potion_of_ultimate_power
0:20.603 high_prio_actions n remorseless_winter Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage, elemental_potion_of_ultimate_power
0:21.503 breath Z obliterate Fluffy_Pillow 98.0/124: 79% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:22.404 breath T howling_blast Fluffy_Pillow 100.0/124: 81% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:23.305 breath V obliterate Fluffy_Pillow 95.0/124: 77% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:24.204 breath T howling_blast Fluffy_Pillow 97.0/124: 78% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:25.105 Waiting     0.093s 105.0/124: 85% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage, elemental_potion_of_ultimate_power
0:25.198 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 92.0/124: 74% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.198 breath Z obliterate Fluffy_Pillow 92.0/124: 74% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, corrupting_rage, elemental_potion_of_ultimate_power
0:26.233 breath Z obliterate Fluffy_Pillow 94.0/124: 76% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:27.269 Waiting     0.961s 101.0/124: 81% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:28.230 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 83.0/124: 67% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:28.230 breath W obliterate Fluffy_Pillow 83.0/124: 67% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:29.265 Waiting     0.209s 95.0/124: 77% runic_power
1.0/6: 17% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:29.474 breath V obliterate Fluffy_Pillow 95.0/124: 77% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:30.509 Waiting     1.582s 102.0/124: 82% runic_power
0.0/6: 0% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:32.091 breath V obliterate Fluffy_Pillow 84.0/124: 68% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:33.128 Waiting     1.110s 91.0/124: 73% runic_power
0.0/6: 0% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:34.238 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 55.0/124: 44% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:34.238 breath V obliterate Fluffy_Pillow 60.0/124: 48% runic_power
3.0/6: 50% rune		 bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:35.139 breath Z obliterate Fluffy_Pillow 85.0/124: 69% runic_power
2.0/6: 33% rune		 bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:36.039 cooldowns i pillar_of_frost PR_Death_Knight_Frost 92.0/124: 74% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:36.039 Waiting     1.185s 92.0/124: 74% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:37.224 breath V obliterate Fluffy_Pillow 56.0/124: 45% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
0:38.125 Waiting     0.283s 80.8/124: 65% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
0:38.408 breath W obliterate Fluffy_Pillow 62.8/124: 51% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
0:39.308 breath T howling_blast Fluffy_Pillow 75.8/124: 61% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:40.210 breath V obliterate Fluffy_Pillow 73.9/124: 60% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:41.380 high_prio_actions n remorseless_winter Fluffy_Pillow 86.9/124: 70% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:42.550 breath T howling_blast Fluffy_Pillow 81.3/124: 66% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:43.720 breath W obliterate Fluffy_Pillow 73.2/124: 59% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:44.890 breath W obliterate Fluffy_Pillow 92.4/124: 75% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
0:46.059 breath T howling_blast Fluffy_Pillow 99.2/124: 80% runic_power
4.0/6: 67% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
0:47.228 breath W obliterate Fluffy_Pillow 76.2/124: 61% runic_power
5.0/6: 83% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
0:48.398 breath W obliterate Fluffy_Pillow 78.2/124: 63% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:49.568 breath Z obliterate Fluffy_Pillow 91.2/124: 74% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:50.739 breath T howling_blast Fluffy_Pillow 98.0/124: 79% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:51.910 breath Z obliterate Fluffy_Pillow 96.2/124: 78% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:53.080 Waiting     0.112s 103.0/124: 83% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:53.192 breath Z obliterate Fluffy_Pillow 85.0/124: 69% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:54.363 breath T howling_blast Fluffy_Pillow 104.2/124: 84% runic_power
3.0/6: 50% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:55.706 breath Z obliterate Fluffy_Pillow 96.1/124: 77% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:57.051 Waiting     0.206s 103.1/124: 83% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:57.257 breath Z obliterate Fluffy_Pillow 90.1/124: 73% runic_power
3.0/6: 50% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:58.601 breath Z obliterate Fluffy_Pillow 96.9/124: 78% runic_power
3.0/6: 50% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:59.945 Waiting     0.287s 106.0/124: 85% runic_power
1.0/6: 17% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:00.232 breath U horn_of_winter PR_Death_Knight_Frost 88.0/124: 71% runic_power
1.0/6: 17% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:01.577 high_prio_actions n remorseless_winter Fluffy_Pillow 101.0/124: 81% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:02.923 breath V obliterate Fluffy_Pillow 101.6/124: 82% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:04.267 breath T howling_blast Fluffy_Pillow 88.0/124: 71% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:05.612 breath Z obliterate Fluffy_Pillow 86.1/124: 69% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:06.958 breath T howling_blast Fluffy_Pillow 88.1/124: 71% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:08.303 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 70.1/124: 57% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:08.303 breath V obliterate Fluffy_Pillow 70.1/124: 57% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:09.646 cooldowns i pillar_of_frost PR_Death_Knight_Frost 72.1/124: 58% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:09.646 breath W obliterate Fluffy_Pillow 72.1/124: 58% runic_power
4.0/6: 67% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(8), pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:10.992 breath W obliterate Fluffy_Pillow 79.1/124: 64% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:12.336 breath T howling_blast Fluffy_Pillow 63.1/124: 51% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:13.682 breath b arcane_torrent PR_Death_Knight_Frost 53.1/124: 43% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:15.026 breath V obliterate Fluffy_Pillow 60.1/124: 48% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:16.370 breath T howling_blast Fluffy_Pillow 44.1/124: 36% runic_power
4.0/6: 67% rune		 icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:17.713 breath V obliterate Fluffy_Pillow 39.1/124: 32% runic_power
5.0/6: 83% rune		 icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:19.058 breath W obliterate Fluffy_Pillow 41.1/124: 33% runic_power
5.0/6: 83% rune		 icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
1:20.402 breath W obliterate Fluffy_Pillow 25.1/124: 20% runic_power
3.0/6: 50% rune		 icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(12), bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
1:21.747 high_prio_actions n remorseless_winter Fluffy_Pillow 32.1/124: 26% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:23.092 Waiting     0.106s 24.1/124: 19% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:23.198 single_target s obliterate Fluffy_Pillow 6.1/124: 5% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:24.541 single_target s obliterate Fluffy_Pillow 26.1/124: 21% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), gathering_storm(2), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:25.886 single_target q howling_blast Fluffy_Pillow 51.1/124: 41% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:27.231 single_target v frost_strike Fluffy_Pillow 64.1/124: 52% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:28.574 single_target s obliterate Fluffy_Pillow 34.1/124: 28% runic_power
2.0/6: 33% rune		 icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:29.918 single_target q howling_blast Fluffy_Pillow 59.1/124: 48% runic_power
0.0/6: 0% rune		 icy_talons(3), gathering_storm(7), killing_machine, remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:31.262 single_target v frost_strike Fluffy_Pillow 67.1/124: 54% runic_power
0.0/6: 0% rune		 icy_talons(3), gathering_storm(8), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:32.606 single_target p obliterate Fluffy_Pillow 37.1/124: 30% runic_power
2.0/6: 33% rune		 rune_of_hysteria, icy_talons(3), gathering_storm(8), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:33.949 single_target q howling_blast Fluffy_Pillow 61.9/124: 50% runic_power
1.0/6: 17% rune		 rune_of_hysteria, icy_talons(3), gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:35.296 single_target v frost_strike Fluffy_Pillow 78.0/124: 63% runic_power
1.0/6: 17% rune		 rune_of_hysteria, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:36.640 single_target s obliterate Fluffy_Pillow 48.0/124: 39% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:37.984 single_target q howling_blast Fluffy_Pillow 72.8/124: 59% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:39.328 single_target p obliterate Fluffy_Pillow 89.0/124: 72% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:40.674 single_target o frost_strike Fluffy_Pillow 109.0/124: 88% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:42.019 high_prio_actions n remorseless_winter Fluffy_Pillow 84.0/124: 68% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:43.365 single_target s obliterate Fluffy_Pillow 99.0/124: 80% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:44.711 single_target o frost_strike Fluffy_Pillow 119.0/124: 96% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:46.055 cooldowns i pillar_of_frost PR_Death_Knight_Frost 89.0/124: 72% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:46.055 single_target s obliterate Fluffy_Pillow 89.0/124: 72% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), gathering_storm(2), pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:47.400 single_target o frost_strike Fluffy_Pillow 109.0/124: 88% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:48.745 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 79.0/124: 64% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:48.745 single_target s obliterate Fluffy_Pillow 79.0/124: 64% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:50.090 single_target v frost_strike Fluffy_Pillow 99.0/124: 80% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:51.435 single_target s obliterate Fluffy_Pillow 69.0/124: 56% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:52.780 single_target q howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:54.123 single_target r frost_strike Fluffy_Pillow 102.0/124: 82% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:55.468 single_target p obliterate Fluffy_Pillow 72.0/124: 58% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:56.813 single_target q howling_blast Fluffy_Pillow 102.0/124: 82% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:58.157 single_target o frost_strike Fluffy_Pillow 110.0/124: 89% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:59.501 single_target s obliterate Fluffy_Pillow 80.0/124: 64% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:00.846 cooldowns g abomination_limb Fluffy_Pillow 100.0/124: 81% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:02.382 high_prio_actions n remorseless_winter Fluffy_Pillow 105.0/124: 85% runic_power
2.0/6: 33% rune		 rune_mastery, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:03.729 cooldowns k raise_dead PR_Death_Knight_Frost 115.0/124: 93% runic_power
1.0/6: 17% rune		 rune_mastery, abomination_limb, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:03.729 single_target o frost_strike Fluffy_Pillow 115.0/124: 93% runic_power
1.0/6: 17% rune		 rune_mastery, abomination_limb, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:05.074 cooldowns j breath_of_sindragosa Fluffy_Pillow 95.0/124: 77% runic_power
3.0/6: 50% rune		 abomination_limb, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:05.176 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 95.0/124: 77% runic_power
5.0/6: 83% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:05.176 breath T howling_blast Fluffy_Pillow 95.0/124: 77% runic_power
5.0/6: 83% rune		 unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
2:06.520 breath V obliterate Fluffy_Pillow 90.0/124: 73% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
2:07.864 breath T howling_blast Fluffy_Pillow 92.0/124: 74% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
2:09.209 breath W obliterate Fluffy_Pillow 74.0/124: 60% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(4), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
2:10.555 breath W obliterate Fluffy_Pillow 76.0/124: 61% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(6), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
2:11.899 breath T howling_blast Fluffy_Pillow 83.0/124: 67% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
2:13.243 breath W obliterate Fluffy_Pillow 61.2/124: 49% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:14.588 breath T howling_blast Fluffy_Pillow 74.2/124: 60% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:15.222 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 66.1/124: 53% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:15.932 breath W obliterate Fluffy_Pillow 72.3/124: 58% runic_power
4.0/6: 67% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:17.103 breath W obliterate Fluffy_Pillow 79.1/124: 64% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:18.273 breath T howling_blast Fluffy_Pillow 67.9/124: 55% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:19.445 breath V obliterate Fluffy_Pillow 66.0/124: 53% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:20.615 breath T howling_blast Fluffy_Pillow 79.0/124: 64% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
2:21.788 breath V obliterate Fluffy_Pillow 77.1/124: 62% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
2:22.957 high_prio_actions n remorseless_winter Fluffy_Pillow 83.9/124: 68% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:24.128 cooldowns i pillar_of_frost PR_Death_Knight_Frost 78.3/124: 63% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:24.128 breath V obliterate Fluffy_Pillow 78.3/124: 63% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
2:25.214 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 67.1/124: 54% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
2:25.299 breath W obliterate Fluffy_Pillow 73.3/124: 59% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), dragon_games_equipment, corrupting_rage
2:26.470 breath T howling_blast Fluffy_Pillow 86.3/124: 70% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
2:27.642 breath V obliterate Fluffy_Pillow 78.2/124: 63% runic_power
5.0/6: 83% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
2:28.813 breath T howling_blast Fluffy_Pillow 85.2/124: 69% runic_power
4.0/6: 67% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(7), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:29.984 breath V obliterate Fluffy_Pillow 85.2/124: 69% runic_power
5.0/6: 83% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:31.153 breath T howling_blast Fluffy_Pillow 98.2/124: 79% runic_power
5.0/6: 83% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
2:32.323 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 78.4/124: 63% runic_power
5.0/6: 83% rune		 unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
2:32.323 breath W obliterate Fluffy_Pillow 78.4/124: 63% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
2:33.491 breath V obliterate Fluffy_Pillow 85.2/124: 69% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
2:34.660 breath T howling_blast Fluffy_Pillow 98.2/124: 79% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, rune_of_hysteria, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), corrupting_rage
2:35.830 breath W obliterate Fluffy_Pillow 102.5/124: 83% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), corrupting_rage
2:37.176 Waiting     1.057s 94.2/124: 76% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:38.233 breath W obliterate Fluffy_Pillow 82.4/124: 66% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:39.577 breath T howling_blast Fluffy_Pillow 95.4/124: 77% runic_power
0.0/6: 0% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:40.922 breath V obliterate Fluffy_Pillow 93.5/124: 75% runic_power
3.0/6: 50% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:42.267 breath W obliterate Fluffy_Pillow 82.3/124: 66% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:43.611 high_prio_actions n remorseless_winter Fluffy_Pillow 95.3/124: 77% runic_power
1.0/6: 17% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:44.956 breath V obliterate Fluffy_Pillow 102.1/124: 82% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:46.301 breath Z obliterate Fluffy_Pillow 88.0/124: 71% runic_power
2.0/6: 33% rune		 rune_mastery, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:47.645 Waiting     0.609s 106.0/124: 85% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:48.254 breath V obliterate Fluffy_Pillow 88.0/124: 71% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:49.599 breath V obliterate Fluffy_Pillow 95.0/124: 77% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:50.943 breath T howling_blast Fluffy_Pillow 97.0/124: 78% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(8), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:52.287 breath V obliterate Fluffy_Pillow 69.0/124: 56% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(9), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
2:53.629 breath T howling_blast Fluffy_Pillow 71.0/124: 57% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
2:54.974 breath V obliterate Fluffy_Pillow 66.0/124: 53% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
2:56.318 breath W obliterate Fluffy_Pillow 50.0/124: 40% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
2:57.665 breath T howling_blast Fluffy_Pillow 52.0/124: 42% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
2:59.009 cooldowns i pillar_of_frost PR_Death_Knight_Frost 42.0/124: 34% runic_power
5.0/6: 83% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
2:59.009 breath W obliterate Fluffy_Pillow 42.0/124: 34% runic_power
5.0/6: 83% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
3:00.353 breath W obliterate Fluffy_Pillow 30.8/124: 25% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:01.698 breath T howling_blast Fluffy_Pillow 37.6/124: 30% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:03.043 breath W obliterate Fluffy_Pillow 41.9/124: 34% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
3:04.386 high_prio_actions n remorseless_winter Fluffy_Pillow 30.7/124: 25% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
3:05.733 breath V obliterate Fluffy_Pillow 25.1/124: 20% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
3:07.078 breath W obliterate Fluffy_Pillow 31.9/124: 26% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
3:08.421 breath W obliterate Fluffy_Pillow 26.9/124: 22% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
3:09.765 breath T howling_blast Fluffy_Pillow 33.7/124: 27% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), corrupting_rage
3:11.109 breath V obliterate Fluffy_Pillow 31.8/124: 26% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(7), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:12.455 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 26.8/124: 22% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:12.455 breath W obliterate Fluffy_Pillow 26.8/124: 22% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:13.800 breath T howling_blast Fluffy_Pillow 33.6/124: 27% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:15.144 breath U horn_of_winter PR_Death_Knight_Frost 31.8/124: 26% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:16.489 breath W obliterate Fluffy_Pillow 26.8/124: 22% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:17.833 breath T howling_blast Fluffy_Pillow 33.6/124: 27% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:19.179 single_target s obliterate Fluffy_Pillow 7.5/124: 6% runic_power
6.0/6: 100% rune		 antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:20.526 single_target q howling_blast Fluffy_Pillow 32.5/124: 26% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:21.870 single_target s obliterate Fluffy_Pillow 45.5/124: 37% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
3:23.214 single_target s obliterate Fluffy_Pillow 65.5/124: 53% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
3:24.558 single_target q howling_blast Fluffy_Pillow 90.5/124: 73% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
3:25.901 high_prio_actions m frost_strike Fluffy_Pillow 103.5/124: 83% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), killing_machine, bonegrinder_crit(3), unleashed_frenzy(3)
3:27.245 high_prio_actions n remorseless_winter Fluffy_Pillow 73.5/124: 59% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), killing_machine, unleashed_frenzy(3)
3:28.589 single_target p obliterate Fluffy_Pillow 83.5/124: 67% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3)
3:29.933 single_target r frost_strike Fluffy_Pillow 103.5/124: 83% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(2), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3)
3:31.276 single_target s obliterate Fluffy_Pillow 73.5/124: 59% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), gathering_storm(2), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3)
3:32.621 single_target u arcane_torrent PR_Death_Knight_Frost 98.5/124: 79% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(4), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3)
3:33.968 single_target o frost_strike Fluffy_Pillow 123.5/124: 100% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(4), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3)
3:35.314 single_target p obliterate Fluffy_Pillow 93.5/124: 75% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), gathering_storm(4), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3)
3:36.659 single_target o frost_strike Fluffy_Pillow 118.5/124: 96% runic_power
1.0/6: 17% rune		 icy_talons(3), gathering_storm(6), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:38.004 cooldowns i pillar_of_frost PR_Death_Knight_Frost 88.5/124: 71% runic_power
4.0/6: 67% rune		 icy_talons(3), gathering_storm(6), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:38.004 single_target q howling_blast Fluffy_Pillow 88.5/124: 71% runic_power
4.0/6: 67% rune		 icy_talons(3), gathering_storm(6), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:39.347 single_target r frost_strike Fluffy_Pillow 101.5/124: 82% runic_power
4.0/6: 67% rune		 icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:40.692 single_target s obliterate Fluffy_Pillow 76.5/124: 62% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:42.035 single_target q howling_blast Fluffy_Pillow 96.5/124: 78% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:43.378 single_target o frost_strike Fluffy_Pillow 104.5/124: 84% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:44.721 single_target s obliterate Fluffy_Pillow 74.5/124: 60% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:46.066 single_target q howling_blast Fluffy_Pillow 94.5/124: 76% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, unleashed_frenzy(3), corrupting_rage
3:47.411 high_prio_actions n remorseless_winter Fluffy_Pillow 107.5/124: 87% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), unleashed_frenzy(3), corrupting_rage
3:48.753 single_target o frost_strike Fluffy_Pillow 117.5/124: 95% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, unleashed_frenzy(3), corrupting_rage
3:50.098 single_target s obliterate Fluffy_Pillow 87.5/124: 71% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:51.442 single_target o frost_strike Fluffy_Pillow 112.3/124: 91% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(2), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:52.789 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 82.3/124: 66% runic_power
3.0/6: 50% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(2), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:52.789 single_target q howling_blast Fluffy_Pillow 82.3/124: 66% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(2), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:54.134 single_target p obliterate Fluffy_Pillow 92.2/124: 74% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:55.479 single_target o frost_strike Fluffy_Pillow 117.0/124: 94% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), killing_machine(2), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:56.825 single_target p obliterate Fluffy_Pillow 93.2/124: 75% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(5), killing_machine(2), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
3:58.169 single_target q howling_blast Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, icy_talons(3), gathering_storm(7), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
3:59.514 single_target p obliterate Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, icy_talons(3), killing_machine(2), bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
4:00.860 cooldowns g abomination_limb Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:02.381 high_prio_actions m frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:03.725 cooldowns k raise_dead PR_Death_Knight_Frost 94.0/124: 76% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:03.729 single_target q howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:05.074 cooldowns j breath_of_sindragosa Fluffy_Pillow 102.0/124: 82% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:05.176 trinkets w use_item_blazebinders_hoof Fluffy_Pillow 102.0/124: 82% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:05.176 breath V obliterate Fluffy_Pillow 102.0/124: 82% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
4:06.518 Waiting     0.692s 106.0/124: 85% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
4:07.210 high_prio_actions n remorseless_winter Fluffy_Pillow 94.2/124: 76% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:08.755 breath T howling_blast Fluffy_Pillow 88.6/124: 71% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:10.099 breath V obliterate Fluffy_Pillow 86.7/124: 70% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine(2), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:11.445 breath V obliterate Fluffy_Pillow 81.7/124: 66% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:12.790 breath T howling_blast Fluffy_Pillow 88.5/124: 71% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:14.134 cooldowns i pillar_of_frost PR_Death_Knight_Frost 83.5/124: 67% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(6), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(5)
4:14.134 breath T howling_blast Fluffy_Pillow 83.5/124: 67% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(6), pillar_of_frost, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(5)
4:15.478 breath W obliterate Fluffy_Pillow 55.5/124: 45% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(7), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:16.821 breath T howling_blast Fluffy_Pillow 57.5/124: 46% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:18.165 breath W obliterate Fluffy_Pillow 47.5/124: 38% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:19.510 breath W obliterate Fluffy_Pillow 36.5/124: 29% runic_power
3.0/6: 50% rune		 icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:19.510 cooldowns e empower_rune_weapon PR_Death_Knight_Frost 56.5/124: 46% runic_power
1.0/6: 17% rune		 icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:20.855 breath T howling_blast Fluffy_Pillow 48.5/124: 39% runic_power
2.0/6: 33% rune		 empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:22.026 breath V obliterate Fluffy_Pillow 38.5/124: 31% runic_power
2.0/6: 33% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:23.196 breath U horn_of_winter PR_Death_Knight_Frost 27.5/124: 22% runic_power
0.0/6: 0% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:24.367 breath W obliterate Fluffy_Pillow 34.5/124: 28% runic_power
3.0/6: 50% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(11), bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:25.237 trinkets x use_item_dragon_games_equipment Fluffy_Pillow 41.5/124: 33% runic_power
3.0/6: 50% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(13), rime, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3)
4:25.538 breath T howling_blast Fluffy_Pillow 41.5/124: 33% runic_power
3.0/6: 50% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(13), rime, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), dragon_games_equipment
4:26.710 breath W obliterate Fluffy_Pillow 31.5/124: 25% runic_power
5.0/6: 83% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
4:27.879 high_prio_actions n remorseless_winter Fluffy_Pillow 38.5/124: 31% runic_power
4.0/6: 67% rune		 rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
4:29.048 breath V obliterate Fluffy_Pillow 30.5/124: 25% runic_power
4.0/6: 67% rune		 empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:30.218 breath V obliterate Fluffy_Pillow 19.5/124: 16% runic_power
3.0/6: 50% rune		 empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:31.388 breath a howling_blast Fluffy_Pillow 21.5/124: 17% runic_power
1.0/6: 17% rune		 empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:32.558 high_prio_actions l antimagic_shell PR_Death_Knight_Frost 16.5/124: 13% runic_power
4.0/6: 67% rune		 empower_rune_weapon, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:32.789 single_target p obliterate Fluffy_Pillow 21.5/124: 17% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), gathering_storm(5), killing_machine(2), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:33.961 single_target p obliterate Fluffy_Pillow 46.3/124: 37% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), gathering_storm(7), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:35.133 single_target q howling_blast Fluffy_Pillow 83.5/124: 67% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), gathering_storm(9), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:36.304 single_target s obliterate Fluffy_Pillow 93.4/124: 75% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:37.474 single_target o frost_strike Fluffy_Pillow 118.2/124: 95% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:38.644 single_target o frost_strike Fluffy_Pillow 100.6/124: 81% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, rune_of_hysteria, empower_rune_weapon, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:39.816 single_target s obliterate Fluffy_Pillow 76.8/124: 62% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:41.160 single_target o frost_strike Fluffy_Pillow 107.8/124: 87% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
4:42.504 single_target p obliterate Fluffy_Pillow 84.0/124: 68% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
4:43.847 single_target o frost_strike Fluffy_Pillow 115.0/124: 93% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
4:45.192 single_target p obliterate Fluffy_Pillow 85.0/124: 69% runic_power
5.0/6: 83% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), bonegrinder_frost, unleashed_frenzy(3), corrupting_rage
4:46.537 single_target p obliterate Fluffy_Pillow 116.0/124: 94% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), killing_machine(2), unleashed_frenzy(3), corrupting_rage
4:47.881 high_prio_actions n remorseless_winter Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:49.224 cooldowns h pillar_of_frost PR_Death_Knight_Frost 124.0/124: 100% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:49.224 single_target r frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:50.568 single_target r frost_strike Fluffy_Pillow 100.2/124: 81% runic_power
1.0/6: 17% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:51.914 single_target p obliterate Fluffy_Pillow 70.2/124: 57% runic_power
2.0/6: 33% rune		 unholy_strength, rune_of_hysteria, icy_talons(3), killing_machine(2), pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3)
4:53.260 single_target q howling_blast Fluffy_Pillow 95.0/124: 77% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3)
4:54.604 single_target o frost_strike Fluffy_Pillow 104.9/124: 85% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, rune_of_hysteria, icy_talons(3), gathering_storm(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3)
4:55.949 single_target p obliterate Fluffy_Pillow 81.1/124: 65% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3)
4:57.293 single_target p obliterate Fluffy_Pillow 101.1/124: 82% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), gathering_storm(5), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3)
4:58.637 single_target o frost_strike Fluffy_Pillow 121.1/124: 98% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), gathering_storm(7), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3)
4:59.982 single_target q howling_blast Fluffy_Pillow 96.1/124: 78% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(7), rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3)

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5690 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3848 0 16538 15751 9278
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 330760 315020 0
Runic Power 124 124 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 31.22% 24.64% 2995
Haste 11.86% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 5974 5598 0
Mastery 46.03% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +923 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +111 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +519 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Talents

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowFrost Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=thousandbone_tongueslicer
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
actions.precombat+=/variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h
# Protects Breath from starving itself on ERW charges depending on anticipated resource gains. More resources enable more aggressive use.
actions.precombat+=/variable,name=erw_pooling_time,op=setif,value=30,value_else=45,condition=death_knight.ams_absorb_percent>0.59

# Executed every time the actor is available.
actions=auto_attack
# Choose Action list to run
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/frostscythe,if=!death_and_decay.ticking&equipped.fyralath_the_dreamrender&(cooldown.fyralath_the_dreamrender.remains<3|!dot.mark_of_fyralath.ticking)
actions.aoe+=/obliterate,target_if=min:dot.mark_of_fyralath.remains,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,target_if=min:dot.mark_of_fyralath.remains,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,target_if=min:dot.mark_of_fyralath.remains,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=howling_blast,if=variable.rime_buffs&runic_power>(45-((talent.rage_of_the_frozen_champion*8)+(5*buff.rune_of_hysteria.up)))
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&(buff.killing_machine.react|runic_power>45)
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up
actions.breath+=/death_and_decay,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/remorseless_winter,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/howling_blast,if=runic_power<36&rune.time_to_2>runic_power%18
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=(talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains<6|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up)|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&!buff.empower_rune_weapon.up&((time<10&buff.bloodlust.up)|(runic_power<70&rune<3&(cooldown.breath_of_sindragosa.remains>variable.erw_pooling_time|full_recharge_time<10)))
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<15
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=set_bonus.tier31_2pc&buff.chilling_rage.remains<3
actions.cooldowns+=/chill_streak,if=!set_bonus.tier31_2pc&active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>5))|buff.breath_of_sindragosa.up
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&(runic_power>50&cooldown.empower_rune_weapon.ready|runic_power>60&cooldown.empower_rune_weapon.remains_expected<30|runic_power>80&cooldown.empower_rune_weapon.remains_expected>30)&(variable.adds_remain|variable.st_planning|fight_remains<30)
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react&rune>2|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>50|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
actions.high_prio_actions=invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions.high_prio_actions+=/mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40&death_knight.first_ams_cast<time
actions.high_prio_actions+=/antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.ready|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up))
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions.high_prio_actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!cooldown.pillar_of_frost.ready|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/remorseless_winter,if=variable.rw_buffs|variable.adds_remain

# Obliteration Active Rotation
actions.obliteration=howling_blast,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&buff.rime.react
actions.obliteration+=/frost_strike,target_if=min:dot.mark_of_fyralath.remains,if=(active_enemies<=1|!talent.glacial_advance)&buff.killing_machine.react<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/glacial_advance,if=buff.killing_machine.react<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&(variable.frostscythe_priority|active_enemies>3&!death_and_decay.ticking&equipped.fyralath_the_dreamrender&(cooldown.fyralath_the_dreamrender.remains<3|!dot.mark_of_fyralath.ticking))
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,target_if=min:dot.mark_of_fyralath.remains,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&(!dot.frost_fever.ticking|buff.rime.react&set_bonus.tier30_2pc&!variable.rp_buffs)
actions.obliteration+=/glacial_advance,if=!buff.killing_machine.react&(!death_knight.runeforge.razorice&(!talent.avalanche|debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)|((variable.rp_buffs|rune<2)&active_enemies>1))
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,target_if=min:dot.mark_of_fyralath.remains,if=!buff.killing_machine.react&(rune<2|variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,target_if=min:dot.mark_of_fyralath.remains,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,target_if=min:dot.mark_of_fyralath.remains,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,target_if=min:dot.mark_of_fyralath.remains

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=frost_strike,if=buff.killing_machine.react<2&runic_power.deficit<20+(4*buff.rune_of_hysteria.up)&!variable.2h_check
actions.single_target+=/howling_blast,if=buff.rime.react&set_bonus.tier30_2pc&buff.killing_machine.stack<2
actions.single_target+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25+(5*buff.rune_of_hysteria.up)&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25+(5*buff.rune_of_hysteria.up)|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets
actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking&!buff.pillar_of_frost.up&!buff.bloodlust.up&!buff.empower_rune_weapon.up&!variable.rp_buffs
actions.trinkets+=/use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&cooldown.empower_rune_weapon.charges<1|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&cooldown.empower_rune_weapon.charges<1|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&((variable.damage_trinket_priority=1|trinket.2.cooldown.remains)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&((variable.damage_trinket_priority=2|trinket.1.cooldown.remains)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0&cooldown.pillar_of_frost.remains>20)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions.variables+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions.variables+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions.variables+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
actions.variables+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&buff.pillar_of_frost.remains>10|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon|active_enemies>=2&buff.pillar_of_frost.up
actions.variables+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>8|!death_and_decay.ticking&active_enemies>4))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions.variables+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions.variables+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions.variables+=/variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions.variables+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=9278
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 54864 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
54864.2 54864.2 42.5 / 0.078% 7221.5 / 13.2% 3990.0
APS APS Error APS Range APR
161.9 3.8 / 2.353% 417.7 / 257.9% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.7 7.8 Runic Power 1.38% 52.9 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 54864
Apocalypse 235 (7828) 0.4% (14.3%) 6.8 46.10s 342502 279549 Direct 6.8 (539.6) 8523 17051 10283 20.6% (20.3%)

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.85 6.85 0.00 0.00 0.00 1.2253 0.0000 70392.34 70392.34 0.00% 279549.33 279549.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.36% 5.43 1 8 8523.06 6282 12665 8517.77 6645 10303 46303 46303 0.00%
crit 20.64% 1.41 0 6 17051.42 12934 25089 13536.56 0 24848 24089 24089 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for {$?a134735=false}[every {$s3=2} Festering {$=}LWound:Wounds;][each Festering Wound] you burst. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [U]:5.85
  • if_expr:variable.st_planning&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [Y]:1.00
  • if_expr:debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell CooldownArmy of the Damned2768373ADD-45000.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
    main_hand 9058  / 4010 7.3% 259.4 4.32s 4631 3074 Direct 259.4 3849 7693 4631 20.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 259.37 259.37 0.00 0.00 0.00 1.5061 0.0000 1201012.27 1715775.57 30.00% 3074.47 3074.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.67% 206.64 142 271 3849.12 1915 6291 3853.59 3470 4222 795380 1136286 30.00%
crit 20.33% 52.73 26 91 7693.18 3831 12582 7700.62 6479 8969 405632 579489 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 2166  / 959 1.8% 190.5 5.96s 1508 1508 Direct 190.5 1254 2505 1508 20.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 190.51 190.51 0.00 0.00 0.00 1.0000 0.0000 287379.94 410553.24 30.00% 1508.48 1508.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.64% 151.72 100 204 1253.62 640 2102 1254.63 1136 1368 190203 271725 30.00%
crit 20.36% 38.79 15 64 2505.43 1280 4204 2507.06 2160 3025 97177 138828 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:47.63
    default
    [ ]:47.63
    default
    [ ]:47.63
    default
    [ ]:47.63
    Frostbolt 1418  / 628 1.1% 19.9 14.86s 9449 5983 Direct 19.9 7847 15707 9453 20.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.93 19.92 0.00 0.00 0.00 1.5794 0.0000 188275.45 188275.45 0.00% 5982.70 5982.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.57% 15.85 6 24 7847.45 4172 13323 7851.89 6864 9062 124363 124363 0.00%
crit 20.43% 4.07 0 13 15706.77 8474 26646 15521.27 0 25898 63912 63912 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:20.02
    Shadow Bolt 4510  / 1996 3.6% 62.9 4.52s 9493 6314 Direct 62.9 7896 15783 9498 20.3%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.94 62.91 0.00 0.00 0.00 1.5034 0.0000 597520.22 597520.22 0.00% 6314.35 6314.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.69% 50.13 31 69 7895.70 4108 13058 7902.99 7019 8813 395831 395831 0.00%
crit 20.31% 12.78 3 28 15782.54 7724 26115 15797.75 11906 21599 201689 201689 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:69.69
Army of the Dead 0 (6018) 0.0% (10.9%) 2.0 0.00s 891356 1351653

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6595 0.4688 0.00 0.00 0.00% 202157.92 1351653.31

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    high_prio_actions
    [h]:1.00
  • if_expr:!equipped.fyralath_the_dreamrender&(talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35)
    main_hand 16619  / 3750 6.8% 338.5 0.75s 3282 2534 Direct 338.5 2727 5446 3282 20.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 338.50 338.50 0.00 0.00 0.00 1.2953 0.0000 1111052.05 1587257.68 30.00% 2533.93 2533.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.57% 269.34 225 304 2726.64 1183 4067 2725.45 2233 2991 734373 1049130 30.00%
crit 20.43% 69.16 38 101 5446.48 2366 8134 5443.28 4091 6317 376679 538127 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 3204  / 723 1.3% 206.7 1.36s 1036 1036 Direct 206.7 861 1715 1036 20.5%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 206.74 206.74 0.00 0.00 0.00 1.0000 0.0000 214184.97 305986.33 30.00% 1035.99 1035.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.51% 164.39 134 187 860.97 395 1359 860.67 699 946 141532 202193 30.00%
crit 20.49% 42.36 23 69 1715.34 791 2718 1714.30 1284 2030 72653 103793 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:25.37
    default
    [ ]:27.30
    default
    [ ]:26.02
    default
    [ ]:27.26
    default
    [ ]:26.18
    default
    [ ]:24.47
    default
    [ ]:25.16
    default
    [ ]:24.97
    Frostbolt 1364  / 276 0.5% 8.0 31.19s 10234 7206 Direct 8.0 8521 16917 10234 20.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.00 1.4201 0.0000 81868.11 81868.11 0.00% 7206.07 7206.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.60% 6.37 2 8 8520.99 4041 13698 8522.05 4843 11084 54262 54262 0.00%
crit 20.40% 1.63 0 6 16917.35 8082 27019 14172.24 0 27019 27606 27606 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:8.00
    Shadow Bolt 6262  / 1268 2.3% 35.8 6.34s 10481 7971 Direct 35.8 8711 17389 10481 20.4%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.85 35.85 0.00 0.00 0.00 1.3149 0.0000 375725.59 375725.59 0.00% 7971.27 7971.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.60% 28.53 19 37 8710.99 3800 13058 8706.36 6699 9933 248556 248556 0.00%
crit 20.40% 7.31 0 17 17389.10 7601 26115 17374.66 0 25059 127169 127169 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:37.85
auto_attack_mh 2707 4.9% 147.1 2.46s 5518 2260 Direct 147.1 4588 9176 5518 20.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 147.08 147.08 0.00 0.00 0.00 2.4416 0.0000 811594.94 1159450.90 30.00% 2260.00 2260.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.73% 117.27 80 160 4588.01 3685 6722 4587.25 4343 4820 538046 768657 30.00%
crit 20.27% 29.81 12 55 9176.06 7371 13443 9174.24 8314 10020 273549 390794 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 93 0.2% 2.0 0.00s 13764 0 Direct 2.0 11347 22599 13763 21.5%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 27529.00 27529.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.53% 1.57 0 3 11347.45 10003 14469 10836.92 0 14469 17822 17822 0.00%
crit 21.47% 0.43 0 2 22598.55 20006 28510 8685.51 0 28510 9707 9707 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Clawing Shadows 7533 13.8% 70.8 4.12s 31902 26790 Direct 70.8 26520 53000 31902 20.3%

Stats Details: Clawing Shadows

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 70.75 70.75 0.00 0.00 0.00 1.1908 0.0000 2257099.66 2257099.66 0.00% 26789.86 26789.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.67% 56.37 34 80 26519.87 12284 50431 26544.56 21895 31170 1494940 1494940 0.00%
crit 20.33% 14.38 2 31 52999.89 26514 102330 53044.11 37047 70112 762160 762160 0.00%

Action Details: Clawing Shadows

  • id:207311
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207311
  • name:Clawing Shadows
  • school:shadow
  • tooltip:
  • description:Deals {$s2=0} Shadow damage and causes 1 Festering Wound to burst.

Action Priority List

    st
    [n]:70.52
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    st
    [q]:0.23
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Rotten Touch39027610.500
Dark Transformation 0 (203) 0.0% (0.4%) 7.0 45.92s 8754 6927

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.97 0.00 0.00 0.00 0.00 1.2638 0.0000 0.00 0.00 0.00% 6927.48 6927.48

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [T]:5.97
  • if_expr:cooldown.apocalypse.remains<5
    garg_setup
    [d]:1.00
  • if_expr:talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownUnholy Command3169411ADD-15000.000
    Dark Transformation (_damage) 203 0.4% 0.0 0.00s 0 0 Direct 7.0 7266 14488 8754 20.6%

Stats Details: Dark Transformation Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 6.97 0.00 0.00 0.00 0.0000 0.0000 60975.71 60975.71 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.39% 5.53 1 8 7266.41 5753 10652 7263.70 6227 8576 40183 40183 0.00%
crit 20.61% 1.44 0 6 14487.54 11889 21304 11501.43 0 21304 20793 20793 0.00%

Action Details: Dark Transformation Damage

  • id:344955
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344955
  • name:Dark Transformation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc63560=Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Death and Decay 263 0.5% 8.5 36.20s 9239 7796 Periodic 92.9 705 1412 850 20.4% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.55 0.00 0.00 92.94 0.00 1.1852 0.0000 78960.74 78960.74 0.00% 7795.51 7795.51
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.59% 73.97 41 112 705.43 447 1186 705.95 639 791 52181 52181 0.00%
crit 20.41% 18.96 3 38 1412.09 958 2340 1413.05 1167 1734 26780 26780 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    garg_setup
    [Z]:1.00
  • if_expr:!death_and_decay.ticking&debuff.festering_wound.stack>1
    st
    [m]:7.55
  • if_expr:!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Death Coil 7055 (9134) 12.9% (16.7%) 96.3 3.08s 28413 23542 Direct 96.3 (233.4) 18235 36497 21957 20.4% (20.4%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.34 96.29 0.00 0.00 0.00 1.2069 0.0000 2114291.38 2114291.38 0.00% 23541.75 23541.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.62% 76.66 49 103 18235.00 11121 31038 18243.91 17031 19530 1397959 1397959 0.00%
crit 20.38% 19.63 4 36 36497.25 24166 61762 36514.91 30621 44601 716332 716332 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Details: Death Coil Damage

  • id:47632
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47632
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fire a blast of unholy energy, causing Shadow damage to an enemy target or healing a friendly Undead target.

Action Priority List

    high_prio_actions
    [i]:5.68
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>27|debuff.death_rot.up&debuff.death_rot.remains<gcd)
    st
    [l]:82.59
  • if_expr:!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
    st
    [p]:8.07

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountImproved Death Coil3775801PCT0.300
Spell TargetsImproved Death Coil3775802ADD1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Percent Cost Sudden Doom813401-1.000Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
    Coil of Devastation 2079 3.8% 0.0 0.00s 0 0 Periodic 137.1 4542 0 4542 0.0% 91.4%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 137.14 137.14 82.03 0.0000 2.0000 622931.36 622931.36 0.00% 2271.13 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 137.14 103 173 4542.28 1751 21599 4548.19 3849 5450 622931 622931 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 928 1.7% 6.8 46.67s 40804 0 Direct 6.8 33983 67977 40835 20.2%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.83 6.83 0.00 0.00 0.00 0.0000 0.0000 278796.70 398291.16 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.84% 5.45 0 9 33982.59 33373 35042 33993.44 0 35042 185248 264647 29.99%
crit 20.16% 1.38 0 7 67976.80 66746 70083 52031.38 0 70083 93549 133644 22.96%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1500 2.7% 22.7 13.23s 19831 16327 Direct 22.7 16478 32919 19832 20.4%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.68 22.68 0.00 0.00 0.00 1.2146 0.0000 449853.37 642664.06 30.00% 16327.43 16327.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.60% 18.06 8 28 16478.11 11696 27848 16460.37 14033 18523 297550 425083 30.00%
crit 20.40% 4.63 0 14 32918.70 23392 53568 32659.28 0 52074 152303 217581 29.80%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [e]:1.00
  • if_expr:debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
    st
    [o]:21.68
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack<4
  • target_if_expr:debuff.festering_wound.stack

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountImproved Festering Strike3168671PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Festering Wound 2414 4.4% 98.1 3.79s 7373 0 Direct 98.1 6125 12269 7373 20.3%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 98.13 98.13 0.00 0.00 0.00 0.0000 0.0000 723534.62 723534.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.69% 78.20 50 107 6125.24 4230 11236 6126.47 5716 6565 479012 479012 0.00%
crit 20.31% 19.93 6 41 12268.77 8215 22472 12267.34 10232 15457 244523 244523 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountImproved Festering Strike3168671PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Outbreak 84 0.2% 11.6 27.02s 2162 1778 Direct 11.6 1796 3586 2162 20.5%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.2160 0.0000 25133.10 25133.10 0.00% 1778.08 1778.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.54% 9.25 3 14 1795.68 1269 3155 1796.33 1443 2201 16603 16603 0.00%
crit 20.46% 2.38 0 9 3585.94 2537 6311 3331.06 0 6311 8531 8531 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    high_prio_actions
    [j]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Raise Dead 0 (7635) 0.0% (13.9%) 1.0 0.00s 2285993 0

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
    auto_attack 5291  / 5291 9.7% 186.1 1.61s 8513 5295 Direct 186.1 7078 14139 8513 20.3%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 186.06 186.06 0.00 0.00 0.00 1.6079 0.0000 1584002.60 2262918.56 30.00% 5294.80 5294.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.67% 148.23 101 189 7077.76 2387 18232 7087.33 6350 8027 1049150 1498824 30.00%
crit 20.33% 37.83 16 63 14138.55 4774 36463 14155.10 9298 19917 534852 764094 30.00%

Action Details: Auto Attack

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:1.00
    Sweeping Claws 1932  / 1932 3.5% 63.3 4.63s 9139 9098 Direct 63.3 7599 15172 9139 20.3%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.26 63.26 0.00 0.00 0.00 1.0045 0.0000 578126.74 578126.74 0.00% 9097.77 9097.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.67% 50.40 32 69 7598.84 5294 13479 7601.90 7023 8274 382975 382975 0.00%
crit 20.33% 12.86 2 26 15172.47 10588 26958 15177.21 11359 19549 195151 195151 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:63.26
    Claw 411  / 411 0.8% 39.1 7.81s 3161 3147 Direct 39.1 2629 5255 3161 20.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.06 39.06 0.00 0.00 0.00 1.0045 0.0000 123457.02 176371.67 30.00% 3146.60 3146.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.75% 31.15 16 47 2628.82 2148 11067 2627.10 2408 2944 81884 116980 30.00%
crit 20.25% 7.91 0 20 5255.45 4297 17314 5251.84 0 6772 41573 59391 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:39.06
  • if_expr:energy>70
    Gnaw 1  / 1 0.0% 3.7 90.13s 109 109 Direct 3.7 90 181 109 20.7%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0045 0.0000 407.13 581.62 30.00% 108.65 108.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.32% 2.96 0 4 90.42 76 119 90.06 0 109 268 382 29.89%
crit 20.68% 0.77 0 4 180.86 152 234 104.20 0 234 140 199 17.29%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:3.73
Soul Reaper 707 (3991) 1.3% (7.3%) 15.5 6.90s 77281 61095 Direct 15.5 (31.0) 11385 22776 13682 20.2% (20.3%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.51 15.51 0.00 0.00 0.00 1.2650 0.0000 212279.02 212279.02 0.00% 61094.89 61094.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.83% 12.39 4 19 11384.96 6859 17487 11397.23 9949 12909 141004 141004 0.00%
crit 20.17% 3.13 0 11 22775.99 13718 34472 21958.54 0 34472 71275 71275 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [X]:15.51
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370075PCT0.150

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
    Soul Reaper (_execute) 3285 6.0% 15.5 6.90s 63604 0 Direct 15.5 52879 105520 63602 20.4%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.51 15.51 0.00 0.00 0.00 0.0000 0.0000 986708.14 986708.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.63% 12.35 5 19 52878.51 40911 81395 52947.29 46223 61595 653174 653174 0.00%
crit 20.37% 3.16 0 10 105519.82 81822 160471 102164.77 0 158168 333534 333534 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050
Spell Direct AmountUnholy Death Knight1370075PCT0.150

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Razorice5171410.036
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Summon Gargoyle 0 (2934) 0.0% (5.3%) 2.0 184.83s 434551 0

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [S]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead
    garg_setup
    [a]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
    Gargoyle Strike 17382  / 2934 5.3% 27.3 7.78s 31832 20403 Direct 27.3 26486 52693 31832 20.4%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.30 27.30 0.00 0.00 0.00 1.5602 0.0000 869101.93 869101.93 0.00% 20402.89 20402.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.60% 21.73 12 28 26486.27 7771 59268 26480.22 20191 32923 575637 575637 0.00%
crit 20.40% 5.57 0 14 52693.46 15541 113687 52485.68 0 108653 293465 293465 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.
Unholy Assault 376 0.7% 3.7 91.24s 30811 26907 Direct 3.7 25601 51325 30810 20.3%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.66 3.66 0.00 0.00 0.00 1.1453 0.0000 112633.70 112633.70 0.00% 26907.24 26907.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.75% 2.92 0 4 25601.17 20349 34541 25541.66 0 34212 74634 74634 0.00%
crit 20.25% 0.74 0 4 51325.20 40697 69082 28915.49 0 67766 38000 38000 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Damage increased by {$s4=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing all damage done by {$s4=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [W]:3.31
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [c]:0.35
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Virulent Plague 1223 2.2% 11.6 27.02s 31573 0 Periodic 99.5 3063 6126 3689 20.4% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.50 99.50 10.62 0.0000 3.0000 367031.74 367031.74 0.00% 1229.62 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.56% 79.16 52 105 3062.71 2139 5836 3063.00 2837 3236 242434 242434 0.00%
crit 20.44% 20.34 5 39 6125.63 4545 11673 6125.72 5280 7516 124597 124597 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.172500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountUnholy Death Knight1370071PCT-0.050
Spell Periodic AmountUnholy Death Knight1370072PCT-0.050

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Amplify Damage42494910.050Spell Data
Ghoulish Infusion39489910.080Spell Data
Unholy Assault20728940.200Spell Data
Mastery: Dreadblade7751511.800Spell DataMastery
Periodic Damage Amplify Damage42494920.050Spell Data
Ghoulish Infusion39489930.080Spell Data
Unholy Assault20728950.200Spell Data
Mastery: Dreadblade7751521.800Spell DataMastery
Tick Time Plaguebringer3901781-0.500Spell Data
Dot / Debuff on Target War32709610.012
Tightening Grasp37477610.050
Ashen Decay42571920.200
Brittle37455710.060
Death Rot37754010.010
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 0
Anti-Magic Shell 164 101.1% 6.9 45.84s 7115 0 Direct 3.1 15824 0 15824 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.91 3.11 0.00 0.00 0.00 0.0000 0.0000 49183.01 49183.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.11 0 14 15823.90 15824 15824 13456.33 0 15824 49183 49183 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [f]:6.91
  • if_expr:runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownAnti-Magic Barrier2057271ADD-20000.000
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Algeth'ar Puzzle (_box_channel) 2.0 0.00s

Stats Details: Algethar Puzzle Box Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 2.00 0.00 0.00 1.5530 1.5530 0.00 0.00 0.00% 0.00 0.00

Action Details: Algethar Puzzle Box Channel

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 184.77s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [k]:2.00
  • if_expr:(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
Empower Rune Weapon 2.4 167.60s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.40 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [V]:2.06
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
    garg_setup
    [b]:0.35
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Modify Cooldown Charge (Category)Empower Rune Weapon3929621SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:382154
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Outbreak (_aoe) 11.6 27.02s

Stats Details: Outbreak Aoe

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Outbreak Aoe

  • id:196780
  • school:shadow
  • range:200.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196780
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:{$@spelldesc77575=Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}}
Elemental Potion of Ultimate Power 1.5 304.64s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    high_prio_actions
    [g]:1.46
  • if_expr:(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Unholy Strength 20.7 14.12s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 181.8s 181.8s 30.0s 20.27% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1411.05

Trigger Details

  • interval_min/max:181.8s / 183.6s
  • trigger_min/max:181.8s / 183.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s
  • uptime_min/max:16.67% / 25.00%

Stack Uptimes

  • algethar_puzzle_1:20.27%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Anti-Magic Shell 6.9 0.0 45.8s 45.8s 6.9s 15.99% 18.28% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.40
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 123.6s
  • trigger_min/max:40.0s / 123.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:11.36% / 17.85%

Stack Uptimes

  • antimagic_shell_1:15.99%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Berserking 2.0 0.0 184.8s 184.8s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.0s / 196.4s
  • trigger_min/max:181.0s / 196.4s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Commander of the Dead 7.0 0.0 45.9s 45.9s 28.6s 66.46% 87.77% 0.0 (0.0) 6.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 60.4s
  • trigger_min/max:45.0s / 60.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:61.78% / 69.13%

Stack Uptimes

  • commander_of_the_dead_1:66.46%

Spelldata

  • id:390260
  • name:Commander of the Dead
  • tooltip:Your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead ghouls deal {$390264s1=35}% increased damage.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.6s 58.1s 50.0s 80.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 347.0s
  • trigger_min/max:15.0s / 316.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.6s
  • uptime_min/max:48.32% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.09%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Transformation 7.0 0.0 45.9s 45.9s 21.9s 50.85% 55.28% 0.0 (0.0) 6.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 60.4s
  • trigger_min/max:45.0s / 60.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.0s
  • uptime_min/max:44.84% / 57.83%

Stack Uptimes

  • dark_transformation_1:50.85%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Dragon Games Equipment 2.7 0.0 120.0s 120.0s 0.8s 0.71% 0.00% 6.8 (6.8) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.74
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.0s
  • trigger_min/max:120.0s / 120.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s
  • uptime_min/max:0.54% / 0.91%

Stack Uptimes

  • dragon_games_equipment_1:0.71%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 304.7s 304.7s 27.3s 13.08% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 326.8s
  • trigger_min/max:300.0s / 326.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.83% / 17.93%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.08%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 167.6s 167.6s 19.3s 15.39% 0.00% 7.0 (7.0) 2.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 196.6s
  • trigger_min/max:120.0s / 196.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:12.63% / 18.23%

Stack Uptimes

  • empower_rune_weapon_1:15.39%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Festermight 13.1 64.5 23.3s 3.8s 19.3s 84.10% 0.00% 0.0 (0.0) 12.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 41.9s
  • trigger_min/max:0.8s / 27.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:73.82% / 91.17%

Stack Uptimes

  • festermight_1:7.92%
  • festermight_2:8.25%
  • festermight_3:8.56%
  • festermight_4:16.46%
  • festermight_5:11.30%
  • festermight_6:10.09%
  • festermight_7:8.09%
  • festermight_8:5.59%
  • festermight_9:3.56%
  • festermight_10:1.86%
  • festermight_11:0.85%
  • festermight_12:0.63%
  • festermight_13:0.54%
  • festermight_14:0.33%
  • festermight_15:0.08%
  • festermight_16:0.01%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 95.3 159.7s 3.1s 293.1s 98.53% 0.00% 93.3 (93.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:46.7s / 280.7s
  • trigger_min/max:0.8s / 14.6s
  • trigger_pct:100.00%
  • duration_min/max:32.6s / 355.6s
  • uptime_min/max:96.69% / 98.80%

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.85%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 11.9 7.7 25.0s 14.9s 10.5s 41.66% 0.00% 7.7 (7.7) 11.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 163.3s
  • trigger_min/max:0.8s / 158.2s
  • trigger_pct:14.90%
  • duration_min/max:0.0s / 55.1s
  • uptime_min/max:14.41% / 66.87%

Stack Uptimes

  • rune_mastery_1:41.66%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 39.8 6.4 7.5s 6.4s 2.8s 36.85% 0.00% 6.4 (6.4) 39.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 72.4s
  • trigger_min/max:0.8s / 71.1s
  • trigger_pct:47.95%
  • duration_min/max:0.0s / 20.7s
  • uptime_min/max:21.25% / 52.07%

Stack Uptimes

  • runic_corruption_1:36.85%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 19.6 0.7 14.9s 14.4s 1.4s 9.31% 0.00% 0.7 (0.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.6s / 57.9s
  • trigger_min/max:1.6s / 55.7s
  • trigger_pct:14.18%
  • duration_min/max:0.0s / 11.3s
  • uptime_min/max:1.84% / 21.15%

Stack Uptimes

  • sudden_doom_1:9.31%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.7 0.0 91.2s 91.2s 19.5s 23.80% 29.46% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.7s
  • trigger_min/max:90.0s / 97.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:21.04% / 26.72%

Stack Uptimes

  • unholy_assault_1:23.80%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Damage increased by {$s4=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing all damage done by {$s4=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Ground 8.5 0.0 36.2s 36.2s 9.9s 28.16% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 128.9s
  • trigger_min/max:10.0s / 128.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.6s
  • uptime_min/max:18.36% / 36.85%

Stack Uptimes

  • unholy_ground_1:28.16%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 12.2 35.9s 14.1s 23.9s 67.56% 0.00% 12.2 (12.2) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 162.6s
  • trigger_min/max:0.0s / 58.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 156.6s
  • uptime_min/max:41.28% / 92.88%

Stack Uptimes

  • unholy_strength_1:67.56%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 183.9s 183.9s 24.5s 98.03% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.7s / 196.9s
  • trigger_min/max:180.7s / 196.9s
  • trigger_pct:100.00%
  • duration_min/max:21.0s / 25.0s
  • uptime_min/max:90.13% / 98.07%

Stack Uptimes

  • dark_empowerment_1:98.03%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (sizzling_seafood_medley)

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sizzling_seafood_medley
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:67.37
  • stat:mastery_rating
  • amount:67.37

Spelldata

  • id:382154
  • name:Well Fed
  • tooltip:Haste and mastery increased by {$=}w1.
  • description:Increases Haste and Mastery by {$s1=45} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 24.5 10.0 46.0 11.9s 1.6s 130.0s
Rune ready 151.0 115.0 190.0 2.1s 0.0s 13.6s
Runic Corruption from Runic Power Spent 46.2 25.0 71.0 6.4s 0.8s 71.1s
Festering Wound from Festering Strike 56.7 35.0 78.0 13.2s 1.1s 87.3s
Festering Wound from Infected Claws 30.7 12.0 55.0 9.7s 1.0s 106.1s
Festering Wound from Unholy Assault 14.6 12.0 16.0 91.2s 90.0s 97.7s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.08% 0.00% 9.50% 1.5s 0.0s 10.7s
ghoul - Energy Cap 0.36% 0.04% 1.36% 0.2s 0.0s 1.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Raise Dead0.0000.0000.000300.000240.008359.984
Army of the Dead6.5410.000144.95713.0830.000144.957
Summon Gargoyle4.1001.70617.8918.2005.09521.280
Apocalypse2.0470.00015.82714.1598.28731.539
Unholy Assault3.0580.0008.24211.1827.25817.523
Dark Transformation1.2690.00015.4228.8734.44924.128
Empower Rune Weapon31.0830.00076.59574.69267.790101.220
Death and Decay6.4050.00079.51758.1147.128139.448
Soul Reaper13.1870.000234.194206.994162.008257.760
Anti-Magic Shell5.9320.00083.64041.85126.562119.368

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=346102)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1352.046 / 1.3226.47825.748
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
40.67361.85894.421 / 92.669132.353188.129

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
Anti-Magic ShellRunic Power3.1115.380.66%4.950.161.01%
ApocalypseRune13.6912.868.52%0.940.836.05%
Empower Rune WeaponRunic Power11.5356.182.41%4.871.452.52%
Empower Rune WeaponRune11.5310.807.15%0.940.726.27%
Festering WoundRunic Power98.13292.0412.54%2.982.360.80%
Rune RegenerationRune127.34127.3484.33%1.000.000.00%
Runic AttenuationRunic Power71.72351.0515.07%4.897.552.11%
Army of the DeadRunic Power2.0019.740.85%9.870.261.29%
Clawing ShadowsRunic Power70.75707.5130.38%10.000.000.00%
Death and DecayRunic Power8.5585.463.67%10.000.000.00%
Festering StrikeRunic Power22.68453.6819.48%20.000.000.00%
OutbreakRunic Power11.62112.354.82%9.663.903.35%
Soul ReaperRunic Power15.51148.836.39%9.596.324.07%
Summon GargoyleRunic Power2.0086.933.73%43.4613.0713.07%
pet - ghoul
Dark TransformationEnergy6.97316.097.85%45.38380.4354.62%
Energy RegenEnergy1341.083709.3092.15%2.7722.030.59%
pet - army_ghoul
Energy RegenEnergy849.706912.14100.00%8.13451.956.14%
pet - apoc_ghoul
Energy RegenEnergy676.165272.25100.00%7.801557.7122.81%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.30%1.001.00891355.94
Clawing ShadowsRune 70.7570.7546.00%1.001.0031901.91
Death and DecayRune 8.558.555.56%1.001.009239.43
Death CoilRunic Power 96.342303.70100.00%23.9123.911188.18
Festering StrikeRune 22.6845.3729.50%2.002.009915.64
OutbreakRune 11.6211.627.56%1.001.002162.02
Soul ReaperRune 15.5115.5110.09%1.001.0077280.56
pet - ghoul
ClawEnergy 39.061562.3538.17%40.0040.0079.02
Sweeping ClawsEnergy 63.262530.4861.83%40.0040.00228.46
pet - army_ghoul
ClawEnergy 206.748269.65100.00%40.0040.0025.90
pet - apoc_ghoul
ClawEnergy 190.517620.51100.00%40.0040.0037.71
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 327940.0 763.55 880.90 259054.1 292733.3 17759.9 327940.0
Runic Power 8.0 7.76 7.69 35.1 23.5 0.0 79.0
Rune 5.0 0.50 0.51 0.0 3.2 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 54864.19
Minimum 48935.13
Maximum 61816.96
Spread ( max - min ) 12881.83
Range [ ( max - min ) / 2 * 100% ] 11.74%
Standard Deviation 1879.3915
5th Percentile 52031.73
95th Percentile 58212.92
( 95th Percentile - 5th Percentile ) 6181.19
Mean Distribution
Standard Deviation 21.7028
95.00% Confidence Interval ( 54821.65 - 54906.73 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4508
0.1 Scale Factor Error with Delta=300 30153
0.05 Scale Factor Error with Delta=300 120609
0.01 Scale Factor Error with Delta=300 3015215
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 54864.19
Minimum 48935.13
Maximum 61816.96
Spread ( max - min ) 12881.83
Range [ ( max - min ) / 2 * 100% ] 11.74%
Standard Deviation 1879.3915
5th Percentile 52031.73
95th Percentile 58212.92
( 95th Percentile - 5th Percentile ) 6181.19
Mean Distribution
Standard Deviation 21.7028
95.00% Confidence Interval ( 54821.65 - 54906.73 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4508
0.1 Scale Factor Error with Delta=300 30153
0.05 Scale Factor Error with Delta=300 120609
0.01 Scale Factor Error with Delta=300 3015215
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 54864.19
Minimum 48935.13
Maximum 61816.96
Spread ( max - min ) 12881.83
Range [ ( max - min ) / 2 * 100% ] 11.74%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 9199745.52
Minimum 6846045.68
Maximum 11550537.89
Spread ( max - min ) 4704492.20
Range [ ( max - min ) / 2 * 100% ] 25.57%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 880.65
Minimum 0.00
Maximum 2362.46
Spread ( max - min ) 2362.46
Range [ ( max - min ) / 2 * 100% ] 134.13%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 761.56
Minimum 0.00
Maximum 1891.22
Spread ( max - min ) 1891.22
Range [ ( max - min ) / 2 * 100% ] 124.17%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2,if=!equipped.fyralath_the_dreamrender
6 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
7 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
A 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
B 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
E 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
F 0.00 variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl
Default action list Executed every time the actor is available.
# count action,conditions
G 1.00 auto_attack
H 0.00 call_action_list,name=variables
Call Action Lists
I 0.00 call_action_list,name=high_prio_actions
J 0.00 call_action_list,name=trinkets
K 0.00 run_action_list,name=garg_setup,if=variable.garg_setup_complete=0
L 0.00 call_action_list,name=cooldowns,if=variable.st_planning
M 0.00 call_action_list,name=aoe_cooldowns,if=variable.adds_remain
N 0.00 call_action_list,name=racials
O 0.00 call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
P 0.00 call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
Q 0.00 call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
R 0.00 call_action_list,name=st,if=active_enemies<=3
actions.cooldowns
# count action,conditions
S 1.00 summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
ST/Cleave Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
T 5.97 dark_transformation,if=cooldown.apocalypse.remains<5
U 5.85 apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
V 2.06 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 abomination_limb,if=rune<3&variable.st_planning
W 3.31 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
X 15.51 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.garg_setup
# count action,conditions
Y 1.00 apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)
Garg Setup
0.00 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
Z 1.00 any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>1
a 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
b 0.35 empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=23
c 0.35 unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=23
d 1.00 dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
e 1.00 festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
0.00 death_coil,if=rune<=1
actions.high_prio_actions
# count action,conditions
0.00 mind_freeze,if=target.debuff.casting.react
Priority Actions
f 6.91 antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
0.00 antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle))
0.00 antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
0.00 invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=22|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.army_ghoul.remains<=18|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+10>cooldown.invoke_external_buff.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
g 1.46 potion,if=(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
h 1.00 army_of_the_dead,if=!equipped.fyralath_the_dreamrender&(talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35)
i 5.68 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>27|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
j 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
0.00 army_of_the_dead,if=equipped.fyralath_the_dreamrender&(talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35)
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration+3
k 2.00 berserking,if=(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(18>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=18|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|active_enemies>=2&death_and_decay.ticking)|fight_remains<=18
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration+3
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.st
# count action,conditions
l 82.59 death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
Single Target
0.00 epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
m 7.55 any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)
n 70.52 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
o 21.68 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4
p 8.07 death_coil
q 0.23 wound_spender,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack>=4
actions.trinkets
# count action,conditions
0.00 use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking
Trinkets
r 2.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<16|!talent.summon_gargoyle&pet.army_ghoul.active&pet.army_ghoul.remains<16)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(variable.damage_trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
s 2.74 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(variable.damage_trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
0.00 use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGjreZdagiifibcYlnolnkmlnlonlnjlnnlonlnnlnnlsllonnlolnnnlllfjTolmUlnolnllnonnpopjlnnpponnlnlfnpnpTloWUjmlnllnlnnlonlnlnnojlfllnnpopTonlUmlnosnlljnlnpollnnlnlnlnpopnrhjTSiiVWUXlmnkllXllnlfnXmlojlXllnnXlnloXllloXTlljUXmnniXlflnlXolnlXnlnjXlnnlsXnllnTXWmUiXlfnjlXlnolnn

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 4 raise_dead PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 5 army_of_the_dead PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 corrupting_rage
Pre precombat 6 trinket_1_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat 7 trinket_2_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat A trinket_1_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat B trinket_2_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat E trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
Pre precombat F damage_trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
0:00.000 default G auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 rune_mastery, corrupting_rage
0:00.000 high_prio_actions j outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, corrupting_rage
0:00.000 trinkets r use_item_algethar_puzzle_box Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, corrupting_rage
0:01.355 garg_setup e festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, algethar_puzzle, corrupting_rage
0:02.373 garg_setup Z death_and_decay Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, algethar_puzzle, corrupting_rage
0:03.390 garg_setup d dark_transformation PR_Death_Knight_Unholy 53.0/100: 53% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, algethar_puzzle, corrupting_rage
0:03.390 garg_setup a summon_gargoyle PR_Death_Knight_Unholy 53.0/100: 53% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:04.359 high_prio_actions g potion Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:04.359 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:05.327 high_prio_actions i death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.295 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 40.0/100: 40% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons(2), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.295 high_prio_actions i death_coil Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(2), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.264 garg_setup b empower_rune_weapon PR_Death_Knight_Unholy 10.0/100: 10% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.264 garg_setup c unholy_assault Fluffy_Pillow 15.0/100: 15% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:08.109 garg_setup Y apocalypse Fluffy_Pillow 15.0/100: 15% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:08.951 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.795 st n clawing_shadows Fluffy_Pillow 2.0/100: 2% runic_power
6.0/6: 100% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:10.638 st o festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:11.483 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:12.326 st n clawing_shadows Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune		 bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.168 racials k berserking PR_Death_Knight_Unholy 28.0/100: 28% runic_power
3.0/6: 50% rune		 bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.168 st m death_and_decay Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune		 bloodlust, berserking, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.971 st l death_coil Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:14.736 st n clawing_shadows Fluffy_Pillow 13.0/100: 13% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:15.504 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:16.272 st o festering_strike Fluffy_Pillow 1.0/100: 1% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:17.036 st n clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune		 bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:17.802 st l death_coil Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune		 bloodlust, berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:18.567 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:19.333 high_prio_actions j outbreak Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:20.101 st l death_coil Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune		 bloodlust, berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:20.866 st n clawing_shadows Fluffy_Pillow 47.0/100: 47% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:21.632 st n clawing_shadows Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:22.398 st l death_coil Fluffy_Pillow 83.0/100: 83% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:23.164 st o festering_strike Fluffy_Pillow 58.0/100: 58% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:23.930 st n clawing_shadows Fluffy_Pillow 78.0/100: 78% runic_power
2.0/6: 33% rune		 bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:24.733 st l death_coil Fluffy_Pillow 96.0/100: 96% runic_power
1.0/6: 17% rune		 bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:25.538 st n clawing_shadows Fluffy_Pillow 66.0/100: 66% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:26.423 st n clawing_shadows Fluffy_Pillow 79.0/100: 79% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:27.309 st l death_coil Fluffy_Pillow 97.0/100: 97% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(14), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:28.327 st n clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:29.344 st n clawing_shadows Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:30.363 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(2), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:31.380 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(2), commander_of_the_dead, elemental_potion_of_ultimate_power
0:31.380 st l death_coil Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(2), commander_of_the_dead, dragon_games_equipment, elemental_potion_of_ultimate_power
0:32.396 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(2), commander_of_the_dead, elemental_potion_of_ultimate_power
0:33.415 st o festering_strike Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2), elemental_potion_of_ultimate_power
0:34.432 st n clawing_shadows Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(2)
0:35.450 st n clawing_shadows Fluffy_Pillow 76.0/100: 76% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(3)
0:36.467 st l death_coil Fluffy_Pillow 89.0/100: 89% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(4)
0:37.485 st o festering_strike Fluffy_Pillow 64.0/100: 64% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(4)
0:38.502 st l death_coil Fluffy_Pillow 84.0/100: 84% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(4)
0:39.521 st n clawing_shadows Fluffy_Pillow 54.0/100: 54% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
0:40.539 st n clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
0:41.862 st n clawing_shadows Fluffy_Pillow 80.0/100: 80% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
0:43.184 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(7), corrupting_rage
0:44.505 st l death_coil Fluffy_Pillow 68.0/100: 68% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(7), corrupting_rage
0:45.828 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(7), corrupting_rage
0:47.150 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 13.0/100: 13% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(7), corrupting_rage
0:47.150 high_prio_actions j outbreak Fluffy_Pillow 13.0/100: 13% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(7), corrupting_rage
0:48.471 cooldowns T dark_transformation PR_Death_Knight_Unholy 23.0/100: 23% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, icy_talons(3), corrupting_rage
0:49.792 st o festering_strike Fluffy_Pillow 23.0/100: 23% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:51.113 st l death_coil Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:52.436 st m death_and_decay Fluffy_Pillow 13.0/100: 13% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:53.760 cooldowns U apocalypse Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:55.019 st l death_coil Fluffy_Pillow 35.0/100: 35% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
0:56.279 st n clawing_shadows Fluffy_Pillow 5.0/100: 5% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead, corrupting_rage
0:57.536 st o festering_strike Fluffy_Pillow 23.0/100: 23% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
0:58.795 st l death_coil Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
1:00.054 st n clawing_shadows Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
1:01.313 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
1:02.572 st l death_coil Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, festermight(6), commander_of_the_dead, corrupting_rage
1:03.894 st n clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
5.0/6: 83% rune		 rune_mastery, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
1:05.215 st o festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead, corrupting_rage
1:06.536 st n clawing_shadows Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
1:07.858 st n clawing_shadows Fluffy_Pillow 57.0/100: 57% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, corrupting_rage
1:09.179 st p death_coil Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead, corrupting_rage
1:10.498 st o festering_strike Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead, corrupting_rage
1:11.820 st p death_coil Fluffy_Pillow 60.0/100: 60% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead, corrupting_rage
1:13.141 high_prio_actions j outbreak Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(9), commander_of_the_dead, corrupting_rage
1:14.463 st l death_coil Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, commander_of_the_dead, corrupting_rage
1:15.785 st n clawing_shadows Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
1:17.105 st n clawing_shadows Fluffy_Pillow 58.0/100: 58% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
1:18.427 st p death_coil Fluffy_Pillow 71.0/100: 71% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(2), commander_of_the_dead, corrupting_rage
1:19.748 st p death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
1:21.071 st o festering_strike Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(2), corrupting_rage
1:22.392 st n clawing_shadows Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(2), corrupting_rage
1:23.714 st n clawing_shadows Fluffy_Pillow 54.0/100: 54% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(3), corrupting_rage
1:25.037 st l death_coil Fluffy_Pillow 67.0/100: 67% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(4), corrupting_rage
1:26.359 st n clawing_shadows Fluffy_Pillow 72.0/100: 72% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
1:27.681 st l death_coil Fluffy_Pillow 85.0/100: 85% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
1:29.002 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 55.0/100: 55% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
1:29.002 st n clawing_shadows Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
1:30.324 st p death_coil Fluffy_Pillow 68.0/100: 68% runic_power
0.0/6: 0% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
1:31.646 st n clawing_shadows Fluffy_Pillow 43.0/100: 43% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
1:32.967 st p death_coil Fluffy_Pillow 56.0/100: 56% runic_power
0.0/6: 0% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(7), corrupting_rage
1:34.287 cooldowns T dark_transformation PR_Death_Knight_Unholy 26.0/100: 26% runic_power
1.0/6: 17% rune		 antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(7), corrupting_rage
1:35.608 st l death_coil Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(7), commander_of_the_dead, corrupting_rage
1:36.930 st o festering_strike Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, corrupting_rage
1:38.252 cooldowns W unholy_assault Fluffy_Pillow 51.0/100: 51% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
1:39.575 cooldowns U apocalypse Fluffy_Pillow 51.0/100: 51% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
1:40.896 high_prio_actions j outbreak Fluffy_Pillow 63.0/100: 63% runic_power
5.0/6: 83% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:42.217 st m death_and_decay Fluffy_Pillow 78.0/100: 78% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:43.539 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:44.797 st n clawing_shadows Fluffy_Pillow 63.0/100: 63% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:46.054 st l death_coil Fluffy_Pillow 76.0/100: 76% runic_power
3.0/6: 50% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
1:47.313 st l death_coil Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
1:48.572 st n clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
5.0/6: 83% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead
1:49.831 st l death_coil Fluffy_Pillow 34.0/100: 34% runic_power
5.0/6: 83% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead
1:51.090 st n clawing_shadows Fluffy_Pillow 4.0/100: 4% runic_power
5.0/6: 83% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead
1:52.348 st n clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead
1:53.669 st l death_coil Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead
1:54.990 st o festering_strike Fluffy_Pillow 5.0/100: 5% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead
1:56.311 st n clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), unholy_assault, festermight(8), commander_of_the_dead
1:57.633 st l death_coil Fluffy_Pillow 43.0/100: 43% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(9), commander_of_the_dead
1:58.954 st n clawing_shadows Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(9), commander_of_the_dead
2:00.275 st l death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead
2:01.596 st n clawing_shadows Fluffy_Pillow 1.0/100: 1% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead
2:02.918 st n clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead
2:04.240 Waiting     1.721s 27.0/100: 27% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), commander_of_the_dead, corrupting_rage
2:05.961 st o festering_strike Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
2:07.283 high_prio_actions j outbreak Fluffy_Pillow 47.0/100: 47% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
2:08.605 st l death_coil Fluffy_Pillow 62.0/100: 62% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
2:09.927 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 32.0/100: 32% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(2), corrupting_rage
2:09.927 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), festermight(2), corrupting_rage
2:11.248 st l death_coil Fluffy_Pillow 7.0/100: 7% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), runic_corruption, sudden_doom, festermight(2), corrupting_rage
2:12.569 st n clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune		 antimagic_shell, icy_talons(3), festermight(2), corrupting_rage
2:13.890 st n clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune		 antimagic_shell, icy_talons(3), festermight(3), corrupting_rage
2:15.213 st p death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune		 antimagic_shell, icy_talons(3), festermight(4), corrupting_rage
2:16.535 st o festering_strike Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune		 antimagic_shell, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:17.858 st p death_coil Fluffy_Pillow 33.0/100: 33% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:19.180 Waiting     0.396s 8.0/100: 8% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
2:19.576 cooldowns T dark_transformation PR_Death_Knight_Unholy 8.0/100: 8% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
2:20.898 st o festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
2:22.218 st n clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
2:23.540 st l death_coil Fluffy_Pillow 41.0/100: 41% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, corrupting_rage
2:24.861 cooldowns U apocalypse Fluffy_Pillow 11.0/100: 11% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, corrupting_rage
2:26.182 st m death_and_decay Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:27.503 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(5), commander_of_the_dead, corrupting_rage
2:28.762 st n clawing_shadows Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:30.018 st o festering_strike Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:31.279 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 76.0/100: 76% runic_power
1.0/6: 17% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:31.380 st n clawing_shadows Fluffy_Pillow 76.0/100: 76% runic_power
1.0/6: 17% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, dragon_games_equipment, corrupting_rage
2:32.639 st l death_coil Fluffy_Pillow 94.0/100: 94% runic_power
0.0/6: 0% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(7), commander_of_the_dead, corrupting_rage
2:33.899 st l death_coil Fluffy_Pillow 94.0/100: 94% runic_power
2.0/6: 33% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead, corrupting_rage
2:35.156 high_prio_actions j outbreak Fluffy_Pillow 69.0/100: 69% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
2:36.415 st n clawing_shadows Fluffy_Pillow 79.0/100: 79% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
2:37.736 st l death_coil Fluffy_Pillow 97.0/100: 97% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead
2:39.057 st n clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead
2:40.378 st p death_coil Fluffy_Pillow 80.0/100: 80% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead
2:41.699 st o festering_strike Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead
2:43.020 st l death_coil Fluffy_Pillow 70.0/100: 70% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), commander_of_the_dead
2:44.342 st l death_coil Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, commander_of_the_dead
2:45.663 st n clawing_shadows Fluffy_Pillow 15.0/100: 15% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), commander_of_the_dead
2:46.985 st n clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune		 icy_talons(3), festermight, commander_of_the_dead
2:48.305 st l death_coil Fluffy_Pillow 46.0/100: 46% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(2), commander_of_the_dead
2:49.626 st n clawing_shadows Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(2)
2:50.948 st l death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3)
2:52.270 st n clawing_shadows Fluffy_Pillow 4.0/100: 4% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
2:53.592 st l death_coil Fluffy_Pillow 17.0/100: 17% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(4), corrupting_rage
2:54.914 st n clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:56.236 st p death_coil Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(5), corrupting_rage
2:57.558 st o festering_strike Fluffy_Pillow 5.0/100: 5% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
2:58.880 st p death_coil Fluffy_Pillow 30.0/100: 30% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(5), corrupting_rage
3:00.202 st n clawing_shadows Fluffy_Pillow 0.0/100: 0% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(5), corrupting_rage
3:01.415 trinkets r use_item_algethar_puzzle_box Fluffy_Pillow 18.0/100: 18% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(6), corrupting_rage
3:03.176 high_prio_actions h army_of_the_dead PR_Death_Knight_Unholy 18.0/100: 18% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(6), algethar_puzzle, corrupting_rage
3:04.498 high_prio_actions j outbreak Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(6), algethar_puzzle, corrupting_rage
3:05.819 cooldowns T dark_transformation PR_Death_Knight_Unholy 38.0/100: 38% runic_power
0.0/6: 0% rune		 icy_talons(3), sudden_doom, algethar_puzzle, corrupting_rage
3:07.140 cooldowns S summon_gargoyle PR_Death_Knight_Unholy 43.0/100: 43% runic_power
0.0/6: 0% rune		 icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:07.140 high_prio_actions i death_coil Fluffy_Pillow 93.0/100: 93% runic_power
0.0/6: 0% rune		 icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:08.461 high_prio_actions i death_coil Fluffy_Pillow 93.0/100: 93% runic_power
0.0/6: 0% rune		 icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:09.781 cooldowns V empower_rune_weapon PR_Death_Knight_Unholy 68.0/100: 68% runic_power
1.0/6: 17% rune		 icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:09.781 cooldowns W unholy_assault Fluffy_Pillow 73.0/100: 73% runic_power
2.0/6: 33% rune		 empower_rune_weapon, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:10.929 cooldowns U apocalypse Fluffy_Pillow 73.0/100: 73% runic_power
3.0/6: 50% rune		 empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:12.079 cooldowns X soul_reaper Fluffy_Pillow 85.0/100: 85% runic_power
5.0/6: 83% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:13.230 st l death_coil Fluffy_Pillow 95.0/100: 95% runic_power
4.0/6: 67% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:14.379 st m death_and_decay Fluffy_Pillow 65.0/100: 65% runic_power
4.0/6: 67% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:15.528 st n clawing_shadows Fluffy_Pillow 80.0/100: 80% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:16.623 racials k berserking PR_Death_Knight_Unholy 98.0/100: 98% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:16.623 st l death_coil Fluffy_Pillow 98.0/100: 98% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:17.618 st l death_coil Fluffy_Pillow 98.0/100: 98% runic_power
4.0/6: 67% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:18.615 cooldowns X soul_reaper Fluffy_Pillow 73.0/100: 73% runic_power
4.0/6: 67% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:19.610 st l death_coil Fluffy_Pillow 83.0/100: 83% runic_power
4.0/6: 67% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:20.606 st l death_coil Fluffy_Pillow 93.0/100: 93% runic_power
5.0/6: 83% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:21.600 st n clawing_shadows Fluffy_Pillow 63.0/100: 63% runic_power
5.0/6: 83% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:22.596 st l death_coil Fluffy_Pillow 81.0/100: 81% runic_power
5.0/6: 83% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:23.592 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 51.0/100: 51% runic_power
5.0/6: 83% rune		 berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:23.592 st n clawing_shadows Fluffy_Pillow 51.0/100: 51% runic_power
5.0/6: 83% rune		 berserking, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:24.589 cooldowns X soul_reaper Fluffy_Pillow 64.0/100: 64% runic_power
4.0/6: 67% rune		 berserking, antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:25.662 st m death_and_decay Fluffy_Pillow 79.0/100: 79% runic_power
4.0/6: 67% rune		 berserking, antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:26.709 st l death_coil Fluffy_Pillow 94.0/100: 94% runic_power
3.0/6: 50% rune		 berserking, antimagic_shell, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:27.706 st o festering_strike Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune		 berserking, antimagic_shell, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:28.701 high_prio_actions j outbreak Fluffy_Pillow 84.0/100: 84% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:29.795 st l death_coil Fluffy_Pillow 99.0/100: 99% runic_power
2.0/6: 33% rune		 antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:31.053 cooldowns X soul_reaper Fluffy_Pillow 69.0/100: 69% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage
3:32.311 st l death_coil Fluffy_Pillow 79.0/100: 79% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, unholy_ground, icy_talons(3), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:33.566 st l death_coil Fluffy_Pillow 54.0/100: 54% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), runic_corruption, sudden_doom, commander_of_the_dead, corrupting_rage
3:34.823 st n clawing_shadows Fluffy_Pillow 54.0/100: 54% runic_power
5.0/6: 83% rune		 unholy_strength, unholy_ground, icy_talons(3), runic_corruption, commander_of_the_dead, corrupting_rage
3:36.081 st n clawing_shadows Fluffy_Pillow 72.0/100: 72% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight, corrupting_rage
3:37.400 cooldowns X soul_reaper Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
3:38.720 st l death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(2), corrupting_rage
3:40.043 st n clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
3:41.365 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:42.685 st o festering_strike Fluffy_Pillow 58.0/100: 58% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:44.007 cooldowns X soul_reaper Fluffy_Pillow 78.0/100: 78% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:45.328 st l death_coil Fluffy_Pillow 88.0/100: 88% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:46.650 st l death_coil Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
3:47.971 st l death_coil Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:49.293 st o festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:50.613 cooldowns X soul_reaper Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(3), corrupting_rage
3:51.935 cooldowns T dark_transformation PR_Death_Knight_Unholy 38.0/100: 38% runic_power
2.0/6: 33% rune		 icy_talons(3), festermight(3), corrupting_rage
3:53.255 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, festermight(3), commander_of_the_dead, corrupting_rage
3:54.575 st l death_coil Fluffy_Pillow 13.0/100: 13% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, sudden_doom, festermight(3), commander_of_the_dead, corrupting_rage
3:55.895 high_prio_actions j outbreak Fluffy_Pillow 13.0/100: 13% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:57.216 cooldowns U apocalypse Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
3:58.538 cooldowns X soul_reaper Fluffy_Pillow 40.0/100: 40% runic_power
5.0/6: 83% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
3:59.861 st m death_and_decay Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune		 rune_mastery, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:01.180 st n clawing_shadows Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:02.439 st n clawing_shadows Fluffy_Pillow 78.0/100: 78% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:03.698 high_prio_actions i death_coil Fluffy_Pillow 96.0/100: 96% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
4:04.954 cooldowns X soul_reaper Fluffy_Pillow 66.0/100: 66% runic_power
2.0/6: 33% rune		 unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
4:06.213 st l death_coil Fluffy_Pillow 76.0/100: 76% runic_power
3.0/6: 50% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
4:07.472 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 46.0/100: 46% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
4:07.472 st l death_coil Fluffy_Pillow 46.0/100: 46% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
4:08.731 st n clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
4:09.991 st l death_coil Fluffy_Pillow 34.0/100: 34% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead, corrupting_rage
4:11.311 cooldowns X soul_reaper Fluffy_Pillow 9.0/100: 9% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead, corrupting_rage
4:12.631 st o festering_strike Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead, corrupting_rage
4:13.953 st l death_coil Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune		 antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(7), commander_of_the_dead, corrupting_rage
4:15.275 st n clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(7), commander_of_the_dead, corrupting_rage
4:16.595 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(8), commander_of_the_dead, corrupting_rage
4:17.917 cooldowns X soul_reaper Fluffy_Pillow 2.0/100: 2% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
4:19.240 st n clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead
4:20.563 st l death_coil Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead
4:21.882 st n clawing_shadows Fluffy_Pillow 5.0/100: 5% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight, commander_of_the_dead
4:23.203 high_prio_actions j outbreak Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(2)
4:24.526 cooldowns X soul_reaper Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), festermight(2)
4:25.849 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2)
4:27.170 st n clawing_shadows Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2)
4:28.493 st n clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3)
4:29.815 st l death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(4)
4:31.135 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 4.0/100: 4% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(4)
4:31.380 cooldowns X soul_reaper Fluffy_Pillow 4.0/100: 4% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(4), dragon_games_equipment
4:32.700 st n clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(4)
4:34.022 st l death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(5), corrupting_rage
4:35.345 st l death_coil Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(5), corrupting_rage
4:36.665 st n clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(5), corrupting_rage
4:37.986 cooldowns T dark_transformation PR_Death_Knight_Unholy 25.0/100: 25% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(6), corrupting_rage
4:39.308 cooldowns X soul_reaper Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
4:40.629 cooldowns W unholy_assault Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
4:41.949 st m death_and_decay Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:43.271 cooldowns U apocalypse Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune		 unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:44.529 high_prio_actions i death_coil Fluffy_Pillow 67.0/100: 67% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:45.788 cooldowns X soul_reaper Fluffy_Pillow 42.0/100: 42% runic_power
5.0/6: 83% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:47.046 st l death_coil Fluffy_Pillow 52.0/100: 52% runic_power
4.0/6: 67% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:48.303 high_prio_actions f antimagic_shell PR_Death_Knight_Unholy 22.0/100: 22% runic_power
5.0/6: 83% rune		 unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:48.303 st n clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
5.0/6: 83% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
4:49.560 high_prio_actions j outbreak Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:50.819 st l death_coil Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune		 antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:52.078 cooldowns X soul_reaper Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:53.399 st l death_coil Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:54.723 st n clawing_shadows Fluffy_Pillow 0.0/100: 0% runic_power
4.0/6: 67% rune		 antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:56.046 st o festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
4:57.367 st l death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
4:58.688 st n clawing_shadows Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
5:00.011 st n clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6014 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3848 0 16397 15616 9166
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 327940 312320 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 21.57% 15.36% 1504
Haste 13.88% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6315 5922 0
Mastery 44.93% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +923 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +923 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Talents

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowUnholy Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=sizzling_seafood_medley
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2,if=!equipped.fyralath_the_dreamrender
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync)*(1+((trinket.1.ilvl-trinket.2.ilvl)%100)))
actions.precombat+=/variable,name=damage_trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&!variable.trinket_2_buffs&trinket.2.ilvl>=trinket.1.ilvl

# Executed every time the actor is available.
actions=auto_attack
# Call Action Lists
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=trinkets
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup_complete=0
actions+=/call_action_list,name=cooldowns,if=variable.st_planning
actions+=/call_action_list,name=aoe_cooldowns,if=variable.adds_remain
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
actions+=/call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
actions+=/call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
actions+=/call_action_list,name=st,if=active_enemies<=3

# Generic AoE
actions.aoe=epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# AoE Burst
actions.aoe_burst=epidemic,if=(rune<1|talent.bursting_sores&death_knight.fwounded_targets=0)&!variable.pooling_runic_power&(active_enemies>=6|runic_power.deficit<30|buff.festermight.stack=20)
actions.aoe_burst+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=1
actions.aoe_burst+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_burst+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe_burst+=/wound_spender

# AoE Cooldowns
actions.aoe_cooldowns=vile_contagion,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.aoe_cooldowns+=/summon_gargoyle
actions.aoe_cooldowns+=/abomination_limb,if=rune<2|buff.festermight.stack>10|!talent.festermight|buff.festermight.up&buff.festermight.remains<12
actions.aoe_cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=talent.bursting_sores&debuff.festering_wound.up&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
actions.aoe_cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=!talent.bursting_sores&debuff.festering_wound.stack>=4|set_bonus.tier31_2pc&debuff.festering_wound.stack>=1
actions.aoe_cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.stack<=2|buff.dark_transformation.up
actions.aoe_cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.aoe_cooldowns+=/dark_transformation,if=(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.aoe_cooldowns+=/empower_rune_weapon,if=buff.dark_transformation.up
actions.aoe_cooldowns+=/sacrificial_pact,if=!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# AoE Setup
actions.aoe_setup=any_dnd,if=(!talent.bursting_sores|death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets>=8|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5)
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies&talent.bursting_sores
actions.aoe_setup+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies
actions.aoe_setup+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=cooldown.apocalypse.remains<variable.apoc_timing&debuff.festering_wound.stack<4
actions.aoe_setup+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# ST/Cleave Cooldowns
actions.cooldowns=summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=cooldown.apocalypse.remains<5
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=23|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)

# Garg Setup
actions.garg_setup=apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<23|!talent.commander_of_the_dead)
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.garg_setup+=/any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>1
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
actions.garg_setup+=/empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=23
actions.garg_setup+=/unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=23
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
actions.garg_setup+=/festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40&!pet.gargoyle.active
actions.garg_setup+=/death_coil,if=rune<=1

# Priority Actions
actions.high_prio_actions=mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
actions.high_prio_actions+=/antimagic_zone,if=!death_knight.amz_specified&(death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle))
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_specified&buff.amz_timing.up
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
actions.high_prio_actions+=/invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=22|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.army_ghoul.remains<=18|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+10>cooldown.invoke_external_buff.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))
actions.high_prio_actions+=/potion,if=(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
actions.high_prio_actions+=/army_of_the_dead,if=!equipped.fyralath_the_dreamrender&(talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35)
actions.high_prio_actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>27|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
actions.high_prio_actions+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
actions.high_prio_actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
actions.high_prio_actions+=/army_of_the_dead,if=equipped.fyralath_the_dreamrender&(talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35)

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration+3
actions.racials+=/berserking,if=(buff.berserking.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration+3
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(18>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=18|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|active_enemies>=2&death_and_decay.ticking)|fight_remains<=18
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration+3>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration+3|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration+3|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration+3
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Single Target
actions.st=death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
actions.st+=/epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&variable.spend_rp|fight_remains<10)
actions.st+=/any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=13|pet.gargoyle.active&pet.gargoyle.remains>8|pet.army_ghoul.active&pet.army_ghoul.remains>8|!variable.pop_wounds&debuff.festering_wound.stack>=4)|talent.defile&(pet.gargoyle.active|pet.apoc_ghoul.active|pet.army_ghoul.active|buff.dark_transformation.up))&(death_knight.fwounded_targets=active_enemies|active_enemies=1)
actions.st+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.st+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4
actions.st+=/death_coil
actions.st+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack>=4

# Trinkets
actions.trinkets=use_item,name=fyralath_the_dreamrender,if=dot.mark_of_fyralath.ticking
actions.trinkets+=/use_item,use_off_gcd=1,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<16|!talent.summon_gargoyle&pet.army_ghoul.active&pet.army_ghoul.remains<16)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=18|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(variable.damage_trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(variable.damage_trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=!equipped.fyralath_the_dreamrender&(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
actions.variables+=/variable,name=garg_setup_complete,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&(cooldown.apocalypse.remains>1|!talent.apocalypse)|!talent.summon_gargoyle|time>20
actions.variables+=/variable,name=apoc_timing,op=setif,value=7,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
actions.variables+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
actions.variables+=/variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4|set_bonus.tier31_4pc&(pet.apoc_magus.active|pet.army_magus.active)&debuff.festering_wound.stack>=1)|fight_remains<5&debuff.festering_wound.stack>=1
actions.variables+=/variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions.variables+=/variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies=1&(!raid_event.adds.exists|raid_event.adds.in>15)
actions.variables+=/variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
actions.variables+=/variable,name=spend_rp,op=setif,value=1,value_else=0,condition=(!talent.rotten_touch|talent.rotten_touch&!debuff.rotten_touch.up|runic_power.deficit<20)&(!set_bonus.tier31_4pc|set_bonus.tier31_4pc&!(pet.apoc_magus.active|pet.army_magus.active)|runic_power.deficit<20|rune<3)&((talent.improved_death_coil&(active_enemies=2|talent.coil_of_devastation)|rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3|!variable.pop_wounds&debuff.festering_wound.stack>=4))

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=9166
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 17575 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17575.0 17575.0 10.6 / 0.060% 1859.1 / 10.6% 170.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
100.3 99.8 Mana 0.00% 51.8 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 17575
Devouring Plague 3992 22.7% 20.9 14.29s 57120 49031 Direct 20.9 22761 45645 25796 13.3%
Periodic 64.9 8907 17827 10099 13.4% 41.3%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.94 20.94 64.94 64.94 0.00 1.1650 1.9094 1195829.12 1195829.12 0.00% 8059.29 49031.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.74% 18.16 9 25 22761.06 21462 31029 22764.33 21923 24152 413323 413323 0.00%
crit 13.26% 2.78 0 9 45644.85 42923 62058 43109.95 0 62058 126719 126719 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.64% 56.26 37 73 8906.99 2214 14737 8908.89 8279 9755 501086 501086 0.00%
crit 13.36% 8.68 0 22 17826.72 4427 29474 17815.81 0 24880 154701 154701 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.738590
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.06

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.825727
  • base_td:0.00
  • base_td_mult:1.06
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 173.9%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [K]:20.94
  • if_expr:remains<=gcd.max|insanity.deficit<=16
  • target_if_expr:!talent.distorted_reality|active_enemies=1|remains<=gcd.max

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Percent Cost Mind Devourer3732041-1.000Spell Data
Mind Blast 2448 13.9% 35.8 8.45s 20511 17507 Direct 35.8 18096 36261 20511 13.3%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.78 35.78 0.00 0.00 0.00 1.1716 0.0000 733792.26 733792.26 0.00% 17506.67 17506.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.71% 31.02 19 42 18096.42 16667 26039 18102.01 17430 19227 561370 561370 0.00%
crit 13.29% 4.76 0 16 36261.33 33335 52079 36077.90 0 48106 172423 172423 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:625.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.97

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage{$?s424509=false}[ and increases your spell damage to the target by {$424509s1=10}% for {$214621d=9 seconds}.][.]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s2=0}/100} Insanity.|r][]

Action Priority List

    main
    [M]:35.92
  • if_expr:(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703313PCT0.490
Spell Direct AmountShadow Priest13703322PCT0.250
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Mind Spike 6675 38.0% 176.6 1.69s 11328 9673 Direct 176.6 9994 20027 11328 13.3%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 176.64 176.64 0.00 0.00 0.00 1.1711 0.0000 2000966.40 2000966.40 0.00% 9672.77 9672.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.70% 153.15 108 195 9993.92 9238 14432 9996.50 9748 10481 1530615 1530615 0.00%
crit 13.30% 23.49 7 45 20026.96 18476 28864 20034.06 18897 21705 470351 470351 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.808652
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.06

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage. |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity.|r

Action Priority List

    filler
    [H]:177.29
  • target_if_expr:dot.devouring_plague.remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Shadow Weaving 61 0.3% 33.0 6.42s 545 0 Direct 33.0 545 0 545 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.00 33.00 0.00 0.00 0.00 0.0000 0.0000 17986.10 17986.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 33.00 33 33 545.04 326 1603 545.03 472 678 17986 17986 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:325.81
  • base_dd_max:325.81
  • base_dd_mult:1.06

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Shadow Word: Death 854 4.9% 6.2 10.34s 41347 34111 Direct 6.2 36300 72994 41347 13.8%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.19 6.19 0.00 0.00 0.00 1.2123 0.0000 255903.23 255903.23 0.00% 34111.33 34111.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.25% 5.34 1 8 36300.35 31539 49273 36319.79 31539 46482 193774 193774 0.00%
crit 13.75% 0.85 0 5 72993.85 63077 98545 43695.40 0 98545 62129 62129 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.98

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to your target. If your target is not killed by Shadow Word: Death, you take backlash damage equal to {$s5=8}% of your maximum health.{$?=}A364675[ Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][ Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s4=0}/100} Insanity.|r][]

Action Priority List

    filler
    [G]:6.20
  • target_if_expr:target.health.pct<20|(buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703315PCT0.600
Spell Direct AmountShadow Priest13703320PCT-0.420
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Soulseeker Arrow 1038 5.9% 7.0 38.40s 44475 0 Periodic 79.5 3915 0 3915 0.0% 37.5%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.00 0.00 79.49 79.49 2.33 0.0000 1.4159 311241.86 311241.86 0.00% 2765.29 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 79.49 18 171 3915.28 121 4407 3911.18 3810 4114 311242 311242 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3629.20
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1730}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 2012 11.5% 13.5 21.04s 44700 37944 Periodic 127.8 4161 8339 4718 13.3% 99.4%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.49 0.00 127.83 127.83 13.49 1.1781 2.3335 603046.59 603046.59 0.00% 1919.39 37944.16
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.67% 110.79 75 143 4160.65 9 5947 4161.64 4021 4359 460954 460954 0.00%
crit 13.33% 17.04 4 35 8338.51 19 11895 8340.81 7399 9437 142092 142092 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.59
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [L]:13.49
  • if_expr:refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
  • target_if_expr:remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Periodic AmountShadow Priest1370334PCT0.500
Spell Direct AmountShadow Priest1370335PCT0.500
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
pet - shadowfiend 4192 / 496
melee 4192 2.8% 33.0 6.42s 4446 4299 Direct 33.0 3935 7867 4446 13.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.00 33.00 0.00 0.00 0.00 1.0344 0.0000 146728.29 146728.29 0.00% 4298.60 4298.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 87.00% 28.71 21 33 3935.33 3718 4573 3935.25 3815 4298 112988 112988 0.00%
crit 13.00% 4.29 0 12 7867.27 7435 9147 7795.89 0 9147 33740 33740 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 1.0 0.00s

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    cds
    [E]:1.00
  • if_expr:buff.power_infusion.up|fight_remains<=15
Devouring Plague (_heal) 85.9 3.41s

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 85.87 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 173.9%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data
Percent Cost Mind Devourer3732041-1.000Spell Data
Phial of Static Empowerment 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [D]:1.00
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Shadowfiend 2.0 0.00s

Stats Details: Shadowfiend

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0800 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowfiend

  • id:34433
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:343726
  • description:Summons a shadowy fiend to attack the target for {$d=15 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$262485s1=200}/100} Insanity each time the Shadowfiend attacks.|r][ |cFFFFFFFFGenerates {$=}{{$s4=5}/10}.1% Mana each time the Shadowfiend attacks.|r]

Action Priority List

    main
    [J]:2.00
  • if_expr:variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
Shadowform 1.0 0.00s

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 1.0 0.00s

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 127.8 2.33s

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 127.83 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=8}7+{$137033s1=8}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountShadow Priest1370331PCT0.080
Spell Periodic AmountShadow Priest1370332PCT0.080
Spell Periodic AmountShadow Priest1370334PCT0.500
Spell Direct AmountShadow Priest1370335PCT0.500
Spell Direct AmountShadow Priest13703330PCT-0.020
Spell Periodic AmountShadow Priest13703331PCT-0.020

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Devoured Pride37331610.050Spell Data
Voidform19424910.100Spell DataNo-stacks
Shadowform23269810.100Spell Data
Periodic Damage Devoured Pride37331620.050Spell Data
Voidform19424920.100Spell DataNo-stacks
Shadowform23269830.100Spell Data

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 1.0 0.0 0.0s 0.0s 14.4s 4.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.6s / 15.0s
  • uptime_min/max:3.79% / 6.23%

Stack Uptimes

  • blood_fury_1:4.86%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Devoured Pride 1.0 0.0 0.0s 0.0s 15.0s 5.07% 5.84% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s
  • uptime_min/max:4.17% / 6.25%

Stack Uptimes

  • devoured_pride_1:5.07%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0s 0.0s 29.4s 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.5s / 30.0s
  • uptime_min/max:8.01% / 12.48%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0s 0.0s 300.0s 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 61.1s 45.9s 16.5s 23.69% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 205.4s
  • trigger_min/max:0.0s / 205.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.4s
  • uptime_min/max:4.83% / 59.66%

Stack Uptimes

  • sophic_devotion_1:23.69%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.3 0.0 0.0s 0.0s 19.4s 1.69% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.6s / 20.0s
  • uptime_min/max:0.00% / 8.28%

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:1.70%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.3 0.0 0.0s 0.0s 19.4s 1.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.29%

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:1.65%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.2 0.0 0.0s 0.0s 19.4s 1.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.30%

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:1.62%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.2 0.0 0.0s 0.0s 19.4s 1.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.32%

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:1.59%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0s 0.0s 300.0s 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:Primary stat is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Idol of Y'Shaarj Devoured Violence procs 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 85.79% 83.49% 87.74% 6.3s 0.0s 9.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Shadow Word: Death39.2250.000289.505242.797193.025294.530
Shadowfiend0.4210.0000.8910.8410.7920.891
Mind Blast0.267-0.0001.9199.6618.02413.464

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Mana RegenMana715.8029934.07100.00%41.82736846.8296.10%
ShadowfiendInsanity33.0066.006.17%2.000.000.00%
Mind BlastInsanity35.78214.6620.06%6.000.000.00%
Mind SpikeInsanity176.64706.5666.04%4.000.000.00%
Shadow Word: DeathInsanity6.1924.762.31%4.000.000.00%
Vampiric TouchInsanity14.4957.965.42%4.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 20.941046.77100.00%50.0050.001142.40
Mind BlastMana 35.7822360.1074.29%625.00625.0032.82
Shadow Word: DeathMana 6.197736.4725.71%1250.001249.9933.08
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 273300.0 344.51 430.74 436299.5 247433.6 219446.1 273300.0
Mana 250000.0 99.78 100.32 736847.0 249837.5 248130.1 250000.0
Insanity 4.0 3.57 3.49 0.0 23.2 0.0 52.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 17575.00
Minimum 16118.64
Maximum 19504.53
Spread ( max - min ) 3385.89
Range [ ( max - min ) / 2 * 100% ] 9.63%
Standard Deviation 467.5797
5th Percentile 16837.07
95th Percentile 18380.52
( 95th Percentile - 5th Percentile ) 1543.45
Mean Distribution
Standard Deviation 5.3995
95.00% Confidence Interval ( 17564.42 - 17585.58 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2720
0.1 Scale Factor Error with Delta=300 1867
0.05 Scale Factor Error with Delta=300 7466
0.01 Scale Factor Error with Delta=300 186636
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 17575.00
Minimum 16118.64
Maximum 19504.53
Spread ( max - min ) 3385.89
Range [ ( max - min ) / 2 * 100% ] 9.63%
Standard Deviation 467.5797
5th Percentile 16837.07
95th Percentile 18380.52
( 95th Percentile - 5th Percentile ) 1543.45
Mean Distribution
Standard Deviation 5.3995
95.00% Confidence Interval ( 17564.42 - 17585.58 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2720
0.1 Scale Factor Error with Delta=300 1867
0.05 Scale Factor Error with Delta=300 7466
0.01 Scale Factor Error with Delta=300 186636
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 17575.00
Minimum 16118.64
Maximum 19504.53
Spread ( max - min ) 3385.89
Range [ ( max - min ) / 2 * 100% ] 9.63%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 5118765.55
Minimum 3900435.82
Maximum 6456987.67
Spread ( max - min ) 2556551.85
Range [ ( max - min ) / 2 * 100% ] 24.97%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 430.67
Minimum 374.76
Maximum 489.43
Spread ( max - min ) 114.67
Range [ ( max - min ) / 2 * 100% ] 13.31%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 344.83
Minimum 258.19
Maximum 428.30
Spread ( max - min ) 170.11
Range [ ( max - min ) / 2 * 100% ] 24.67%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 shadowform,if=!buff.shadowform.up
5 0.00 arcane_torrent
6 0.00 shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(!set_bonus.tier31_4pc|spell_targets.shadow_crash>1)
7 0.00 vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice|set_bonus.tier31_4pc&spell_targets.shadow_crash=1
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=holding_crash,op=set,value=raid_event.adds.in<15
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
8 0.00 run_action_list,name=aoe,if=active_enemies>2
9 0.00 run_action_list,name=main
actions.cds
# count action,conditions
D 1.00 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
TODO: Check VE/DA enter conditions based on dots
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
E 1.00 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 use_item,name=nymues_unraveling_spindle,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<3+gcd.max|fight_remains<15)
Use Nymue's before we go into our cooldowns
0.00 use_item,name=belorrelos_the_suncaller,use_off_gcd=1,if=gcd.remains>0&(!raid_event.adds.exists&!prev_gcd.1.mindbender|raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)|fight_remains<20
Use Belor'relos, the Suncaller before we go into our cooldowns
0.00 divine_star,if=(raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)&equipped.belorrelos_the_suncaller&trinket.belorrelos_the_suncaller.cooldown.remains<=gcd.max
Fit in a Divine Star as you cast Belor's for the free GCD.
0.00 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
Sync Power Infusion with Voidform or Dark Ascension
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
0.00 dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
F 0.00 call_action_list,name=trinkets
0.00 desperate_prayer,if=health.pct<=75
Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.filler
# count action,conditions
0.00 vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
G 6.20 shadow_word_death,target_if=target.health.pct<20|(buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking
0.00 mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=dot.devouring_plague.remains>cast_time
0.00 mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up
0.00 mindgames,target_if=max:dot.devouring_plague.remains
0.00 shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
0.00 halo,if=spell_targets>1
Save up to 20s if adds are coming soon.
H 177.29 mind_spike,target_if=max:dot.devouring_plague.remains
0.00 mind_flay,target_if=max:dot.devouring_plague.remains,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 divine_star
0.00 shadow_crash,if=raid_event.adds.in>20&!set_bonus.tier31_4pc
Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 shadow_word_death,target_if=max:dot.devouring_plague.remains
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain,target_if=max:dot.devouring_plague.remains,if=set_bonus.tier31_4pc
Use Shadow Word: Pain while moving as a low-priority action with T31 4pc
0.00 shadow_word_pain,target_if=min:remains,if=!set_bonus.tier31_4pc
Use Shadow Word: Pain while moving as a low-priority action without T31 4pc
actions.main
# count action,conditions
0.00 variable,name=dots_up,op=set,value=active_dot.vampiric_touch=active_enemies|action.shadow_crash.in_flight&talent.whispering_shadows
I 0.00 call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
J 2.00 mindbender,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active and sync with Dark Ascension
K 20.94 devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=remains<=gcd.max|insanity.deficit<=16
0.00 shadow_word_death,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)&dot.devouring_plague.ticking
0.00 mind_blast,target_if=dot.devouring_plague.remains>execute_time&(cooldown.mind_blast.full_recharge_time<=gcd.max+execute_time)|pet.fiend.remains<=execute_time+gcd.max,if=pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>execute_time&active_enemies<=7
High priority Mind Blast action when using Inescapable Torment
0.00 shadow_word_death,target_if=dot.devouring_plague.ticking&pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
0.00 void_bolt,if=variable.dots_up
0.00 devouring_plague,if=fight_remains<=duration+4
Spend your Insanity on Devouring Plague at will if the fight will end in less than 10s
0.00 devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=(remains<=gcd.max|remains<3&cooldown.void_torrent.up)|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2|buff.mind_devourer.up&pmultiplier<1.2
Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
0.00 shadow_word_death,if=set_bonus.tier31_2pc
0.00 shadow_crash,if=!variable.holding_crash&(dot.vampiric_touch.refreshable|buff.deaths_torment.stack>9&set_bonus.tier31_4pc)
Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
0.00 shadow_word_pain,if=buff.deaths_torment.stack>9&set_bonus.tier31_4pc&(!variable.holding_crash|!talent.shadow_crash)
Consume T31 4pc SWPs
0.00 shadow_word_death,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
L 13.49 vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
M 35.92 mind_blast,if=(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
0.00 void_torrent,if=!variable.holding_crash,target_if=dot.devouring_plague.remains>=2.5,interrupt_if=cooldown.shadow_word_death.ready&pet.fiend.active&set_bonus.tier31_2pc
Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
N 0.00 call_action_list,name=filler
Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=(buff.power_infusion.up|fight_remains<20)&equipped.voidmenders_shadowgem
0.00 use_item,name=iridal_the_earths_master,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
0.00 use_item,name=dreambinder_loom_of_the_great_cycle,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno,if=equipped.darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime,if=equipped.darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance,if=equipped.darkmoon_deck_box_dance
0.00 use_item,name=erupting_spear_fragment,if=(buff.power_infusion.up|raid_event.adds.up|fight_remains<20)&equipped.erupting_spear_fragment
Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
0.00 use_item,name=beacon_to_the_beyond,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20)&equipped.beacon_to_the_beyond
Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
O 1.00 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex,if=equipped.desperate_invokers_codex

Sample Sequence

01247JMHHHHHHKMHHHHHHLKMHHHHHHMHHHKHHMHHHHHHLMHKHHHHMHHHHHHMKHLHHHMHHHHHKMHHHHHLMHHHHKHMHHHHHHMHLKHHHMHHHHHHMHKHHLHMHHHHHHMKHHHHHMHLHHHKMHHHHHHMHHHHKLMHHHHHHMHHKHHJMLHHHHHKMHHHHHHKMHLHHHHMHHHHKHMHHHHLHMHHKHHHMHHHGHHMHKLHGHMHHHHHGMKHHLHHDMGHHHHKMOHHGHHEHMLHHHKGMHHHH

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 4 shadowform PR_Priest_Shadow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 7 vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment
0:00.000 main J shadowfiend Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, static_empowerment
0:00.938 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment
0:01.877 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
16.0/100: 16% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(2)
0:02.817 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 bloodlust, shadowform, devoured_pride, static_empowerment(3)
0:03.757 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(4)
0:04.697 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:05.635 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:06.574 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:07.513 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:08.453 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:09.393 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
12.0/100: 12% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:10.333 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:11.274 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:12.214 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:13.152 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:14.090 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, devoured_pride, sophic_devotion, static_empowerment(5)
0:15.031 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:15.971 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:16.909 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:17.849 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:18.790 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 bloodlust, shadowform, static_empowerment(5)
0:19.730 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 bloodlust, shadowform, static_empowerment(5)
0:20.668 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 bloodlust, shadowform, static_empowerment(5)
0:21.608 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 bloodlust, shadowform, static_empowerment(5)
0:22.550 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 bloodlust, shadowform, static_empowerment(5)
0:23.490 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 bloodlust, shadowform, static_empowerment(5)
0:24.429 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
38.0/100: 38% insanity		 bloodlust, shadowform, static_empowerment(5)
0:25.368 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, static_empowerment(5)
0:26.307 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 bloodlust, shadowform, static_empowerment(5)
0:27.246 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 bloodlust, shadowform, static_empowerment(5)
0:28.187 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 bloodlust, shadowform, static_empowerment(5)
0:29.126 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 bloodlust, shadowform, static_empowerment(5)
0:30.065 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 bloodlust, shadowform, static_empowerment(5)
0:31.004 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
14.0/100: 14% insanity		 bloodlust, shadowform, static_empowerment(5)
0:31.941 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 bloodlust, shadowform, static_empowerment(5)
0:32.881 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 bloodlust, shadowform, static_empowerment(5)
0:33.820 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 bloodlust, shadowform, static_empowerment(5)
0:34.759 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 bloodlust, shadowform, static_empowerment(5)
0:35.697 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 bloodlust, shadowform, static_empowerment(5)
0:36.636 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 bloodlust, shadowform, static_empowerment(5)
0:37.577 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 bloodlust, shadowform, static_empowerment(5)
0:38.517 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
48.0/100: 48% insanity		 bloodlust, shadowform, static_empowerment(5)
0:39.456 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 bloodlust, shadowform, static_empowerment(5)
0:40.396 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
0:41.617 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
0:42.836 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
0:44.057 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
0:45.278 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
0:46.582 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
0:47.801 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
0:49.020 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
0:50.241 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
0:51.461 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
0:52.681 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
0:53.902 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
0:55.121 main K devouring_plague Fluffy_Pillow 249382.7/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
0:56.341 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
0:57.561 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
0:58.781 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
1:00.002 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
1:01.223 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
1:02.443 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:03.662 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
30.0/100: 30% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:04.883 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:06.103 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:07.324 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:08.543 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:09.764 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:10.984 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:12.203 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:13.424 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:14.645 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:15.866 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:17.088 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, sophic_devotion, static_empowerment(5)
1:18.310 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
1:19.530 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:20.751 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
1:21.972 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
1:23.191 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
1:24.412 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
1:25.633 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
1:26.855 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
1:28.074 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:29.295 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
1:30.517 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
1:31.738 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
1:32.959 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
1:34.180 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
1:35.400 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
1:36.622 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
1:37.842 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:39.064 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
1:40.284 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
1:41.505 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
1:42.725 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
1:43.945 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
1:45.166 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
1:46.385 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
1:47.607 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
1:48.826 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
1:50.046 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
1:51.266 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
1:52.486 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
1:53.705 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
1:54.927 filler H mind_spike Fluffy_Pillow 249390.4/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
1:56.148 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
1:57.368 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
1:58.588 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
1:59.806 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
2:01.027 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
2:02.247 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
2:03.469 filler H mind_spike Fluffy_Pillow 249390.4/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
2:04.688 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
2:05.909 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
2:07.129 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
2:08.348 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
2:09.569 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
2:10.791 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
2:12.010 main K devouring_plague Fluffy_Pillow 249382.7/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
2:13.232 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
2:14.452 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
2:15.673 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
2:16.892 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:18.111 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:19.332 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:20.553 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
30.0/100: 30% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:21.773 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:22.992 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:24.213 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:25.433 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:26.652 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:27.873 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:29.095 filler H mind_spike Fluffy_Pillow 249390.4/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:30.314 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:31.534 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:32.753 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
2:33.973 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
2:35.192 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
2:36.413 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
2:37.634 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
2:38.855 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
2:40.075 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:41.295 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:42.516 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:43.737 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:44.958 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:46.180 filler H mind_spike Fluffy_Pillow 249390.4/250000: 100% mana
12.0/100: 12% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:47.399 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:48.619 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:49.841 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:51.062 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:52.282 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:53.501 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
2:54.721 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
2:55.940 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
2:57.161 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
2:58.382 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
2:59.602 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
3:00.822 main J shadowfiend Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
3:02.043 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
3:03.265 main L vampiric_touch Fluffy_Pillow 249390.4/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
3:04.486 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
3:05.705 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
3:06.925 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
3:08.145 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
3:09.364 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
3:10.584 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
3:11.806 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:13.026 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
3:14.245 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
3:15.466 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:16.687 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:17.909 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:19.129 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:20.350 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:21.571 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:22.793 filler H mind_spike Fluffy_Pillow 249390.4/250000: 100% mana
6.0/100: 6% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:24.015 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:25.236 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:26.457 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:27.678 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:28.899 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:30.120 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:31.339 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
36.0/100: 36% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:32.559 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:33.779 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, sophic_devotion, static_empowerment(5)
3:35.000 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
3:36.220 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
3:37.443 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
3:38.664 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
3:39.884 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
3:41.102 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
3:42.321 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
3:43.540 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
3:44.762 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
3:45.983 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
3:47.204 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
3:48.425 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
3:49.648 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5)
3:50.870 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5)
3:52.089 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5)
3:53.309 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
3:54.530 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
3:55.750 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
3:56.971 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
3:58.190 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, static_empowerment(5)
3:59.410 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, static_empowerment(5)
4:00.632 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5)
4:01.853 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5)
4:03.074 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5)
4:04.294 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5)
4:05.516 filler H mind_spike Fluffy_Pillow 249390.4/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
4:06.738 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 shadowform, static_empowerment(5)
4:07.959 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 shadowform, static_empowerment(5)
4:09.181 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5)
4:10.400 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, static_empowerment(5)
4:11.853 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, static_empowerment(5)
4:13.074 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, static_empowerment(5)
4:14.295 filler H mind_spike Fluffy_Pillow 249387.8/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
4:15.516 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
28.0/100: 28% insanity		 shadowform, static_empowerment(5)
4:16.737 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
32.0/100: 32% insanity		 shadowform, static_empowerment(5)
4:17.957 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
36.0/100: 36% insanity		 shadowform, static_empowerment(5)
4:19.178 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 shadowform, static_empowerment(5)
4:20.396 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 shadowform, static_empowerment(5)
4:21.854 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 shadowform, static_empowerment(5)
4:23.074 main K devouring_plague Fluffy_Pillow 249385.2/250000: 100% mana
54.0/100: 54% insanity		 shadowform, static_empowerment(5)
4:24.294 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
4.0/100: 4% insanity		 shadowform, static_empowerment(5)
4:25.516 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
8.0/100: 8% insanity		 shadowform, static_empowerment(5)
4:26.737 main L vampiric_touch Fluffy_Pillow 250000.0/250000: 100% mana
12.0/100: 12% insanity		 shadowform, static_empowerment(5)
4:27.958 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 shadowform, static_empowerment(5)
4:29.179 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 shadowform, static_empowerment(5)
4:30.400 cds D potion Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5)
4:30.400 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:31.621 filler G shadow_word_death Fluffy_Pillow 249387.8/250000: 100% mana
30.0/100: 30% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:32.841 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
34.0/100: 34% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:34.061 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
38.0/100: 38% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:35.280 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
42.0/100: 42% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:36.501 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
46.0/100: 46% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:37.722 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
50.0/100: 50% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:38.941 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
0.0/100: 0% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.161 trinkets O use_items Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity		 shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.161 filler H mind_spike Fluffy_Pillow 249385.2/250000: 100% mana
6.0/100: 6% insanity		 shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:41.274 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
10.0/100: 10% insanity		 shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:42.389 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
14.0/100: 14% insanity		 shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:43.500 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
18.0/100: 18% insanity		 shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:44.613 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
22.0/100: 22% insanity		 shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.726 cds E blood_fury PR_Priest_Shadow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.726 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
26.0/100: 26% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:46.839 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
30.0/100: 30% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:47.954 main L vampiric_touch Fluffy_Pillow 249390.4/250000: 100% mana
36.0/100: 36% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:49.069 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
40.0/100: 40% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:50.183 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
44.0/100: 44% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:51.297 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
48.0/100: 48% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:52.411 main K devouring_plague Fluffy_Pillow 250000.0/250000: 100% mana
52.0/100: 52% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:53.523 filler G shadow_word_death Fluffy_Pillow 250000.0/250000: 100% mana
2.0/100: 2% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:54.636 main M mind_blast Fluffy_Pillow 250000.0/250000: 100% mana
6.0/100: 6% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:55.748 filler H mind_spike Fluffy_Pillow 249382.7/250000: 100% mana
12.0/100: 12% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:56.860 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
16.0/100: 16% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:57.975 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
20.0/100: 20% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:59.088 filler H mind_spike Fluffy_Pillow 250000.0/250000: 100% mana
24.0/100: 24% insanity		 blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3848 1 13665 13015 9166
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 273300 260300 0
Mana 250000 250000 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 2560 2560 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +923 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +692 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +923 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +923 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +111 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +692 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +519 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +519 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +923 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Talents

RowPriest Talents [1]
1
2
3
4
5
6
7
8
9
10
RowShadow Talents [2]
1
2
3
4
5
6
7
8
9
10

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(!set_bonus.tier31_4pc|spell_targets.shadow_crash>1)
actions.precombat+=/vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice|set_bonus.tier31_4pc&spell_targets.shadow_crash=1

# Executed every time the actor is available.
actions=variable,name=holding_crash,op=set,value=raid_event.adds.in<15
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
actions+=/run_action_list,name=aoe,if=active_enemies>2
actions+=/run_action_list,name=main

actions.aoe=call_action_list,name=aoe_variables
# High Priority action to put out Vampiric Touch on enemies that will live at least 18 seconds, up to 12 targets manually while prepping AoE
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.dots_up),if=variable.max_vts>0&!variable.manual_vts_applied&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Crash to apply Vampiric Touch to as many adds as possible while being efficient with Vampiric Touch refresh windows
actions.aoe+=/shadow_crash,if=!variable.holding_crash,target_if=dot.vampiric_touch.refreshable|dot.vampiric_touch.remains<=target.time_to_die&!buff.voidform.up&(raid_event.adds.in-dot.vampiric_touch.remains)<15
actions.aoe+=/call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend or Mindbender on cooldown if DoTs are active and sync with Dark Ascension
actions.aoe+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.dots_up|action.shadow_crash.in_flight&talent.whispering_shadows)&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
actions.aoe+=/devouring_plague,target_if=max:target.time_to_die*(!dot.devouring_plague.ticking),if=talent.distorted_reality&(active_dot.devouring_plague=0|insanity.deficit<=20)
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff or if Inescapable Torment is talented with Mindbender active. Only use when facing 3-7 targets.
actions.aoe+=/mind_blast,target_if=max:dot.devouring_plague.remains,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&active_enemies<=7&!buff.mind_devourer.up&dot.devouring_plague.remains>execute_time
# High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
actions.aoe+=/void_bolt,target_if=max:target.time_to_die
# Use Devouring Plague on enemies that will live the longest with distorted reality.
actions.aoe+=/devouring_plague,target_if=max:target.time_to_die*(!dot.devouring_plague.ticking),if=talent.distorted_reality
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.aoe+=/devouring_plague,if=(remains<=gcd.max&!variable.pool_for_cds|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2)&!talent.distorted_reality
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.dots_up),if=variable.max_vts>0&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash)&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
actions.aoe+=/shadow_word_death,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
# High Priority Mind Spike: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up&variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# # Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.aoe+=/mind_blast,target_if=max:dot.devouring_plague.remains,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent action list for AoE
actions.aoe+=/void_torrent,target_if=max:dot.devouring_plague.remains,if=(!variable.holding_crash|raid_event.adds.count%(active_dot.vampiric_touch+raid_event.adds.count)<1.5)&(dot.devouring_plague.remains>=2.5|buff.voidform.up)
# High priority action for Mind Flay: Insanity to fish for Idol of C'Thun procs, cancel as soon as something else is more important and most of the channel has completed
actions.aoe+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up&talent.idol_of_cthun,interrupt_if=ticks>=2,interrupt_immediate=1
actions.aoe+=/call_action_list,name=filler

actions.aoe_variables=variable,name=max_vts,op=set,default=12,value=spell_targets.vampiric_touch>?12
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
# TODO: Revamp to fix undesired behaviour with unstacked fights
actions.aoe_variables+=/variable,name=dots_up,op=set,value=(active_dot.vampiric_touch+8*(action.shadow_crash.in_flight&talent.whispering_shadows))>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=holding_crash,op=set,value=(variable.max_vts-active_dot.vampiric_touch)<4|raid_event.adds.in<10&raid_event.adds.count>(variable.max_vts-active_dot.vampiric_touch),if=variable.holding_crash&talent.whispering_shadows
actions.aoe_variables+=/variable,name=manual_vts_applied,op=set,value=(active_dot.vampiric_touch+8*!variable.holding_crash)>=variable.max_vts|!variable.is_vt_possible

# TODO: Check VE/DA enter conditions based on dots
actions.cds=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
actions.cds+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions.cds+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions.cds+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions.cds+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
# Use Nymue's before we go into our cooldowns
actions.cds+=/use_item,name=nymues_unraveling_spindle,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<3+gcd.max|fight_remains<15)
# Use Belor'relos, the Suncaller before we go into our cooldowns
actions.cds+=/use_item,name=belorrelos_the_suncaller,use_off_gcd=1,if=gcd.remains>0&(!raid_event.adds.exists&!prev_gcd.1.mindbender|raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)|fight_remains<20
# Fit in a Divine Star as you cast Belor's for the free GCD.
actions.cds+=/divine_star,if=(raid_event.adds.up|spell_targets.belorrelos_the_suncaller>=5)&equipped.belorrelos_the_suncaller&trinket.belorrelos_the_suncaller.cooldown.remains<=gcd.max
# Sync Power Infusion with Voidform or Dark Ascension
actions.cds+=/power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
# Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
# Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
actions.cds+=/call_action_list,name=trinkets
# Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.cds+=/desperate_prayer,if=health.pct<=75

# Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
actions.filler=vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
actions.filler+=/shadow_word_death,target_if=target.health.pct<20|(buff.deathspeaker.up|set_bonus.tier31_2pc)&dot.devouring_plague.ticking
actions.filler+=/mind_spike_insanity,target_if=max:dot.devouring_plague.remains,if=dot.devouring_plague.remains>cast_time
actions.filler+=/mind_flay,target_if=max:dot.devouring_plague.remains,if=buff.mind_flay_insanity.up
actions.filler+=/mindgames,target_if=max:dot.devouring_plague.remains
actions.filler+=/shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
# Save up to 20s if adds are coming soon.
actions.filler+=/halo,if=spell_targets>1
actions.filler+=/mind_spike,target_if=max:dot.devouring_plague.remains
actions.filler+=/mind_flay,target_if=max:dot.devouring_plague.remains,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
actions.filler+=/divine_star
# Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
actions.filler+=/shadow_crash,if=raid_event.adds.in>20&!set_bonus.tier31_4pc
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.filler+=/shadow_word_death,target_if=target.health.pct<20
# Use Shadow Word: Death while moving as a low-priority action
actions.filler+=/shadow_word_death,target_if=max:dot.devouring_plague.remains
# Use Shadow Word: Pain while moving as a low-priority action with T31 4pc
actions.filler+=/shadow_word_pain,target_if=max:dot.devouring_plague.remains,if=set_bonus.tier31_4pc
# Use Shadow Word: Pain while moving as a low-priority action without T31 4pc
actions.filler+=/shadow_word_pain,target_if=min:remains,if=!set_bonus.tier31_4pc

actions.main=variable,name=dots_up,op=set,value=active_dot.vampiric_touch=active_enemies|action.shadow_crash.in_flight&talent.whispering_shadows
actions.main+=/call_action_list,name=cds,if=fight_remains<30|target.time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active and sync with Dark Ascension
actions.main+=/mindbender,if=variable.dots_up&(fight_remains<30|target.time_to_die>15)&(!talent.dark_ascension|cooldown.dark_ascension.remains<gcd.max|fight_remains<15)
actions.main+=/devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=remains<=gcd.max|insanity.deficit<=16
actions.main+=/shadow_word_death,if=(set_bonus.tier31_4pc|pet.fiend.active&talent.inescapable_torment&set_bonus.tier31_2pc)&dot.devouring_plague.ticking
# High priority Mind Blast action when using Inescapable Torment
actions.main+=/mind_blast,target_if=dot.devouring_plague.remains>execute_time&(cooldown.mind_blast.full_recharge_time<=gcd.max+execute_time)|pet.fiend.remains<=execute_time+gcd.max,if=pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>execute_time&active_enemies<=7
# High Priority Shadow Word: Death is Mindbender is expiring in less than 2 seconds
actions.main+=/shadow_word_death,target_if=dot.devouring_plague.ticking&pet.fiend.remains<=2&pet.fiend.active&talent.inescapable_torment&active_enemies<=7
actions.main+=/void_bolt,if=variable.dots_up
# Spend your Insanity on Devouring Plague at will if the fight will end in less than 10s
actions.main+=/devouring_plague,if=fight_remains<=duration+4
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.main+=/devouring_plague,target_if=!talent.distorted_reality|active_enemies=1|remains<=gcd.max,if=(remains<=gcd.max|remains<3&cooldown.void_torrent.up)|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<=buff.voidform.remains+2|buff.mind_devourer.up&pmultiplier<1.2
actions.main+=/shadow_word_death,if=set_bonus.tier31_2pc
# Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
actions.main+=/shadow_crash,if=!variable.holding_crash&(dot.vampiric_touch.refreshable|buff.deaths_torment.stack>9&set_bonus.tier31_4pc)
# Consume T31 4pc SWPs
actions.main+=/shadow_word_pain,if=buff.deaths_torment.stack>9&set_bonus.tier31_4pc&(!variable.holding_crash|!talent.shadow_crash)
# Use Shadow Word: Death with Inescapable Torment and Mindbender active and not talented into Insidious Ire and Yogg or Deathspeaker is active
actions.main+=/shadow_word_death,if=variable.dots_up&talent.inescapable_torment&pet.fiend.active&((!talent.insidious_ire&!talent.idol_of_yoggsaron)|buff.deathspeaker.up)&!set_bonus.tier31_2pc
# Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
actions.main+=/vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
# Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.main+=/mind_blast,if=(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
actions.main+=/void_torrent,if=!variable.holding_crash,target_if=dot.devouring_plague.remains>=2.5,interrupt_if=cooldown.shadow_word_death.ready&pet.fiend.active&set_bonus.tier31_2pc
# Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.main+=/call_action_list,name=filler

actions.trinkets=use_item,name=voidmenders_shadowgem,if=(buff.power_infusion.up|fight_remains<20)&equipped.voidmenders_shadowgem
actions.trinkets+=/use_item,name=iridal_the_earths_master,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
actions.trinkets+=/use_item,name=dreambinder_loom_of_the_great_cycle,use_off_gcd=1,if=gcd.remains>0|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno,if=equipped.darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime,if=equipped.darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance,if=equipped.darkmoon_deck_box_dance
# Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
actions.trinkets+=/use_item,name=erupting_spear_fragment,if=(buff.power_infusion.up|raid_event.adds.up|fight_remains<20)&equipped.erupting_spear_fragment
# Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
actions.trinkets+=/use_item,name=beacon_to_the_beyond,if=(!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20)&equipped.beacon_to_the_beyond
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
actions.trinkets+=/use_item,name=desperate_invokers_codex,if=equipped.desperate_invokers_codex

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=9166
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 49816 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
49816.3 49816.3 51.7 / 0.104% 8892.8 / 17.9% 68.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
677.7 676.1 Mana 0.89% 52.0 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQJJSIAAAAAAAAAAAAgSESCJkioQSDAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 49816
Doom Winds 101 0.2% 3.7 90.42s 8059 7270 Direct 3.7 6661 13341 8059 20.9% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.1086 0.0000 30085.17 42979.92 30.00% 7270.46 7270.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.07% 2.95 0 4 6661.00 3768 12982 6640.06 0 9816 19662 28090 29.82%
crit 20.93% 0.78 0 4 13341.20 7535 21736 7728.64 0 20939 10423 14890 17.35%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.73
  • if_expr:raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Flame Shock 1531 3.1% 29.5 10.02s 15545 41080 Direct 29.5 2749 5503 3320 20.7% 0.0%
Periodic 184.2 1626 3252 1960 20.6% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.54 29.54 184.18 184.18 27.94 0.3784 1.5777 459147.86 459147.86 0.00% 1521.55 41079.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.25% 23.41 11 38 2748.80 2332 4450 2748.85 2449 3142 64344 64344 0.00%
crit 20.75% 6.13 0 16 5502.77 4664 8900 5488.71 0 7985 33724 33724 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.44% 146.31 100 190 1626.24 2 2603 1625.96 1493 1837 237935 237935 0.00%
crit 20.56% 37.87 14 64 3251.76 5 5206 3251.46 2892 3715 123145 123145 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Volcanic damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Volcanic damage and then an additional {$=}o2 Volcanic damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Volcanic damage and knocking them into the air.]

Action Priority List

    single
    [O]:1.60
  • if_expr:!ticking
    single
    [W]:7.91

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Spell Periodic AmountFire and Ice3828862PCT0.030
Flametongue Weapon 0 (1370) 0.0% (2.8%) 1.0 0.00s 410594 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFire and Ice3828861PCT0.030
    Flametongue Attack 1370 2.8% 992.8 0.68s 414 0 Direct 992.8 343 686 414 20.7% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 992.77 992.77 0.00 0.00 0.00 0.0000 0.0000 410593.79 410593.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 787.76 523 1064 342.66 285 555 342.75 317 384 269935 269935 0.00%
crit 20.65% 205.01 118 302 686.09 569 1110 686.30 623 763 140658 140658 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Forgestorm Ignited (_damage) 1239 2.5% 28.5 7.72s 13038 0 Direct 28.5 10809 21620 13038 20.6% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.53 28.53 0.00 0.00 0.00 0.0000 0.0000 371990.50 371990.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.38% 22.65 1 61 10809.21 10705 11241 10800.97 10705 11192 244810 244810 0.00%
crit 20.62% 5.88 0 20 21620.12 21411 22481 21333.30 0 22481 127180 127180 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 968 1.9% 14.2 19.46s 20425 17070 Direct 14.2 16919 33941 20424 20.6% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.23 14.23 0.00 0.00 0.00 1.1965 0.0000 290555.40 290555.40 0.00% 17070.41 17070.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.41% 11.30 2 23 16919.21 7534 29687 16971.87 12085 21206 191117 191117 0.00%
crit 20.59% 2.93 0 10 33941.02 15068 59374 32309.55 0 58696 99438 99438 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [U]:14.23

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownEnhancement Shaman1370417ADD6000.000
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Ice Strike 1881 3.8% 21.5 13.80s 26186 22070 Direct 21.5 21699 43397 26186 20.7% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.54 21.54 0.00 0.00 0.00 1.1865 0.0000 564033.54 564033.54 0.00% 22070.49 22070.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.32% 17.09 8 26 21699.50 17718 35004 21698.31 19436 24936 370753 370753 0.00%
crit 20.68% 4.45 0 13 43397.18 35436 69815 43053.56 0 65800 193280 193280 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [P]:20.50
  • if_expr:!buff.ice_strike.up
    single
    [R]:1.04

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Lava Lash 1761 3.5% 20.0 14.70s 26362 22154 Direct 20.0 21881 43790 26362 20.5% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.03 20.03 0.00 0.00 0.00 1.1900 0.0000 528001.89 528001.89 0.00% 22154.24 22154.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.55% 15.93 7 25 21880.75 18660 35012 21875.06 19162 26022 348615 348615 0.00%
crit 20.45% 4.10 0 12 43789.67 37319 70023 43305.45 0 68419 179387 179387 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [Q]:20.03

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownMolten Assault3340331ADD-3000.000
Spell Direct AmountFire and Ice3828861PCT0.030
Lightning Bolt 13766 27.6% 68.0 4.38s 60678 51268 Direct 68.0 50277 100597 60677 20.7% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.02 68.02 0.00 0.00 0.00 1.1836 0.0000 4127310.05 4127310.05 0.00% 51268.38 51268.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.33% 53.96 29 77 50276.85 34015 101174 50287.04 43708 59079 2712986 2712986 0.00%
crit 20.67% 14.06 2 29 100597.16 68031 200376 100627.78 76437 142235 1414325 1414325 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.09

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [N]:68.02
  • if_expr:((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
Spell Direct AmountThorim's Invocation3844442PCT0.200
main_hand 1789 3.6% 193.4 1.81s 2774 1557 Direct 193.4 2661 5326 2774 20.6% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.40 193.40 0.00 0.00 0.00 1.7821 0.0000 536464.59 766397.53 30.00% 1556.53 1556.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.03% 121.89 77 175 2660.54 2257 4294 2660.62 2458 3027 324294 463289 30.00%
crit 20.60% 39.84 18 70 5325.51 4513 8587 5325.48 4781 6037 212170 303108 30.00%
miss 16.37% 31.67 12 59 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 896 1.8% 193.4 1.80s 1389 779 Direct 193.4 1332 2665 1389 20.6% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.43 193.43 0.00 0.00 0.00 1.7834 0.0000 268617.66 383749.30 30.00% 778.69 778.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.00% 121.86 76 171 1332.01 1128 2151 1332.02 1228 1501 162320 231892 30.00%
crit 20.62% 39.88 19 69 2665.15 2257 4302 2665.35 2349 3001 106298 151858 30.00%
miss 16.38% 31.68 13 59 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (9736) 0.0% (19.5%) 90.9 3.29s 32092 27325

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.91 0.00 0.00 0.00 0.00 1.1745 0.0000 0.00 0.00 0.00% 27324.79 27324.79

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:57.39
  • if_expr:buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
    single
    [S]:33.52

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
    Stormstrike (_mh) 5276 (6490) 10.6% (13.0%) 121.1 2.46s 16058 0 Direct 121.1 (173.8) 10812 21663 13053 20.6% (14.4%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 121.12 121.12 0.00 0.00 0.00 0.0000 0.0000 1580963.04 2258576.21 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 96.11 53 141 10811.73 3255 27722 10832.51 8809 12888 1039146 1484532 30.00%
crit 20.65% 25.01 6 48 21663.15 6510 53614 21705.19 14600 31413 541817 774044 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
        Stormblast (_stormstrike_mh) 1215 2.4% 52.7 5.61s 6906 0 Direct 52.7 6906 0 6906 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.71 52.71 0.00 0.00 0.00 0.0000 0.0000 364001.71 364001.71 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 52.71 24 88 6906.38 3572 24570 6907.90 5419 8780 364002 364002 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2638 (3246) 5.3% (6.5%) 121.1 2.46s 8029 0 Direct 121.1 (173.8) 5406 10828 6527 20.7% (14.4%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 121.12 121.12 0.00 0.00 0.00 0.0000 0.0000 790534.85 1129364.30 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.34% 96.09 53 145 5406.30 1628 13861 5416.47 4712 6483 519520 742190 30.00%
crit 20.66% 25.03 7 51 10828.20 3255 26768 10847.66 7610 14452 271015 387174 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
        Stormblast (_stormstrike_offhand) 608 1.2% 52.7 5.61s 3454 0 Direct 52.7 3454 0 3454 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.71 52.71 0.00 0.00 0.00 0.0000 0.0000 182022.74 182022.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 52.71 24 88 3453.58 1786 12340 3454.67 2727 4647 182023 182023 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 972 2.0% 6.0 50.67s 48548 40811 Direct 6.0 40280 80320 48548 20.6% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 6.01 0.00 0.00 0.00 1.1896 0.0000 291672.95 291672.95 0.00% 40810.54 40810.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 4.77 0 8 40280.10 26249 83589 40322.01 0 62508 192030 192030 0.00%
crit 20.65% 1.24 0 5 80320.28 52498 163671 60073.23 0 163671 99643 99643 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [T]:6.01
  • if_expr:raid_event.adds.in>=action.sundering.cooldown

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Tempest Strikes 3784 7.6% 162.7 1.83s 6973 0 Direct 162.7 5779 11564 6973 20.6% 0.0%

Stats Details: Tempest Strikes

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 162.65 162.65 0.00 0.00 0.00 0.0000 0.0000 1134187.25 1134187.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.36% 129.08 82 184 5779.29 4848 9379 5780.22 5307 6488 746017 746017 0.00%
crit 20.64% 33.57 12 64 11563.82 9695 18681 11564.14 10106 13591 388170 388170 0.00%

Action Details: Tempest Strikes

  • id:428078
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:428078
  • name:Tempest Strikes
  • school:nature
  • tooltip:
  • description:{$@spelldesc428071=Stormstrike, Ice Strike, and Lava Lash have a {$h=100}% chance to discharge electricity at your target, dealing {$428078s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Windfury Weapon 0 (6905) 0.0% (13.8%) 1.0 0.00s 2066677 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6905 13.8% 375.7 2.49s 5500 0 Direct 375.7 4554 9127 5500 20.7% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 375.74 375.74 0.00 0.00 0.00 0.0000 0.0000 2066677.11 2952471.15 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.31% 298.01 184 457 4554.15 1878 11455 4555.47 4000 5474 1357164 1938855 30.00%
crit 20.69% 77.73 35 127 9127.29 3756 22683 9128.24 7289 11654 709513 1013616 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
pet - greater_earth_elemental 431 / 89
melee 431 0.2% 38.9 2.21s 682 438 Direct 38.9 565 1130 682 20.7% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.91 38.91 0.00 0.00 0.00 1.5569 0.0000 26538.19 37912.66 30.00% 438.03 438.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.32% 30.87 6 56 565.14 488 896 564.29 488 718 17445 24922 30.00%
crit 20.68% 8.05 0 21 1130.14 976 1792 1128.02 0 1519 9093 12991 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4089 / 3027
melee 4089 6.1% 383.0 1.56s 2367 2039 Direct 383.0 1961 3927 2367 20.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 383.04 383.04 0.00 0.00 0.00 1.1608 0.0000 906636.32 1295227.77 30.00% 2039.12 2039.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.36% 303.98 201 415 1961.08 1630 3124 1961.50 1798 2229 596139 851648 30.00%
crit 20.64% 79.06 41 117 3927.38 3260 6247 3928.16 3542 4462 310498 443579 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.1 308.67s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.11 0.00 0.00 0.00 0.00 1.0393 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [V]:1.11
Feral Spirit 15.5 20.45s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.50 0.00 0.00 0.00 0.00 1.1699 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:15.50

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 301.88s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 3.1 114.03s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.09 0.00 0.00 0.00 0.00 0.5586 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Action Priority List

    single
    [M]:1.49
  • if_expr:!buff.windfury_totem.up
    single
    [X]:0.59
  • if_expr:buff.windfury_totem.remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.3s 58.6s 50.3s 80.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 331.0s
  • trigger_min/max:15.0s / 288.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 353.2s
  • uptime_min/max:46.02% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.28%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Crumbling Power 2.0 0.0 180.4s 5.4s 18.5s 12.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.3s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s
  • uptime_min/max:10.25% / 15.42%

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.36%
  • crumbling_power_3:0.73%
  • crumbling_power_4:0.75%
  • crumbling_power_5:0.75%
  • crumbling_power_6:0.71%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.67%
  • crumbling_power_19:0.69%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4s 90.4s 7.9s 9.88% 12.50% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.4s
  • trigger_min/max:90.0s / 92.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:8.76% / 11.44%

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 15.5 0.0 22.2s 19.9s 16.9s 74.02% 100.00% 0.0 (0.0) 12.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 95.2s
  • trigger_min/max:4.8s / 38.3s
  • trigger_pct:49.99%
  • duration_min/max:0.0s / 83.4s
  • uptime_min/max:60.82% / 88.14%

Stack Uptimes

  • earthen_weapon_2:72.32%
  • earthen_weapon_4:1.70%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 301.2s 302.0s 27.5s 13.45% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 319.3s
  • trigger_min/max:300.0s / 319.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.97% / 18.16%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.45%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 13.1 2.4 23.7s 20.4s 16.9s 74.03% 0.00% 62.2 (62.2) 12.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 95.2s
  • trigger_min/max:4.8s / 38.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 83.4s
  • uptime_min/max:60.84% / 88.16%

Stack Uptimes

  • feral_spirit_1:74.03%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 36.7 446.9 8.2s 0.6s 7.2s 88.24% 92.43% 446.9 (1084.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 73.1s
  • trigger_min/max:0.0s / 20.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.9s
  • uptime_min/max:77.21% / 95.94%

Stack Uptimes

  • flurry_1:18.88%
  • flurry_2:36.02%
  • flurry_3:33.34%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 108.1 17.9s 2.4s 14.6s 83.79% 100.00% 48.0 (48.0) 16.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 54.0s
  • trigger_min/max:0.0s / 46.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:69.64% / 93.88%

Stack Uptimes

  • forceful_winds_1:16.12%
  • forceful_winds_2:14.94%
  • forceful_winds_3:13.17%
  • forceful_winds_4:10.63%
  • forceful_winds_5:28.93%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=20}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.4s 46.3s 13.0s 19.58% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 202.5s
  • trigger_min/max:0.1s / 202.5s
  • trigger_pct:98.74%
  • duration_min/max:0.0s / 61.1s
  • uptime_min/max:4.18% / 46.16%

Stack Uptimes

  • forgestorm_ignited_1:19.58%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.5 1.0 14.5s 13.8s 8.9s 60.96% 87.63% 1.0 (1.0) 7.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.7s / 60.1s
  • trigger_min/max:8.7s / 44.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.2s
  • uptime_min/max:42.08% / 81.05%

Stack Uptimes

  • ice_strike_1:60.96%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 25.1 23.5 11.9s 6.1s 8.1s 67.91% 100.00% 23.5 (23.5) 24.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 53.2s
  • trigger_min/max:0.9s / 29.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.0s
  • uptime_min/max:54.96% / 80.97%

Stack Uptimes

  • legacy_of_the_frost_witch_1:67.91%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your Physical and Frost abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 68.9 400.8 4.4s 0.6s 3.7s 83.92% 100.00% 58.8 (58.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 23.9s
  • trigger_min/max:0.0s / 7.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.5s
  • uptime_min/max:77.82% / 90.04%

Stack Uptimes

  • maelstrom_weapon_1:9.85%
  • maelstrom_weapon_2:10.44%
  • maelstrom_weapon_3:11.49%
  • maelstrom_weapon_4:11.98%
  • maelstrom_weapon_5:9.97%
  • maelstrom_weapon_6:7.29%
  • maelstrom_weapon_7:5.10%
  • maelstrom_weapon_8:3.74%
  • maelstrom_weapon_9:2.85%
  • maelstrom_weapon_10:11.21%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.2s 45.7s 16.5s 23.66% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 209.6s
  • trigger_min/max:0.0s / 209.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 84.7s
  • uptime_min/max:4.71% / 58.01%

Stack Uptimes

  • sophic_devotion_1:23.66%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.6s 45.7s 32.3s 38.26% 0.00% 25.8 (25.8) 3.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 259.6s
  • trigger_min/max:0.0s / 207.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 178.7s
  • uptime_min/max:8.36% / 90.34%

Stack Uptimes

  • spiraling_winds_1:2.34%
  • spiraling_winds_2:2.31%
  • spiraling_winds_3:2.30%
  • spiraling_winds_4:2.28%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.23%
  • spiraling_winds_8:2.22%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.86%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Stormbringer 52.9 15.1 5.6s 4.3s 1.1s 19.42% 57.75% 15.1 (15.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 88.6s
  • trigger_min/max:0.0s / 88.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s
  • uptime_min/max:9.45% / 31.75%

Stack Uptimes

  • stormbringer_1:19.42%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.5 36.0 69.0 17.9s 15.0s 54.0s
Windfury-ForcefulWinds: 2 50.6 33.0 66.0 18.2s 0.3s 70.3s
Windfury-ForcefulWinds: 3 48.3 27.0 66.0 19.0s 0.3s 86.8s
Windfury-ForcefulWinds: 4 43.9 24.0 63.0 20.9s 1.1s 96.5s
Windfury-ForcefulWinds: 5 181.4 90.0 318.0 5.0s 0.0s 88.5s
Windfury (Main Hand) 26.8 10.0 49.0 11.0s 1.3s 132.5s
Windfury (Off Hand) 26.7 10.0 53.0 11.0s 1.3s 132.8s
Windfury: Unruly Winds 125.2 77.0 189.0 2.5s 0.0s 46.4s
Stormflurry 30.2 8.0 57.0 9.5s 0.0s 140.2s
Flametongue: Windfury Attack 375.7 231.0 567.0 2.5s 0.0s 46.4s
Stormbringer: Windfury Attack 38.4 15.0 77.0 8.6s 0.0s 112.2s
Flametongue: main_hand 161.7 112.0 217.0 2.2s 1.3s 15.4s
Windfury: main_hand 61.2 33.0 103.0 5.3s 1.3s 66.0s
Flametongue: offhand 161.7 113.0 220.0 2.2s 1.3s 18.8s
Flametongue: Doom Winds 3.7 3.0 4.0 90.4s 90.0s 92.4s
Windfury: Doom Winds 3.7 3.0 4.0 90.4s 90.0s 92.4s
Flametongue: Lava Lash 20.0 13.0 27.0 14.7s 8.8s 50.8s
Stormbringer: Lava Lash 2.0 0.0 9.0 77.0s 8.8s 325.2s
Flametongue: Sundering 6.0 3.0 8.0 50.7s 40.0s 178.9s
Stormbringer: Sundering 0.6 0.0 5.0 114.9s 40.0s 338.3s
Windfury: Sundering 1.9 0.0 6.0 93.8s 40.0s 343.5s
Flametongue: Ice Strike 21.5 15.0 28.0 13.8s 8.7s 44.9s
Stormbringer: Ice Strike 2.2 0.0 10.0 75.2s 8.7s 332.4s
Windfury: Ice Strike 7.2 0.0 17.0 38.7s 8.7s 278.7s
Flametongue: Stormstrike 121.1 68.0 175.0 2.5s 0.0s 18.7s
Stormbringer: Stormstrike 12.4 1.0 33.0 22.2s 0.0s 233.3s
Windfury: Stormstrike 51.3 24.0 94.0 5.8s 0.0s 85.1s
Flametongue: Stormstrike Off-Hand 121.1 68.0 175.0 2.5s 0.0s 18.7s
Stormbringer: Stormstrike Off-Hand 12.4 1.0 27.0 22.3s 0.0s 227.9s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 36.55% 23.44% 45.30% 0.6s 0.0s 4.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike
Stormstrike		1.3170.0008.257120.26169.765192.858
Feral Spirit0.7880.0001.48812.2284.25119.959
Doom Winds0.5410.0002.3932.0210.8647.001
Lava Lash3.2710.00038.44666.23129.010118.958
Sundering12.1360.000138.86875.52817.140178.004
Ice Strike2.2610.00032.59549.11417.56196.087
Frost Shock15.4330.000206.644232.555147.405325.104
Flame Shock24.4030.000260.905255.623173.668342.299
Earth Elemental32.3420.000272.47137.43610.393272.471

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack73.616.414.88%27.93%
main_hand34.74.27.01%7.09%
offhand34.34.46.94%7.46%
Feral Spirit76.19.415.37%15.92%
Doom Winds0.80.10.17%0.11%
Lightning Bolt97.60.019.73%0.00%
Lava Lash24.90.05.02%0.00%
Sundering1.40.00.29%0.00%
Ice Strike26.70.05.40%0.00%
Stormstrike76.014.915.35%25.41%
Stormstrike (_mh)24.64.64.96%7.79%
Stormstrike Off-Hand24.24.94.89%8.29%
Overflow Stacks0.058.80.00%10.62%
Actual Stacks495.00.089.38%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt490.9100.00%
Total Spent490.9100.00%
Casts per Maelstrom Weapon Stack Consumed
Ability 0 1 2 3 4 5 6 7 8 9 10
Lightning Bolt          18.39 13.30 9.05 6.23 4.56 16.50
Total           18.39
(27.03%)		 13.30
(19.55%)		 9.05
(13.30%)		 6.23
(9.16%)		 4.56
(6.71%)		 16.50
(24.25%)

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
Mana RegenMana649.29202823.20100.00%312.38564208.0073.56%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 270980.0 0.00 870.04 0.0 9967.8 -486130.8 270980.0
Mana 250000.0 676.08 677.68 564207.7 249520.1 247000.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.001000.000.49%1000.001000.000.00
Flame ShockMana 9.517130.753.51%750.00241.4264.39
Frost ShockMana 14.237112.853.50%500.00500.0140.85
Ice StrikeMana 21.5435540.2217.48%1650.001650.0115.87
Lava LashMana 20.038011.633.94%400.00400.0065.90
Lightning BoltMana 68.0234009.9316.73%500.00500.00121.36
StormstrikeMana 90.9190910.2844.72%1000.00999.9932.09
SunderingMana 6.0118023.208.87%3000.002999.9316.18
Windfury TotemMana 3.091564.290.77%506.95506.940.00

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 49816.28
Minimum 42155.53
Maximum 59182.27
Spread ( max - min ) 17026.74
Range [ ( max - min ) / 2 * 100% ] 17.09%
Standard Deviation 2284.8682
5th Percentile 46221.88
95th Percentile 53690.46
( 95th Percentile - 5th Percentile ) 7468.58
Mean Distribution
Standard Deviation 26.3851
95.00% Confidence Interval ( 49764.57 - 49868.00 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8082
0.1 Scale Factor Error with Delta=300 44567
0.05 Scale Factor Error with Delta=300 178265
0.01 Scale Factor Error with Delta=300 4456624
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 49816.28
Minimum 42155.53
Maximum 59182.27
Spread ( max - min ) 17026.74
Range [ ( max - min ) / 2 * 100% ] 17.09%
Standard Deviation 2284.8682
5th Percentile 46221.88
95th Percentile 53690.46
( 95th Percentile - 5th Percentile ) 7468.58
Mean Distribution
Standard Deviation 26.3851
95.00% Confidence Interval ( 49764.57 - 49868.00 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8082
0.1 Scale Factor Error with Delta=300 44567
0.05 Scale Factor Error with Delta=300 178265
0.01 Scale Factor Error with Delta=300 4456624
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 49816.28
Minimum 42155.53
Maximum 59182.27
Spread ( max - min ) 17026.74
Range [ ( max - min ) / 2 * 100% ] 17.09%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 13996860.11
Minimum 9599450.66
Maximum 18436780.12
Spread ( max - min ) 8837329.46
Range [ ( max - min ) / 2 * 100% ] 31.57%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 868.73
Minimum 0.00
Maximum 2390.03
Spread ( max - min ) 2390.03
Range [ ( max - min ) / 2 * 100% ] 137.56%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
0.00 primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
G 15.50 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
H 3.73 doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
J 0.00 call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
K 0.00 call_action_list,name=funnel,if=active_enemies>1&rotation.funnel
actions.single
# count action,conditions
0.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
L 57.39 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
0.00 lava_lash,if=buff.hot_hand.up
M 1.49 windfury_totem,if=!buff.windfury_totem.up
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
N 68.02 lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
0.00 primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
O 1.60 flame_shock,if=!ticking
0.00 ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
0.00 lava_lash,if=talent.lashing_flames.enabled
P 20.50 ice_strike,if=!buff.ice_strike.up
0.00 frost_shock,if=buff.hailstorm.up
Q 20.03 lava_lash
R 1.04 ice_strike
0.00 windstrike
S 33.52 stormstrike
T 6.01 sundering,if=raid_event.adds.in>=action.sundering.cooldown
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
0.00 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
U 14.23 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
V 1.11 earth_elemental
W 7.91 flame_shock
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
X 0.59 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGHLLLLNLOPLLNQSTNUVPGNSQNULWPLNNQLNUWLGLLNPQLNSUWNSLNLPQNGSNSLNSPNNQLLGLNNPSTNQSNUWXHLNGLNLPNQSLLLGNSLNPLLNQSTNNSPLLGLNQSNSNNPSLNGLNQLLNPSUNSWNQSGLLNPSNTQUNEFSHLLLLGLLLNNNPQSLGLLLLNNLNMPQGLNSTNUWLLLNPQNLLNUWSGLNNLNPLNQUWSNSTPGLLLNLNHLLLNLLGLNOPQLLNSLNSLLN

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 250000.0/250000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 2 augmentation PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 3 windfury_weapon PR_Shaman_Enhancement 250000.0/250000: 100% mana corrupting_rage
Pre precombat 4 flametongue_weapon PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 6 windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(3), corrupting_rage
0:00.000 default B bloodlust Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), corrupting_rage
0:00.000 default C potion Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage
0:00.000 default D auto_attack Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default F berserking PR_Shaman_Enhancement 249000.0/250000: 100% mana bloodlust, flurry(3), forceful_winds, crumbling_power(20), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, berserking, flurry(3), forceful_winds, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:00.866 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:01.732 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, crumbling_power(18), corrupting_rage, elemental_potion_of_ultimate_power
0:02.599 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, crumbling_power(17), corrupting_rage, elemental_potion_of_ultimate_power
0:03.465 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(16), corrupting_rage, elemental_potion_of_ultimate_power
0:04.331 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(15), corrupting_rage, elemental_potion_of_ultimate_power
0:05.196 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(14), corrupting_rage, elemental_potion_of_ultimate_power
0:06.063 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, crumbling_power(13), corrupting_rage, elemental_potion_of_ultimate_power
0:06.929 single O flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), doom_winds, legacy_of_the_frost_witch, crumbling_power(12), corrupting_rage, elemental_potion_of_ultimate_power
0:07.796 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), doom_winds, legacy_of_the_frost_witch, crumbling_power(11), corrupting_rage, elemental_potion_of_ultimate_power
0:08.663 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), corrupting_rage, elemental_potion_of_ultimate_power
0:09.528 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(9), corrupting_rage, elemental_potion_of_ultimate_power
0:10.393 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, crumbling_power(8), corrupting_rage, elemental_potion_of_ultimate_power
0:11.260 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), corrupting_rage, elemental_potion_of_ultimate_power
0:12.128 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), corrupting_rage, elemental_potion_of_ultimate_power
0:13.083 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), corrupting_rage, elemental_potion_of_ultimate_power
0:14.036 single N lightning_bolt Fluffy_Pillow 249439.7/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), corrupting_rage, elemental_potion_of_ultimate_power
0:14.990 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), corrupting_rage, elemental_potion_of_ultimate_power
0:15.944 single V earth_elemental Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, maelstrom_weapon, crumbling_power(2), corrupting_rage, elemental_potion_of_ultimate_power
0:16.897 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), maelstrom_weapon, crumbling_power, corrupting_rage, elemental_potion_of_ultimate_power
0:17.854 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), forceful_winds(2), maelstrom_weapon(3), ice_strike, corrupting_rage, elemental_potion_of_ultimate_power
0:18.807 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), ice_strike, corrupting_rage, elemental_potion_of_ultimate_power
0:19.760 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage, elemental_potion_of_ultimate_power
0:20.714 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage, elemental_potion_of_ultimate_power
0:21.667 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage, elemental_potion_of_ultimate_power
0:22.619 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage, elemental_potion_of_ultimate_power
0:23.573 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage, elemental_potion_of_ultimate_power
0:24.527 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.480 Waiting     0.715s 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), corrupting_rage, elemental_potion_of_ultimate_power
0:26.195 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), corrupting_rage, elemental_potion_of_ultimate_power
0:27.342 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, corrupting_rage, elemental_potion_of_ultimate_power
0:28.295 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, corrupting_rage, elemental_potion_of_ultimate_power
0:29.250 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, corrupting_rage, elemental_potion_of_ultimate_power
0:30.204 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:31.158 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:32.112 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:33.065 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:34.019 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), forceful_winds, maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
0:34.973 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, forceful_winds(2), stormbringer, maelstrom_weapon(2), corrupting_rage
0:35.928 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), forceful_winds(3), stormbringer, maelstrom_weapon(8), corrupting_rage
0:36.880 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), corrupting_rage
0:37.833 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), corrupting_rage
0:38.789 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), corrupting_rage
0:39.743 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
0:40.696 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:41.934 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:43.172 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:44.410 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:45.650 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:46.890 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, corrupting_rage
0:48.127 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, corrupting_rage
0:49.365 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, corrupting_rage
0:50.604 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
0:51.841 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(7), legacy_of_the_frost_witch, corrupting_rage
0:53.080 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), stormbringer, legacy_of_the_frost_witch, corrupting_rage
0:54.318 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(3), maelstrom_weapon, corrupting_rage
0:55.557 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(2), ice_strike, corrupting_rage
0:56.795 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(4), maelstrom_weapon(6), ice_strike, corrupting_rage
0:58.033 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(4), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
0:59.273 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:00.510 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:01.749 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:02.987 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:04.225 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:05.463 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:06.703 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, corrupting_rage
1:07.941 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:09.179 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:10.418 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:11.658 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
1:12.897 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
1:14.135 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
1:15.374 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, forgestorm_ignited
1:16.611 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, forgestorm_ignited
1:17.850 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
1:19.090 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited
1:20.328 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited
1:21.566 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited
1:22.804 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited
1:24.041 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited
1:25.280 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion
1:26.520 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion
1:27.759 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
1:28.996 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), sophic_devotion, corrupting_rage
1:30.235 single X windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(2), maelstrom_weapon(4), sophic_devotion, corrupting_rage
1:31.061 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(4), sophic_devotion, corrupting_rage
1:32.300 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(4), doom_winds, sophic_devotion, corrupting_rage
1:33.538 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(8), doom_winds, sophic_devotion, corrupting_rage
1:34.776 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(8), doom_winds, legacy_of_the_frost_witch, corrupting_rage
1:36.014 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, corrupting_rage
1:37.253 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, corrupting_rage
1:38.490 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), doom_winds, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:39.729 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:40.967 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:42.205 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:43.443 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:44.680 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:45.917 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:47.157 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, forgestorm_ignited, corrupting_rage
1:48.397 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, forgestorm_ignited, corrupting_rage
1:49.634 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), ice_strike, forgestorm_ignited, corrupting_rage
1:50.873 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
1:52.111 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds, forgestorm_ignited, corrupting_rage
1:53.349 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds, forgestorm_ignited, corrupting_rage
1:54.586 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, corrupting_rage
1:55.826 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(2), corrupting_rage
1:57.064 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(3), corrupting_rage
1:58.303 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(4), corrupting_rage
1:59.543 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), corrupting_rage
2:00.783 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), corrupting_rage
2:02.022 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), corrupting_rage
2:03.260 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), corrupting_rage
2:04.498 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), corrupting_rage
2:05.736 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), corrupting_rage
2:06.975 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(8), corrupting_rage
2:08.214 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds, stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), corrupting_rage
2:09.452 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), stormbringer, maelstrom_weapon(6), ice_strike, spiraling_winds(9), corrupting_rage
2:10.692 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), corrupting_rage
2:11.930 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), corrupting_rage
2:13.169 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), corrupting_rage
2:14.407 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:15.647 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:16.886 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:18.124 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
2:19.363 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, corrupting_rage
2:20.601 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
2:21.840 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds, sophic_devotion, corrupting_rage
2:23.080 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, corrupting_rage
2:24.319 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, forgestorm_ignited, corrupting_rage
2:25.556 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, forgestorm_ignited, corrupting_rage
2:26.793 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds(4), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, forgestorm_ignited, corrupting_rage
2:28.031 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, forgestorm_ignited, corrupting_rage
2:29.270 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, forgestorm_ignited, corrupting_rage
2:30.508 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, forgestorm_ignited, corrupting_rage
2:31.749 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(6), sophic_devotion, forgestorm_ignited, corrupting_rage
2:32.988 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(7), sophic_devotion, forgestorm_ignited, corrupting_rage
2:34.226 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(7), sophic_devotion, forgestorm_ignited, corrupting_rage
2:35.464 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, corrupting_rage
2:36.702 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), corrupting_rage
2:37.939 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), corrupting_rage
2:39.176 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:40.415 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:41.654 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:42.893 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(3), maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:44.132 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(4), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:45.371 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
2:46.606 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, corrupting_rage
2:48.031 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(6)
2:49.269 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10)
2:50.507 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10)
2:51.746 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch
2:52.985 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion
2:54.223 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion
2:55.462 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion
2:56.700 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, spiraling_winds(3), sophic_devotion
2:57.939 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, spiraling_winds(4), sophic_devotion
2:59.178 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), spiraling_winds(4), sophic_devotion
3:00.418 default E use_item_irideus_fragment Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion
3:00.418 default F berserking PR_Shaman_Enhancement 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(20), spiraling_winds(5), sophic_devotion
3:00.418 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(19), spiraling_winds(5), sophic_devotion
3:01.544 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(19), spiraling_winds(5), sophic_devotion
3:02.667 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, forceful_winds(3), stormbringer, maelstrom_weapon(5), doom_winds, legacy_of_the_frost_witch, crumbling_power(18), spiraling_winds(6), sophic_devotion, corrupting_rage
3:03.793 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, crumbling_power(17), spiraling_winds(7), sophic_devotion, corrupting_rage
3:04.918 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(16), spiraling_winds(7), sophic_devotion, corrupting_rage
3:06.044 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(15), spiraling_winds(8), sophic_devotion, corrupting_rage
3:07.168 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(14), spiraling_winds(8), sophic_devotion, corrupting_rage
3:08.293 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(13), spiraling_winds(9), corrupting_rage
3:09.417 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(12), spiraling_winds(9), corrupting_rage
3:10.543 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), crumbling_power(11), spiraling_winds(10), corrupting_rage
3:11.668 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), crumbling_power(10), spiraling_winds(10), corrupting_rage
3:12.793 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(10), corrupting_rage
3:14.032 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(10), corrupting_rage
3:15.269 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(10), corrupting_rage
3:16.507 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(10), corrupting_rage
3:17.746 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(10), corrupting_rage
3:18.985 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(10), corrupting_rage
3:20.224 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, crumbling_power(3), spiraling_winds(10), corrupting_rage
3:21.463 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds, earthen_weapon(4), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), corrupting_rage
3:22.702 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), corrupting_rage
3:23.939 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), corrupting_rage
3:25.178 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), corrupting_rage
3:26.416 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), corrupting_rage
3:27.656 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
3:28.896 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
3:30.135 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
3:31.374 single M windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
3:32.201 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), corrupting_rage
3:33.438 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
3:34.676 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
3:35.915 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
3:37.153 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
3:38.391 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
3:39.630 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
3:40.867 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, corrupting_rage
3:42.106 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
3:43.344 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), sophic_devotion, corrupting_rage
3:44.583 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(4), sophic_devotion, corrupting_rage
3:45.821 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(5), sophic_devotion, corrupting_rage
3:47.058 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(8), sophic_devotion, corrupting_rage
3:48.296 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), corrupting_rage
3:49.536 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, corrupting_rage
3:50.773 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:52.010 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:53.249 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds, stormbringer, ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:54.487 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:55.726 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:56.963 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
3:58.201 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon, corrupting_rage
3:59.441 Waiting     1.052s 250000.0/250000: 100% mana flurry, forceful_winds(2), maelstrom_weapon, corrupting_rage
4:00.493 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(2), corrupting_rage
4:01.896 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(7), corrupting_rage
4:03.135 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(9), corrupting_rage
4:04.375 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), corrupting_rage
4:05.613 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, corrupting_rage
4:06.851 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, legacy_of_the_frost_witch, corrupting_rage
4:08.090 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:09.329 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:10.566 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:11.807 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:13.046 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:14.287 single U frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, sophic_devotion, corrupting_rage
4:15.526 single W flame_shock Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), sophic_devotion, corrupting_rage
4:16.764 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), sophic_devotion, corrupting_rage
4:18.003 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(3), maelstrom_weapon(5), sophic_devotion, corrupting_rage
4:19.241 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(3), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:20.479 single T sundering Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:21.718 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana forceful_winds(4), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:22.955 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, corrupting_rage
4:24.191 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, corrupting_rage
4:25.431 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, corrupting_rage
4:26.672 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, corrupting_rage
4:27.910 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, corrupting_rage
4:29.148 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:30.388 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:31.626 default H doom_winds Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, corrupting_rage
4:32.864 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
4:34.103 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, forgestorm_ignited, corrupting_rage
4:35.342 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, forgestorm_ignited, corrupting_rage
4:36.579 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, forgestorm_ignited, corrupting_rage
4:37.817 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), doom_winds, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
4:39.055 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(6), doom_winds, legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
4:40.293 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, stormbringer, maelstrom_weapon(9), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
4:41.530 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited, corrupting_rage
4:42.768 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), forgestorm_ignited, corrupting_rage
4:44.006 single O flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, corrupting_rage
4:45.244 single P ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch
4:46.483 single Q lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch
4:47.721 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch
4:48.960 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike
4:50.198 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike
4:51.437 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch
4:52.677 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch
4:53.913 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch
4:55.153 single S stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch
4:56.391 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, forceful_winds, stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch
4:57.627 single L stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch
4:58.864 single N lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(10), legacy_of_the_frost_witch

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 250000 250000 0
Spell Power 6635 6149 0
Crit 21.84% 15.63% 1013
Haste 21.55% 21.55% 3663
Versatility 3.93% 0.93% 191
Mana Regen 2560 2560 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [16]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [29]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQJJSIAAAAAAAAAAAAgSESCJkioQSDAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
actions+=/primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
actions+=/call_action_list,name=funnel,if=active_enemies>1&rotation.funnel

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.funnel=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.funnel+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.funnel+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/windstrike,if=(talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1)|buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/stormstrike,if=buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&buff.crackling_thunder.up
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)|(talent.converging_storms.enabled&buff.converging_storms.stack<buff.converging_storms.max_stack)
actions.funnel+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.funnel+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.funnel+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.funnel+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.funnel+=/sundering
actions.funnel+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.funnel+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=3
actions.funnel+=/stormstrike,if=buff.crash_lightning.up&talent.deeply_rooted_elements.enabled
actions.funnel+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.funnel+=/windstrike
actions.funnel+=/stormstrike
actions.funnel+=/ice_strike
actions.funnel+=/lava_lash
actions.funnel+=/crash_lightning
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=2
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5
actions.funnel+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.funnel+=/flame_shock,if=!ticking
actions.funnel+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
actions.single+=/primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
actions.single+=/lava_lash,if=talent.lashing_flames.enabled
actions.single+=/ice_strike,if=!buff.ice_strike.up
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/ice_strike
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=action.sundering.cooldown
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Ele : 59173 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
59173.5 59173.5 55.5 / 0.094% 9492.4 / 16.0% 106.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
525.3 524.1 Mana 0.32% 53.6 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkESSSDlEAAAAAAAAAAAAAKRIJkQKiCJNAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Ele 59173
Elemental Blast 11371 19.2% 24.8 12.22s 137552 120114 Direct 24.8 113424 227093 137604 21.3% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.78 24.77 0.00 0.00 0.00 1.1452 0.0000 3408232.70 3408232.70 0.00% 120113.93 120113.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.73% 19.50 9 30 113423.91 46821 257855 113434.56 96745 133612 2211635 2211635 0.00%
crit 21.27% 5.27 0 15 227093.31 93643 528106 226372.32 0 401922 1196598 1196598 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:0.28
  • if_expr:buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
    single
    [O]:6.33
  • if_expr:buff.maelstrom_weapon.stack>=5&charges=max_charges
    single
    [Q]:18.16
  • if_expr:buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Resource Cost 2Enhancement Shaman13704112PCT-1.000
Spell Direct AmountEnhancement Shaman13704122PCT-0.090
Spell Direct AmountEnhancement Shaman13704123PCT0.100
Spell Direct AmountFire and Ice3828861PCT0.030
Flame Shock 5862 9.9% 90.3 3.32s 19445 152327 Direct 90.3 7007 14023 8520 21.6% 0.0%
Periodic 196.0 4139 8292 5037 21.6% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.35 90.35 195.97 195.97 89.35 0.1277 1.5216 1756786.66 1756786.66 0.00% 5672.40 152326.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.43% 70.86 42 105 7006.90 3928 17845 7007.73 6131 8441 496497 496497 0.00%
crit 21.57% 19.49 5 39 14023.01 7856 33494 14028.77 11292 18313 273277 273277 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 78.39% 153.61 109 201 4139.11 2271 10430 4139.69 3659 4739 635831 635831 0.00%
crit 21.61% 42.35 20 72 8291.82 4542 20995 8292.73 6862 10146 351182 351182 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Volcanic damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Volcanic damage and then an additional {$=}o2 Volcanic damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Volcanic damage and knocking them into the air.]

Action Priority List

    single
    [a]:9.75

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Spell Periodic AmountFire and Ice3828862PCT0.030
Flametongue Weapon 0 (969) 0.0% (1.6%) 1.0 0.00s 290364 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountFire and Ice3828861PCT0.030
    Flametongue Attack 969 1.6% 610.3 0.74s 476 0 Direct 610.3 391 783 476 21.6% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 610.30 610.30 0.00 0.00 0.00 0.0000 0.0000 290363.90 290363.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.37% 478.29 341 621 390.97 297 1026 391.03 346 450 186997 186997 0.00%
crit 21.63% 132.01 82 199 783.01 594 2053 783.10 683 939 103367 103367 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Forgestorm Ignited (_damage) 1256 2.1% 28.6 7.69s 13165 0 Direct 28.6 10808 21622 13165 21.8% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.63 28.63 0.00 0.00 0.00 0.0000 0.0000 376855.91 376855.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.20% 22.39 2 60 10808.32 10705 11241 10799.40 10705 11209 241958 241958 0.00%
crit 21.80% 6.24 0 24 21622.30 21411 22481 21389.32 0 22481 134898 134898 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 6485 11.0% 42.8 6.95s 45421 39798 Direct 42.8 37327 74584 45420 21.7% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.80 42.80 0.00 0.00 0.00 1.1413 0.0000 1943859.43 1943859.43 0.00% 39798.12 39798.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.28% 33.50 18 50 37326.82 7863 111122 37383.67 29011 48149 1250430 1250430 0.00%
crit 21.72% 9.30 1 22 74583.72 15726 221566 74701.93 32758 130910 693429 693429 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [V]:42.53
  • if_expr:buff.hailstorm.up
    single
    [Y]:0.27

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownEnhancement Shaman1370417ADD6000.000
Hasted Cooldown DurationEnhancement Shaman1370418SET1.000
Spell Direct AmountEnhancement Shaman13704114PCT-0.170
Spell Periodic AmountEnhancement Shaman13704115PCT-0.170
Spell Direct AmountFire and Ice3828861PCT0.030
Ice Strike 2401 4.1% 24.1 12.56s 29832 26146 Direct 24.1 24513 49016 29831 21.7% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.12 24.12 0.00 0.00 0.00 1.1410 0.0000 719498.05 719498.05 0.00% 26146.45 26146.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.30% 18.88 9 28 24513.47 18491 53016 24517.34 20725 28868 462913 462913 0.00%
crit 21.70% 5.23 0 14 49015.66 36982 106032 48780.85 0 85141 256585 256585 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [T]:24.12
  • if_expr:talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountFire and Ice3828861PCT0.030
Lava Lash 12620 21.3% 73.6 4.04s 51376 45101 Direct 73.6 (73.6) 42222 84497 51376 21.7% (21.7%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 73.62 73.62 0.00 0.00 0.00 1.1391 0.0000 3782128.32 3782128.32 0.00% 45100.50 45100.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.35% 57.68 26 93 42222.28 21811 120680 42225.96 36308 52170 2435238 2435238 0.00%
crit 21.65% 15.94 0 36 84496.53 43621 295358 84513.10 0 119440 1346890 1346890 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [M]:48.54
  • if_expr:buff.hot_hand.up
    single
    [U]:25.07
  • if_expr:talent.lashing_flames.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell CooldownMolten Assault3340331ADD-6000.000
Spell Direct AmountFire and Ice3828861PCT0.030
Lightning Bolt 6044 10.2% 28.6 10.38s 63280 53727 Direct 28.6 52070 104279 63280 21.5% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.63 28.63 0.00 0.00 0.00 1.1778 0.0000 1811881.84 1811881.84 0.00% 53726.78 53726.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.53% 22.49 11 35 52069.67 29583 127564 52128.16 43670 64885 1170830 1170830 0.00%
crit 21.47% 6.15 0 17 104279.01 59166 249171 104129.76 0 188015 641052 641052 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.91

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [P]:6.93
  • if_expr:buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [R]:12.53
  • if_expr:((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
    single
    [X]:9.17
  • if_expr:talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
main_hand 1812 3.1% 194.0 1.80s 2799 1607 Direct 194.0 2658 5318 2799 21.7% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 194.00 194.00 0.00 0.00 0.00 1.7416 0.0000 543001.83 775736.68 30.00% 1607.07 1607.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.92% 120.12 76 168 2658.44 2257 4294 2658.65 2454 2988 319337 456207 30.00%
crit 21.68% 42.06 17 72 5317.60 4513 8570 5317.84 4762 6027 223665 319530 30.00%
miss 16.40% 31.82 11 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 928 1.6% 198.2 1.76s 1404 807 Direct 198.2 1332 2668 1404 21.7% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 198.18 198.18 0.00 0.00 0.00 1.7388 0.0000 278248.22 397507.60 30.00% 807.48 807.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.98% 122.83 81 172 1332.39 1128 2151 1332.47 1219 1500 163652 233794 30.00%
crit 21.67% 42.95 19 74 2667.94 2257 4244 2668.14 2391 3034 114596 163713 30.00%
miss 16.35% 32.40 14 57 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 0 (3645) 0.0% (6.2%) 7.0 46.16s 156314 130709

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 0.00 0.00 0.00 0.00 1.1959 0.0000 0.00 0.00 0.00% 130708.87 130708.87

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:1.00
  • if_expr:!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
    single
    [S]:5.98
  • if_expr:raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
    Primordial Wave (_damage) 1005 1.7% 7.0 46.16s 43106 0 Direct 7.0 35383 71005 43107 21.7% 0.0%

Stats Details: Primordial Wave Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 0.00 0.0000 0.0000 300911.65 300911.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.32% 5.47 1 8 35382.92 28240 54637 35399.30 28240 48982 193449 193449 0.00%
crit 21.68% 1.51 0 6 71004.57 56480 108222 57878.26 0 108222 107463 107463 0.00%

Action Details: Primordial Wave Damage

  • id:375984
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:6.00

Spelldata

  • id:375984
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc375982=Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman13704121PCT5.000
    Lightning Bolt (_pw) 2640 4.5% 6.9 45.75s 114052 0 Direct 6.9 93667 187792 114051 21.7% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 0.00 0.0000 0.0000 790638.13 790638.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.34% 5.43 1 8 93667.41 59166 191346 93737.86 69027 157341 508708 508708 0.00%
crit 21.66% 1.50 0 6 187792.14 118331 378240 152674.44 0 364853 281930 281930 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.91

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountEnhancement Shaman1370415PCT-0.210
Spell Cast TimeLightning Bolt3180441ADD-500.000
Stormstrike 0 (1891) 0.0% (3.2%) 32.3 9.13s 17547 15332

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.31 0.00 0.00 0.00 0.00 1.1445 0.0000 0.00 0.00 0.00% 15331.56 15331.56

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [W]:32.31

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationShaman1370382SET1.000
Hasted Global CooldownShaman1370383SET1.000
    Stormstrike (_mh) 1260 2.1% 32.3 9.13s 11695 0 Direct 32.3 9621 19246 11695 21.5% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.31 32.31 0.00 0.00 0.00 0.0000 0.0000 377857.25 539809.84 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.46% 25.35 11 42 9621.42 8138 15312 9622.42 8502 11120 243893 348428 30.00%
crit 21.54% 6.96 0 18 19246.05 16276 30624 19231.00 0 25586 133964 191382 29.97%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
    Stormstrike Off-Hand 631 1.1% 32.3 9.13s 5852 0 Direct 32.3 4809 9632 5853 21.6% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.31 32.31 0.00 0.00 0.00 0.0000 0.0000 189088.61 270133.47 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.37% 25.32 8 42 4809.41 4069 7656 4809.94 4268 5508 121787 173985 30.00%
crit 21.63% 6.99 0 20 9632.41 8138 15312 9626.27 0 13690 67302 96148 29.99%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
Spell Direct AmountElemental Assault2108531PCT0.200
Windfury Weapon 0 (903) 0.0% (1.5%) 1.0 0.00s 270735 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 903 1.5% 120.0 5.14s 2256 0 Direct 120.0 1854 3714 2256 21.6% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.98 119.98 0.00 0.00 0.00 0.0000 0.0000 270734.83 386773.91 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.37% 94.03 41 150 1854.11 1565 3022 1854.37 1673 2130 174349 249077 30.00%
crit 21.63% 25.95 7 49 3714.08 3130 6044 3714.77 3257 4598 96386 137697 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountEnhancement Shaman1370411PCT0.155
Spell Periodic AmountEnhancement Shaman1370412PCT0.155
pet - greater_earth_elemental 501 / 107
melee 501 0.2% 44.2 2.50s 721 508 Direct 44.2 593 1186 721 21.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.20 44.20 0.00 0.00 0.00 1.4190 0.0000 31872.64 45533.50 30.00% 508.19 508.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.35% 34.63 18 66 592.63 488 905 590.33 488 762 20523 29320 30.00%
crit 21.65% 9.57 1 24 1186.02 976 1810 1181.11 976 1655 11349 16214 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2465 / 962
melee 2465 1.6% 120.4 2.68s 2390 2143 Direct 120.4 1964 3933 2390 21.7% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.45 120.45 0.00 0.00 0.00 1.1157 0.0000 287921.34 411326.68 30.00% 2142.67 2142.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.32% 94.33 7 206 1963.62 1630 3124 1961.60 1630 2488 185239 264634 30.00%
crit 21.68% 26.11 0 64 3932.55 3260 6247 3928.36 0 4906 102682 146693 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2468 / 964
melee 2468 1.6% 120.7 2.68s 2390 2142 Direct 120.7 1963 3930 2390 21.7% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.71 120.71 0.00 0.00 0.00 1.1157 0.0000 288516.03 412176.26 30.00% 2142.27 2142.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.29% 94.51 6 196 1963.11 1630 3124 1961.05 1630 2437 185530 265050 30.00%
crit 21.71% 26.20 1 61 3930.27 3260 6247 3926.14 3260 5176 102986 147127 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2458 / 956
melee 2458 1.6% 119.9 2.69s 2389 2139 Direct 119.9 1963 3932 2389 21.7% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.89 119.89 0.00 0.00 0.00 1.1171 0.0000 286439.61 409209.88 30.00% 2138.85 2138.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.35% 93.93 14 193 1962.89 1630 3124 1960.63 1630 2459 184378 263404 30.00%
crit 21.65% 25.96 2 62 3932.11 3260 6247 3927.28 3260 5224 102062 145806 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Ele
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.2 310.87s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.19 0.00 0.00 0.00 0.00 0.9264 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Z]:1.19
Feral Spirit 14.4 22.14s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.36 0.00 0.00 0.00 0.00 1.1341 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:14.36

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownShaman1370383SET1.000
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 303.35s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 3.0 116.94s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.05 0.00 0.00 0.00 0.00 0.5486 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Action Priority List

    single
    [N]:1.66
  • if_expr:!buff.windfury_totem.up
    single
    [b]:0.39
  • if_expr:buff.windfury_totem.remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 73.2 122.8 4.1s 1.5s 3.3s 80.09% 98.30% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 16.4s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.6s
  • uptime_min/max:71.05% / 87.53%

Stack Uptimes

  • ashen_catalyst_1:33.62%
  • ashen_catalyst_2:18.12%
  • ashen_catalyst_3:12.75%
  • ashen_catalyst_4:10.11%
  • ashen_catalyst_5:4.25%
  • ashen_catalyst_6:0.98%
  • ashen_catalyst_7:0.23%
  • ashen_catalyst_8:0.04%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.1s 50.2s 80.22% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 342.0s
  • trigger_min/max:15.0s / 304.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.4s
  • uptime_min/max:51.14% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.22%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Crackling Surge 8.0 0.0 37.1s 36.7s 15.0s 38.90% 43.78% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.9s / 282.9s
  • trigger_min/max:10.9s / 282.9s
  • trigger_pct:84.66%
  • duration_min/max:0.0s / 41.9s
  • uptime_min/max:6.07% / 68.12%

Stack Uptimes

  • crackling_surge_1:31.15%
  • crackling_surge_2:7.72%
  • crackling_surge_3:0.02%
  • crackling_surge_4:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases Nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4s 5.3s 17.9s 12.07% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 165.7s
  • trigger_pct:100.00%
  • duration_min/max:15.1s / 20.0s
  • uptime_min/max:9.82% / 15.15%

Stack Uptimes

  • crumbling_power_1:0.43%
  • crumbling_power_2:0.63%
  • crumbling_power_3:0.65%
  • crumbling_power_4:0.64%
  • crumbling_power_5:0.63%
  • crumbling_power_6:0.62%
  • crumbling_power_7:0.62%
  • crumbling_power_8:0.61%
  • crumbling_power_9:0.59%
  • crumbling_power_10:0.60%
  • crumbling_power_11:0.62%
  • crumbling_power_12:0.64%
  • crumbling_power_13:0.66%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.68%
  • crumbling_power_16:0.69%
  • crumbling_power_17:0.69%
  • crumbling_power_18:0.70%
  • crumbling_power_19:0.70%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Elemental Blast: Critical Strike 8.3 0.0 35.0s 35.0s 9.8s 27.28% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 242.6s
  • trigger_min/max:10.0s / 242.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:4.31% / 51.73%

Stack Uptimes

  • elemental_blast_critical_strike_1:27.28%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 8.2 0.0 35.5s 35.5s 9.8s 26.84% 0.00% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 296.2s
  • trigger_min/max:10.0s / 296.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.91% / 49.65%

Stack Uptimes

  • elemental_blast_haste_1:26.84%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 8.3 0.0 35.0s 35.0s 9.8s 27.17% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 260.8s
  • trigger_min/max:10.0s / 260.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:6.80% / 50.86%

Stack Uptimes

  • elemental_blast_mastery_1:27.17%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 301.9s 303.4s 27.5s 13.45% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 314.8s
  • trigger_min/max:300.0s / 314.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.97% / 18.13%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.45%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 13.8 0.6 22.6s 22.1s 15.3s 70.01% 0.00% 56.7 (56.7) 13.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 47.3s
  • trigger_min/max:13.8s / 36.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.9s
  • uptime_min/max:64.06% / 77.35%

Stack Uptimes

  • feral_spirit_1:70.01%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 44.5 282.1 6.8s 0.9s 5.6s 83.35% 89.81% 282.1 (618.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 78.0s
  • trigger_min/max:0.0s / 16.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 77.6s
  • uptime_min/max:71.05% / 92.78%

Stack Uptimes

  • flurry_1:21.78%
  • flurry_2:36.66%
  • flurry_3:24.91%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.8s 46.8s 12.9s 19.33% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 212.1s
  • trigger_min/max:0.2s / 212.1s
  • trigger_pct:98.95%
  • duration_min/max:0.0s / 56.1s
  • uptime_min/max:3.67% / 52.05%

Stack Uptimes

  • forgestorm_ignited_1:19.33%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 43.0 10.4 7.0s 5.6s 3.6s 51.94% 99.38% 10.3 (78.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 32.9s
  • trigger_min/max:1.0s / 16.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.4s
  • uptime_min/max:36.70% / 68.16%

Stack Uptimes

  • hailstorm_5:4.15%
  • hailstorm_6:3.80%
  • hailstorm_7:3.53%
  • hailstorm_8:10.58%
  • hailstorm_9:7.76%
  • hailstorm_10:22.11%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.7 5.7 27.4s 17.4s 9.9s 35.37% 86.50% 5.7 (5.7) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 205.1s
  • trigger_min/max:0.0s / 197.6s
  • trigger_pct:4.99%
  • duration_min/max:0.0s / 51.7s
  • uptime_min/max:8.10% / 65.67%

Stack Uptimes

  • hot_hand_1:35.37%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.1 0.0 12.6s 12.6s 3.4s 27.71% 55.47% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 30.8s
  • trigger_min/max:7.7s / 30.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.9s
  • uptime_min/max:16.26% / 43.02%

Stack Uptimes

  • ice_strike_1:27.71%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 8.0 0.0 37.2s 36.8s 15.0s 39.01% 100.00% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.6s / 273.7s
  • trigger_min/max:10.6s / 273.7s
  • trigger_pct:84.64%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:4.66% / 71.78%

Stack Uptimes

  • icy_edge_1:31.20%
  • icy_edge_2:7.78%
  • icy_edge_3:0.02%
  • icy_edge_4:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases Frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 54.3 379.0 5.6s 0.7s 4.6s 83.99% 100.00% 28.4 (41.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.3s
  • trigger_min/max:0.0s / 7.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.7s
  • uptime_min/max:79.28% / 88.42%

Stack Uptimes

  • maelstrom_weapon_1:9.71%
  • maelstrom_weapon_2:10.00%
  • maelstrom_weapon_3:10.15%
  • maelstrom_weapon_4:10.14%
  • maelstrom_weapon_5:9.05%
  • maelstrom_weapon_6:8.15%
  • maelstrom_weapon_7:7.22%
  • maelstrom_weapon_8:6.35%
  • maelstrom_weapon_9:4.16%
  • maelstrom_weapon_10:9.07%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 8.0 0.0 37.0s 36.7s 15.0s 39.02% 100.00% 0.0 (0.0) 7.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.6s / 241.6s
  • trigger_min/max:10.6s / 241.6s
  • trigger_pct:84.46%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:2.66% / 72.08%

Stack Uptimes

  • molten_weapon_1:31.13%
  • molten_weapon_2:7.87%
  • molten_weapon_3:0.02%
  • molten_weapon_4:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases Fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Wave 7.0 0.0 46.2s 46.2s 2.7s 6.29% 24.32% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 58.8s
  • trigger_min/max:45.0s / 58.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:3.18% / 15.67%

Stack Uptimes

  • primordial_wave_1:6.29%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to them. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=40}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.2 61.0s 45.5s 16.6s 23.72% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 215.7s
  • trigger_min/max:0.0s / 215.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 73.6s
  • uptime_min/max:5.14% / 58.54%

Stack Uptimes

  • sophic_devotion_1:23.72%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.7s 45.4s 32.1s 38.51% 0.00% 25.8 (25.8) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 244.5s
  • trigger_min/max:0.0s / 211.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 191.5s
  • uptime_min/max:7.35% / 90.35%

Stack Uptimes

  • spiraling_winds_1:2.37%
  • spiraling_winds_2:2.34%
  • spiraling_winds_3:2.32%
  • spiraling_winds_4:2.30%
  • spiraling_winds_5:2.29%
  • spiraling_winds_6:2.27%
  • spiraling_winds_7:2.26%
  • spiraling_winds_8:2.24%
  • spiraling_winds_9:2.23%
  • spiraling_winds_10:17.89%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 6.9 0.0 45.7s 45.7s 11.8s 27.27% 31.06% 0.0 (0.0) 6.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:32.2s / 90.7s
  • trigger_min/max:32.2s / 90.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:22.40% / 29.86%

Stack Uptimes

  • splintered_elements_1:27.27%

Spelldata

  • id:354648
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc354647=Each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave increases your Haste by {$s1=10}% for {$354648d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 16.0 5.0 18.2s 13.7s 5.6s 29.56% 44.34% 5.0 (5.0) 1.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 174.3s
  • trigger_min/max:0.0s / 174.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.7s
  • uptime_min/max:4.81% / 57.31%

Stack Uptimes

  • stormbringer_1:29.56%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury (Main Hand) 26.8 10.0 53.0 10.9s 1.1s 141.4s
Windfury (Off Hand) 27.3 10.0 50.0 10.7s 1.1s 125.4s
Elemental Blast: Critical Strike 8.3 2.0 16.0 35.0s 10.0s 242.6s
Elemental Blast: Haste 8.2 1.0 16.0 35.5s 10.0s 296.2s
Elemental Blast: Mastery 8.3 2.0 16.0 35.0s 10.0s 260.8s
Maelstrom Weapon Swing Reset 6.9 5.0 8.0 45.7s 32.2s 90.7s
Flametongue: Windfury Attack 120.0 56.0 186.0 5.1s 0.0s 66.4s
Stormbringer: Windfury Attack 8.9 0.0 23.0 31.3s 0.0s 296.0s
Flametongue: main_hand 162.2 116.0 218.0 2.2s 1.1s 19.7s
Hot Hand: main_hand 8.1 0.0 21.0 33.0s 1.1s 281.7s
Windfury: main_hand 44.4 18.0 74.0 7.0s 1.1s 99.3s
Flametongue: offhand 165.8 116.0 224.0 2.2s 1.1s 18.2s
Hot Hand: offhand 8.3 0.0 20.0 32.4s 1.1s 286.4s
Flametongue: Lava Lash 73.6 39.0 116.0 4.0s 0.8s 15.8s
Stormbringer: Lava Lash 5.5 0.0 17.0 44.4s 0.8s 312.2s
Flametongue: Ice Strike 24.1 18.0 30.0 12.6s 7.7s 30.6s
Stormbringer: Ice Strike 1.8 0.0 9.0 81.6s 7.8s 351.9s
Windfury: Ice Strike 6.7 0.0 15.0 40.3s 7.8s 298.5s
Flametongue: Stormstrike 32.3 17.0 50.0 9.1s 0.8s 70.4s
Stormbringer: Stormstrike 2.4 0.0 11.0 67.6s 0.8s 322.8s
Windfury: Stormstrike 8.9 1.0 22.0 30.5s 0.8s 248.4s
Flametongue: Stormstrike Off-Hand 32.3 17.0 50.0 9.1s 0.8s 70.4s
Stormbringer: Stormstrike Off-Hand 2.4 0.0 11.0 68.3s 0.8s 342.4s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 42.55% 33.90% 50.07% 0.7s 0.0s 5.0s
Hot Hand 35.37% 8.10% 65.67% 9.9s 0.0s 51.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike
Stormstrike		3.8830.00058.511127.73956.771214.556
Primordial Wave1.1230.00013.8387.8650.97626.412
Feral Spirit0.7760.0001.51611.1653.76817.814
Lava Lash0.5740.0008.34842.36422.61566.689
Elemental Blast0.5010.00014.15112.5051.78842.383
Ice Strike1.2110.00017.90529.3709.62066.809
Frost Shock2.4310.00029.772105.08055.061165.424
Flame Shock23.8610.000274.773253.867174.411344.663
Earth Elemental18.6990.000195.68624.6906.152245.816

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack26.62.25.86%5.33%
main_hand35.63.47.83%8.21%
offhand36.63.38.04%7.86%
Primordial Wave50.419.511.09%46.64%
Feral Spirit76.66.416.85%15.41%
Lava Lash84.46.818.58%16.23%
Ice Strike54.00.111.88%0.16%
Frost Shock42.50.09.36%0.00%
Stormstrike32.20.17.10%0.16%
Stormstrike (_mh)7.70.01.70%0.00%
Stormstrike Off-Hand7.80.01.72%0.00%
Overflow Stacks0.041.70.00%8.41%
Actual Stacks454.40.091.59%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt234.452.07%
Elemental Blast215.847.93%
Total Spent450.2100.00%
Casts per Maelstrom Weapon Stack Consumed
Ability 0 1 2 3 4 5 6 7 8 9 10
Lightning Bolt          3.11 3.02 3.03 5.64 3.90 9.93
Elemental Blast          1.10 1.00 0.85 7.19 5.55 9.08
Total           4.22
(7.90%)		 4.02
(7.53%)		 3.89
(7.28%)		 12.83
(24.02%)		 9.45
(17.69%)		 19.01
(35.59%)

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Ele
Mana RegenMana630.32157232.39100.00%249.45609776.4979.50%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 270980.0 0.00 871.91 0.0 9408.1 -406434.9 270980.0
Mana 250000.0 524.10 525.29 609777.5 249643.1 248350.0 250000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement_Ele
BloodlustMana 1.001000.000.63%1000.001000.000.00
Flame ShockMana 9.757311.734.64%750.0080.93240.27
Frost ShockMana 42.8021398.3513.58%500.00500.0090.84
Ice StrikeMana 24.1239795.9925.25%1650.001650.0118.08
Lava LashMana 73.6129445.4618.68%400.00399.98128.45
Lightning BoltMana 28.6314316.829.08%500.00500.01126.56
Primordial WaveMana 6.9810474.606.65%1500.001500.00104.21
StormstrikeMana 32.3132310.3620.50%1000.001000.0317.55
Windfury TotemMana 3.051536.000.97%503.94503.930.00

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Ele Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Ele Damage Per Second
Count 7499
Mean 59173.46
Minimum 50988.55
Maximum 69228.77
Spread ( max - min ) 18240.22
Range [ ( max - min ) / 2 * 100% ] 15.41%
Standard Deviation 2450.0788
5th Percentile 55269.37
95th Percentile 63334.82
( 95th Percentile - 5th Percentile ) 8065.45
Mean Distribution
Standard Deviation 28.2930
95.00% Confidence Interval ( 59118.00 - 59228.91 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 66
0.1% Error 6586
0.1 Scale Factor Error with Delta=300 51245
0.05 Scale Factor Error with Delta=300 204977
0.01 Scale Factor Error with Delta=300 5124409
Priority Target DPS
PR_Shaman_Enhancement_Ele Priority Target Damage Per Second
Count 7499
Mean 59173.46
Minimum 50988.55
Maximum 69228.77
Spread ( max - min ) 18240.22
Range [ ( max - min ) / 2 * 100% ] 15.41%
Standard Deviation 2450.0788
5th Percentile 55269.37
95th Percentile 63334.82
( 95th Percentile - 5th Percentile ) 8065.45
Mean Distribution
Standard Deviation 28.2930
95.00% Confidence Interval ( 59118.00 - 59228.91 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 66
0.1% Error 6586
0.1 Scale Factor Error with Delta=300 51245
0.05 Scale Factor Error with Delta=300 204977
0.01 Scale Factor Error with Delta=300 5124409
DPS(e)
PR_Shaman_Enhancement_Ele Damage Per Second (Effective)
Count 7499
Mean 59173.46
Minimum 50988.55
Maximum 69228.77
Spread ( max - min ) 18240.22
Range [ ( max - min ) / 2 * 100% ] 15.41%
Damage
PR_Shaman_Enhancement_Ele Damage
Count 7499
Mean 16840087.34
Minimum 12046808.71
Maximum 21877362.80
Spread ( max - min ) 9830554.09
Range [ ( max - min ) / 2 * 100% ] 29.19%
DTPS
PR_Shaman_Enhancement_Ele Damage Taken Per Second
Count 7499
Mean 871.42
Minimum 0.00
Maximum 2159.02
Spread ( max - min ) 2159.02
Range [ ( max - min ) / 2 * 100% ] 123.88%
HPS
PR_Shaman_Enhancement_Ele Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Ele Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Ele Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Ele Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Ele Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_EleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Ele Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
0.00 primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
G 14.36 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
0.00 doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
I 0.00 call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
J 0.00 call_action_list,name=funnel,if=active_enemies>1&rotation.funnel
actions.single
# count action,conditions
K 1.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
L 0.28 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
0.00 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
M 48.54 lava_lash,if=buff.hot_hand.up
N 1.66 windfury_totem,if=!buff.windfury_totem.up
O 6.33 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
P 6.93 lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
Q 18.16 elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
R 12.53 lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
S 5.98 primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
0.00 flame_shock,if=!ticking
T 24.12 ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
U 25.07 lava_lash,if=talent.lashing_flames.enabled
0.00 ice_strike,if=!buff.ice_strike.up
V 42.53 frost_shock,if=buff.hailstorm.up
0.00 lava_lash
0.00 ice_strike
0.00 windstrike
W 32.31 stormstrike
0.00 sundering,if=raid_event.adds.in>=action.sundering.cooldown
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
X 9.17 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 0.27 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Z 1.19 earth_elemental
a 9.75 flame_shock
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
b 0.39 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGKMOMMTMPMVMMQMVMGLMTMVMRMVWRWMTMQMVMWGRUTMMQMVMWMRSPTGUQVWZXUVTWQVWURVaWGTQUVWXaVUWQTVWSGPMVMWMQMTVRWUMRMVMTGQMNMVMQMTMRMVWUXSGPTUVWMOMVMWMQTVWRUGVWXaTUVOWaVUXEFWTVRSGOUVWaPTUVWQaMVMRMTMVGOUVWXaTVUQWVWXUSPGTVOUWVWNQMVMTMRMVWWGQUMTMQMVWRUVaTWSGPUVWXaTUOVWaXUVWTRCV

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 2 augmentation PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 3 windfury_weapon PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 4 flametongue_weapon PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 6 windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana corrupting_rage
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana corrupting_rage
0:00.000 default B bloodlust Fluffy_Pillow 250000.0/250000: 100% mana corrupting_rage
0:00.000 default C potion Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage
0:00.000 default D auto_attack Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(3), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, flurry(2), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default F berserking PR_Shaman_Enhancement_Ele 249000.0/250000: 100% mana bloodlust, flurry(2), crumbling_power(20), corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 249000.0/250000: 100% mana bloodlust, berserking, flurry(2), crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:00.896 single K primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon, crumbling_power(19), corrupting_rage, elemental_potion_of_ultimate_power
0:01.791 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), primordial_wave, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(10), crumbling_power(18), corrupting_rage, elemental_potion_of_ultimate_power
0:02.687 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), crumbling_power(17), corrupting_rage, elemental_potion_of_ultimate_power
0:03.581 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), crumbling_power(16), corrupting_rage, elemental_potion_of_ultimate_power
0:04.475 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), crumbling_power(15), corrupting_rage, elemental_potion_of_ultimate_power
0:05.370 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), crumbling_power(14), corrupting_rage, elemental_potion_of_ultimate_power
0:06.266 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(10), ice_strike, crumbling_power(13), corrupting_rage, elemental_potion_of_ultimate_power
0:07.161 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), hailstorm(10), ice_strike, crumbling_power(12), corrupting_rage, elemental_potion_of_ultimate_power
0:08.056 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, hailstorm(10), ice_strike, crumbling_power(11), corrupting_rage, elemental_potion_of_ultimate_power
0:08.810 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, crumbling_power(10), corrupting_rage, elemental_potion_of_ultimate_power
0:09.563 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), crumbling_power(9), corrupting_rage, elemental_potion_of_ultimate_power
0:10.317 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), crumbling_power(8), corrupting_rage, elemental_potion_of_ultimate_power
0:11.072 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(9), crumbling_power(7), corrupting_rage, elemental_potion_of_ultimate_power
0:11.826 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, hailstorm(9), crumbling_power(6), corrupting_rage, elemental_potion_of_ultimate_power
0:12.579 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(9), crumbling_power(5), corrupting_rage, elemental_potion_of_ultimate_power
0:13.375 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), crumbling_power(4), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:14.171 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, hot_hand, maelstrom_weapon(7), crumbling_power(3), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:14.966 single L elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(8), crumbling_power(2), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:15.763 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(2), hailstorm(8), crumbling_power, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:16.558 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(8), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:17.353 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(6), hailstorm(8), ice_strike, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:18.150 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, hot_hand, maelstrom_weapon(7), hailstorm(8), ice_strike, sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:18.946 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(8), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:19.744 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(9), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:20.698 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(9), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:21.652 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(3), hailstorm(9), sophic_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:22.754 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), sophic_devotion, elemental_potion_of_ultimate_power
0:23.738 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(10), sophic_devotion, elemental_potion_of_ultimate_power
0:24.722 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon, hailstorm(10), sophic_devotion, elemental_potion_of_ultimate_power
0:25.706 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hot_hand, maelstrom_weapon(2), hailstorm(10), sophic_devotion, elemental_potion_of_ultimate_power
0:26.691 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), sophic_devotion, elemental_potion_of_ultimate_power
0:27.674 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(10), ice_strike, elemental_potion_of_ultimate_power
0:28.658 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(10), ice_strike, elemental_potion_of_ultimate_power
0:29.642 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, elemental_potion_of_ultimate_power
0:30.625 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike
0:31.610 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4)
0:32.593 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5)
0:33.578 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(7)
0:34.562 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(8)
0:35.545 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(3), hailstorm(8)
0:36.528 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon, hailstorm(8)
0:37.511 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(8), ice_strike, corrupting_rage
0:38.493 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(8), ice_strike, corrupting_rage
0:39.477 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana bloodlust, flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(8), ice_strike, corrupting_rage
0:40.463 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, corrupting_rage
0:41.702 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, corrupting_rage
0:42.940 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), corrupting_rage
0:44.179 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), corrupting_rage
0:45.419 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(9), corrupting_rage
0:46.661 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), maelstrom_weapon(10), corrupting_rage
0:47.901 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon, hailstorm(10), corrupting_rage
0:49.139 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, primordial_wave, ashen_catalyst(2), maelstrom_weapon(10), hailstorm(10), corrupting_rage
0:50.379 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, ashen_catalyst(3), hailstorm(10), corrupting_rage
0:51.446 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, ashen_catalyst(3), maelstrom_weapon(4), hailstorm(10), ice_strike
0:52.643 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(7), hailstorm(10), ice_strike
0:53.706 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(9), hailstorm(10), ice_strike
0:54.770 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(10), ice_strike
0:55.835 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), sophic_devotion
0:56.899 single Z earth_elemental Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), sophic_devotion
0:57.964 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(5), sophic_devotion
0:59.029 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), hailstorm(5), sophic_devotion
1:00.093 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(2), hailstorm(5), sophic_devotion
1:01.157 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(4), sophic_devotion
1:02.432 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(7), ice_strike, sophic_devotion
1:03.707 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(9), ice_strike, sophic_devotion
1:04.984 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(2), hailstorm(9), ice_strike, sophic_devotion
1:06.260 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(4), sophic_devotion, corrupting_rage
1:07.538 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(5), maelstrom_weapon(7), sophic_devotion, corrupting_rage
1:08.814 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(10), sophic_devotion, corrupting_rage
1:10.091 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon, hailstorm(10), sophic_devotion, corrupting_rage
1:11.367 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(2), sophic_devotion, corrupting_rage
1:12.643 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(2), sophic_devotion, corrupting_rage
1:13.920 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(4), maelstrom_weapon(4), sophic_devotion, corrupting_rage
1:15.196 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_weapon(5), corrupting_rage
1:16.472 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_weapon(8), ice_strike, corrupting_rage
1:17.749 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(6), maelstrom_weapon, hailstorm(8), ice_strike, corrupting_rage
1:19.024 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(2), hailstorm(8), ice_strike, corrupting_rage
1:20.301 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(4), corrupting_rage
1:21.578 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(6), corrupting_rage
1:22.855 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hailstorm(6), corrupting_rage
1:24.132 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon, hailstorm(6), corrupting_rage
1:25.408 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_weapon(3), corrupting_rage
1:26.708 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, maelstrom_weapon(6), corrupting_rage
1:27.985 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(9), corrupting_rage
1:29.262 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon, hailstorm(9), corrupting_rage
1:30.502 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), hailstorm(9), ice_strike, corrupting_rage
1:31.741 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), stormbringer, maelstrom_weapon(5), corrupting_rage
1:32.980 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(7), corrupting_rage
1:34.219 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, primordial_wave, ashen_catalyst(5), maelstrom_weapon(10), corrupting_rage
1:35.459 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(6), maelstrom_weapon(10), sophic_devotion, forgestorm_ignited, corrupting_rage
1:36.699 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(6), hot_hand, maelstrom_weapon, hailstorm(10), sophic_devotion, forgestorm_ignited, corrupting_rage
1:37.732 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), sophic_devotion, forgestorm_ignited, corrupting_rage
1:38.767 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), sophic_devotion, forgestorm_ignited, corrupting_rage
1:39.832 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), sophic_devotion, forgestorm_ignited, corrupting_rage
1:40.894 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(9), sophic_devotion, forgestorm_ignited, corrupting_rage
1:41.959 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), sophic_devotion, forgestorm_ignited, corrupting_rage
1:43.023 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(2), hailstorm(10), sophic_devotion, forgestorm_ignited, corrupting_rage
1:44.087 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(5), hailstorm(10), sophic_devotion, forgestorm_ignited, corrupting_rage
1:45.151 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(7), hailstorm(10), ice_strike, sophic_devotion, forgestorm_ignited, corrupting_rage
1:46.217 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(8), sophic_devotion, forgestorm_ignited, corrupting_rage
1:47.280 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon, hailstorm(8), sophic_devotion
1:48.346 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(2), hailstorm(8), sophic_devotion
1:49.620 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, hot_hand, maelstrom_weapon(6), hailstorm(8)
1:50.896 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(8), hailstorm(8), spiraling_winds
1:52.172 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst(2), hot_hand, hailstorm(10), spiraling_winds
1:53.449 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), spiraling_winds(2)
1:54.727 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(3), spiraling_winds(3)
1:56.003 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(4), spiraling_winds(3)
1:57.419 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(2), maelstrom_weapon(7), ice_strike, spiraling_winds(4)
1:58.696 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, molten_weapon(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(5)
1:59.974 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), hot_hand, stormbringer, hailstorm(8), ice_strike, spiraling_winds(5)
2:01.214 single N windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(8), ice_strike, spiraling_winds(6)
2:02.043 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(8), ice_strike, spiraling_winds(6), corrupting_rage
2:03.435 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(8), ice_strike, spiraling_winds(7), corrupting_rage
2:04.674 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), spiraling_winds(8), corrupting_rage
2:05.915 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), spiraling_winds(8), corrupting_rage
2:07.152 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(8), spiraling_winds(9), corrupting_rage
2:08.390 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(8), spiraling_winds(10), corrupting_rage
2:09.812 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(8), ice_strike, spiraling_winds(10), corrupting_rage
2:11.088 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(8), hailstorm(8), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
2:12.365 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, hailstorm(10), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
2:13.641 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds(10), sophic_devotion, corrupting_rage
2:14.916 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(3), spiraling_winds(10), sophic_devotion, corrupting_rage
2:16.193 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(10), sophic_devotion
2:17.471 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(7), spiraling_winds(10), sophic_devotion
2:18.748 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(2), maelstrom_weapon, hailstorm(7), spiraling_winds(10), sophic_devotion
2:20.023 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana primordial_wave, ashen_catalyst(2), maelstrom_weapon(10), hailstorm(7), spiraling_winds(10), sophic_devotion
2:21.299 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(10), hailstorm(7), spiraling_winds(10), sophic_devotion
2:22.574 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon, hailstorm(10), spiraling_winds(10), sophic_devotion
2:23.637 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(4), hailstorm(10), ice_strike, spiraling_winds(10), sophic_devotion
2:24.702 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(6), hailstorm(10), ice_strike, sophic_devotion
2:25.767 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(7)
2:26.833 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(10)
2:27.897 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(10)
2:28.962 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, hailstorm(10)
2:30.026 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), hot_hand, maelstrom_weapon(2), hailstorm(10)
2:31.091 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(4), corrupting_rage
2:32.156 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(6), corrupting_rage
2:33.222 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), corrupting_rage
2:34.284 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), stormbringer, maelstrom_weapon(9), spiraling_winds, corrupting_rage
2:35.562 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(9), spiraling_winds(2), corrupting_rage
2:36.838 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), hailstorm(9), ice_strike, spiraling_winds(2), corrupting_rage
2:38.113 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), stormbringer, maelstrom_weapon(6), spiraling_winds(3), corrupting_rage
2:39.389 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(9), spiraling_winds(4), corrupting_rage
2:40.666 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(4), hailstorm(9), spiraling_winds(4), forgestorm_ignited, corrupting_rage
2:41.941 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon, hailstorm(9), spiraling_winds(5), forgestorm_ignited, corrupting_rage
2:43.218 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(9), spiraling_winds(5), forgestorm_ignited, corrupting_rage
2:44.494 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), spiraling_winds(6), forgestorm_ignited, corrupting_rage
2:45.769 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(6), spiraling_winds(7), forgestorm_ignited, corrupting_rage
2:47.045 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hailstorm(6), spiraling_winds(7), forgestorm_ignited, corrupting_rage
2:48.322 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon, hailstorm(6), spiraling_winds(8), forgestorm_ignited, corrupting_rage
2:49.598 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(3), hailstorm(6), ice_strike, spiraling_winds(9), forgestorm_ignited, corrupting_rage
2:50.876 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(4), hailstorm(6), ice_strike, spiraling_winds(9), forgestorm_ignited, corrupting_rage
2:52.151 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(6), spiraling_winds(10), corrupting_rage
2:53.426 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, hailstorm(6), spiraling_winds(10), corrupting_rage
2:54.701 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), hailstorm(6), spiraling_winds(10), corrupting_rage
2:55.979 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(3), hailstorm(6), spiraling_winds(10), corrupting_rage
2:57.256 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(5), maelstrom_weapon(5), spiraling_winds(10), corrupting_rage
2:58.557 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(6), corrupting_rage
2:59.833 default E use_item_irideus_fragment Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst, hailstorm(6), corrupting_rage
3:00.000 default F berserking PR_Shaman_Enhancement_Ele 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst(2), hailstorm(6), crumbling_power(20)
3:00.000 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, elemental_blast_mastery, ashen_catalyst(2), hailstorm(6), crumbling_power(19)
3:01.160 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana berserking, elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(4), hailstorm(6), crumbling_power(19)
3:02.321 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana berserking, ashen_catalyst(3), maelstrom_weapon(7), hailstorm(6), ice_strike, crumbling_power(18)
3:03.481 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry, ashen_catalyst(4), maelstrom_weapon(8), crumbling_power(17)
3:04.642 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana berserking, ashen_catalyst(4), maelstrom_weapon, hailstorm(8), crumbling_power(16)
3:05.805 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana berserking, primordial_wave, ashen_catalyst(5), maelstrom_weapon(10), hailstorm(8), crumbling_power(15)
3:06.966 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana berserking, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(6), maelstrom_weapon(10), hailstorm(8), crumbling_power(14)
3:08.128 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana berserking, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(7), maelstrom_weapon(2), hailstorm(10), crumbling_power(13)
3:09.290 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana berserking, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, maelstrom_weapon(4), hailstorm(10), crumbling_power(12)
3:10.451 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana berserking, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(6), crumbling_power(11)
3:11.612 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(7), crumbling_power(10)
3:12.774 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(8), crumbling_power(9)
3:14.050 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hailstorm(8), crumbling_power(8)
3:15.115 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon(4), hailstorm(8), ice_strike, crumbling_power(7), corrupting_rage
3:16.297 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(6), hailstorm(8), ice_strike, crumbling_power(6), corrupting_rage
3:17.362 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(7), crumbling_power(5), corrupting_rage
3:18.428 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(9), crumbling_power(4), corrupting_rage
3:19.492 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hailstorm(9), crumbling_power(3), corrupting_rage
3:20.559 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), hot_hand, maelstrom_weapon, hailstorm(9), corrupting_rage
3:21.623 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(9), corrupting_rage
3:22.688 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, ashen_catalyst(2), hot_hand, maelstrom_weapon(6), corrupting_rage
3:23.752 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, hot_hand, maelstrom_weapon(8), corrupting_rage
3:24.818 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, hailstorm(8), corrupting_rage
3:26.094 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(8), corrupting_rage
3:27.373 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), hailstorm(8), ice_strike, corrupting_rage
3:28.648 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, maelstrom_weapon(6), hailstorm(8), ice_strike
3:29.926 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(9)
3:31.203 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(10)
3:32.480 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), hailstorm(10), forgestorm_ignited
3:33.986 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(2), hailstorm(10), forgestorm_ignited
3:35.260 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(3), forgestorm_ignited
3:36.535 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(6), forgestorm_ignited
3:37.813 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon, hailstorm(6), forgestorm_ignited
3:39.089 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(2), hailstorm(6), forgestorm_ignited
3:40.365 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(6), hailstorm(6), ice_strike, forgestorm_ignited
3:41.641 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon(7), forgestorm_ignited
3:42.918 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(9), forgestorm_ignited
3:44.194 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst(2), hailstorm(9), forgestorm_ignited, corrupting_rage
3:45.434 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), stormbringer, maelstrom_weapon(2), hailstorm(9), forgestorm_ignited, corrupting_rage
3:46.672 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), stormbringer, maelstrom_weapon(3), forgestorm_ignited, corrupting_rage
3:47.912 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(5), forgestorm_ignited, corrupting_rage
3:49.152 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, ashen_catalyst(5), maelstrom_weapon, hailstorm(5), forgestorm_ignited, corrupting_rage
3:50.390 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, maelstrom_weapon(2), hailstorm(5), corrupting_rage
3:51.628 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, primordial_wave, ashen_catalyst, maelstrom_weapon(10), hailstorm(5), corrupting_rage
3:52.868 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, ashen_catalyst(2), hailstorm(10), corrupting_rage
3:53.903 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon, hailstorm(10), corrupting_rage
3:54.967 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(4), hailstorm(10), ice_strike, corrupting_rage
3:56.032 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon(7), corrupting_rage
3:57.098 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_weapon(2), hailstorm(7), corrupting_rage
3:58.131 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(3), hailstorm(7), corrupting_rage
3:59.166 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, maelstrom_weapon(6), hailstorm(7), corrupting_rage
4:00.199 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), corrupting_rage
4:01.233 single N windfury_totem Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(9), corrupting_rage
4:01.987 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(10), corrupting_rage
4:03.020 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), hot_hand, hailstorm(10), corrupting_rage
4:04.056 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), corrupting_rage
4:05.295 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), corrupting_rage
4:06.535 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(6), corrupting_rage
4:07.811 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(9), ice_strike, sophic_devotion, corrupting_rage
4:09.088 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, sophic_devotion, corrupting_rage
4:10.364 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, sophic_devotion, corrupting_rage
4:11.639 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(2), hailstorm(10), ice_strike, sophic_devotion, corrupting_rage
4:12.916 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(4), sophic_devotion, corrupting_rage
4:14.194 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(6), sophic_devotion, corrupting_rage
4:15.470 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(10), sophic_devotion, corrupting_rage
4:16.746 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), stormbringer, maelstrom_weapon(10), sophic_devotion, corrupting_rage
4:18.023 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), stormbringer, hailstorm(10), sophic_devotion, corrupting_rage
4:19.301 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), sophic_devotion, corrupting_rage
4:20.578 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), sophic_devotion, corrupting_rage
4:21.854 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(10), ice_strike, sophic_devotion, forgestorm_ignited, corrupting_rage
4:23.129 single Q elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(9), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
4:24.405 single M lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
4:25.682 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
4:26.959 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), sophic_devotion, forgestorm_ignited, corrupting_rage
4:28.234 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(8), sophic_devotion, forgestorm_ignited, corrupting_rage
4:29.509 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hailstorm(8), sophic_devotion, forgestorm_ignited, corrupting_rage
4:30.786 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(3), hailstorm(8), sophic_devotion, forgestorm_ignited, corrupting_rage
4:32.061 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, corrupting_rage
4:33.338 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(4), sophic_devotion, corrupting_rage
4:34.615 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(6), ice_strike, sophic_devotion, corrupting_rage
4:35.892 single S primordial_wave Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(7), ice_strike, sophic_devotion, corrupting_rage
4:37.169 default G feral_spirit Fluffy_Pillow 250000.0/250000: 100% mana flurry, primordial_wave, ashen_catalyst(5), maelstrom_weapon(10), ice_strike, sophic_devotion, corrupting_rage
4:38.446 single P lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(10), ice_strike, sophic_devotion, corrupting_rage
4:39.724 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(6), maelstrom_weapon, hailstorm(10), ice_strike, sophic_devotion, corrupting_rage
4:40.787 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(3), hailstorm(10), ice_strike, sophic_devotion, corrupting_rage
4:41.850 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(4), corrupting_rage
4:42.916 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(5), corrupting_rage
4:43.981 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon, hailstorm(5), forgestorm_ignited, corrupting_rage
4:45.046 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon, hailstorm(5), forgestorm_ignited, corrupting_rage
4:46.112 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(4), hailstorm(5), ice_strike, forgestorm_ignited, corrupting_rage
4:47.177 single O elemental_blast Fluffy_Pillow 250000.0/250000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(6), hailstorm(5), ice_strike, forgestorm_ignited, corrupting_rage
4:48.242 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hailstorm(10), ice_strike, forgestorm_ignited, corrupting_rage
4:49.307 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(2), sophic_devotion, forgestorm_ignited, corrupting_rage
4:50.371 single a flame_shock Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(3), sophic_devotion, forgestorm_ignited, corrupting_rage
4:51.434 Waiting     0.913s 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(3), sophic_devotion, forgestorm_ignited, corrupting_rage
4:52.347 single X lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana elemental_blast_mastery, ashen_catalyst(4), maelstrom_weapon(5), spiraling_winds, sophic_devotion, forgestorm_ignited, corrupting_rage
4:53.622 single U lava_lash Fluffy_Pillow 250000.0/250000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(5), hailstorm(5), spiraling_winds, sophic_devotion, forgestorm_ignited, corrupting_rage
4:54.898 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(2), hailstorm(5), spiraling_winds(2), sophic_devotion, forgestorm_ignited, corrupting_rage
4:56.175 single W stormstrike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(3), spiraling_winds(2), sophic_devotion, forgestorm_ignited, corrupting_rage
4:57.450 single T ice_strike Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(3), sophic_devotion, forgestorm_ignited, corrupting_rage
4:58.726 single R lightning_bolt Fluffy_Pillow 250000.0/250000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(8), ice_strike, spiraling_winds(4), sophic_devotion, forgestorm_ignited, corrupting_rage
5:00.001 default C potion Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(4), hailstorm(8), ice_strike, spiraling_winds(4), sophic_devotion, forgestorm_ignited, corrupting_rage
5:00.001 single V frost_shock Fluffy_Pillow 250000.0/250000: 100% mana ashen_catalyst(4), hailstorm(8), ice_strike, spiraling_winds(4), sophic_devotion, forgestorm_ignited, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 250000 250000 0
Spell Power 6635 6149 0
Crit 22.03% 15.82% 1047
Haste 17.84% 17.84% 3032
Versatility 3.93% 0.93% 191
Mana Regen 2560 2560 0
Attack Power 5440 5012 0
Mastery 58.69% 58.69% 3842
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +519 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Talents

RowShaman Talents [16]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="PR_Shaman_Enhancement_Ele"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkESSSDlEAAAAAAAAAAAAAKRIJkQKiCJNAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1&(active_enemies=1&ti_lightning_bolt)|(active_enemies>1&ti_chain_lightning)
actions+=/primordial_wave,if=set_bonus.tier31_2pc&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=action.ascendance.cooldown%2)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=action.doom_winds.cooldown|active_enemies>1
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1&(rotation.standard|rotation.simple)
actions+=/call_action_list,name=funnel,if=active_enemies>1&rotation.funnel

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|feral_spirit.active>=2)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.funnel=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.funnel+=/lava_lash,if=(talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6)|(talent.ashen_catalyst.enabled&buff.ashen_catalyst.stack=buff.ashen_catalyst.max_stack)
actions.funnel+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/windstrike,if=(talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>1)|buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/stormstrike,if=buff.converging_storms.stack=buff.converging_storms.max_stack
actions.funnel+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&buff.crackling_thunder.up
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.funnel+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)|(talent.converging_storms.enabled&buff.converging_storms.stack<buff.converging_storms.max_stack)
actions.funnel+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.funnel+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.funnel+=/ice_strike,if=talent.hailstorm.enabled&!buff.ice_strike.up
actions.funnel+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.funnel+=/sundering
actions.funnel+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.funnel+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=3
actions.funnel+=/stormstrike,if=buff.crash_lightning.up&talent.deeply_rooted_elements.enabled
actions.funnel+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.funnel+=/windstrike
actions.funnel+=/stormstrike
actions.funnel+=/ice_strike
actions.funnel+=/lava_lash
actions.funnel+=/crash_lightning
actions.funnel+=/fire_nova,if=active_dot.flame_shock>=2
actions.funnel+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lava_burst,if=(buff.molten_weapon.stack+buff.volcanic_strength.up>buff.crackling_surge.stack)&buff.maelstrom_weapon.stack>=5
actions.funnel+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5
actions.funnel+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.funnel+=/flame_shock,if=!ticking
actions.funnel+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=action.sundering.cooldown
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=8&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=8&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=8&(feral_spirit.active>=2|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack>=8)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/crash_lightning,if=talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0
actions.single+=/primordial_wave,if=raid_event.adds.in>(action.primordial_wave.cooldown%(1+set_bonus.tier31_4pc))|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/ice_strike,if=talent.elemental_assault.enabled&talent.swirling_maelstrom.enabled
actions.single+=/lava_lash,if=talent.lashing_flames.enabled
actions.single+=/ice_strike,if=!buff.ice_strike.up
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/ice_strike
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=action.sundering.cooldown
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up&talent.elemental_spirits.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1047
# gear_haste_rating=3032
# gear_mastery_rating=3842
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:
Total Events Processed: 234921694
Max Event Queue: 287
Sim Seconds: 2250297
CPU Seconds: 219.8752
Physical Seconds: 110.2730
Speed Up: 10234

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.98sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 176065 587 7.60 3511 7048 38.0 38.0 31.7% 0.0% 0.0% 0.0% 6.76sec 176065 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost antimagic_shell 48707 50823 169 0.63 16014 0 6.8 3.2 0.0% 0.0% 0.0% 0.0% 42.81sec 50823 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 146.59sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 801036 2670 38.30 3617 7248 191.5 191.5 31.8% 16.3% 0.0% 0.0% 1.83sec 1144367 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 390211 1301 37.43 1809 3623 187.1 187.1 31.8% 16.7% 0.0% 0.0% 1.83sec 557459 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost blood_draw 374606 29343 98 0.40 11133 22312 2.0 2.0 31.6% 0.0% 0.0% 0.0% 179.84sec 29343 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.65sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_damage 155166 3048836 10163 26.34 17575 35106 131.7 131.7 31.8% 0.0% 0.0% 0.0% 2.03sec 3048836 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 220537 735 0.56 60255 120967 3.0 2.8 31.4% 0.0% 0.0% 0.0% 119.72sec 220537 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay ticks -43265 4301 14 0.00 405 809 0.7 0.0 31.9% 0.0% 0.0% 0.0% 77.06sec 4301 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 308868 1030 1.39 33771 67528 6.9 6.9 31.8% 0.0% 0.0% 0.0% 29.34sec 441252 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 83.39sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 382156 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 759019 2530 19.74 5842 11661 60.3 98.7 31.8% 0.0% 0.0% 0.0% 4.95sec 759019 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 222026 748940 2496 8.87 12824 25579 44.3 44.3 31.9% 0.0% 0.0% 0.0% 4.90sec 748940 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 374295 1248 8.87 6413 12787 44.3 44.3 31.8% 0.0% 0.0% 0.0% 4.90sec 374295 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 78.35sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 2015655 6719 12.06 25358 50654 60.3 60.3 31.9% 0.0% 0.0% 0.0% 4.95sec 2015655 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 398451 1328 12.06 5014 10027 60.3 60.3 31.8% 0.0% 0.0% 0.0% 4.95sec 398451 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 411610 1372 9.61 6504 13046 48.1 48.1 31.5% 0.0% 0.0% 0.0% 6.11sec 588029 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 206081 687 9.61 3252 6523 48.1 48.1 31.7% 0.0% 0.0% 0.0% 6.11sec 294408 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1848942 6163 11.52 0 32095 57.6 57.6 100.0% 0.0% 0.0% 0.0% 5.15sec 1848942 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 924471 3082 11.52 0 16048 57.6 57.6 100.0% 0.0% 0.0% 0.0% 5.15sec 924471 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost overwhelming_rage ticks -374037 264311 881 3.94 13431 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.17sec 325454 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 35.72sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 305.17sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.57sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul auto_attack 0 268008 1650 35.01 2143 4294 94.8 94.8 31.9% 0.0% 0.0% 0.0% 2.91sec 382879 162.41sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 130763 805 19.23 1904 3812 52.1 52.1 31.9% 0.0% 0.0% 0.0% 5.38sec 186809 162.41sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 245 2 1.07 64 128 2.9 2.9 32.0% 0.0% 0.0% 0.0% 121.58sec 349 162.41sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 20.39sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1709699 5699 47.72 5440 10874 238.6 238.6 31.8% 0.0% 0.0% 0.0% 1.26sec 1709699 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 61706 206 4.03 2323 4646 20.2 20.2 31.8% 0.0% 0.0% 0.0% 14.42sec 88153 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 61660 206 4.03 2323 4645 20.1 20.1 31.8% 0.0% 0.0% 0.0% 14.49sec 88088 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.2 0.0 0.0% 0.0% 0.0% 0.0% 14.44sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy algethar_puzzle_box_channel 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy antimagic_shell 48707 49183 164 0.62 15824 0 6.9 3.1 0.0% 0.0% 0.0% 0.0% 45.84sec 49183 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 70392 235 1.37 8523 17051 6.8 6.8 20.6% 0.0% 0.0% 0.0% 46.10sec 70392 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 1201012 9041 117.15 3849 7693 259.4 259.4 20.3% 0.0% 0.0% 0.0% 4.32sec 1715776 132.84sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 287380 2163 86.05 1254 2505 190.5 190.5 20.4% 0.0% 0.0% 0.0% 5.96sec 410553 132.84sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_magus frostbolt 317792 188275 1417 9.00 7847 15707 19.9 19.9 20.4% 0.0% 0.0% 0.0% 14.86sec 188275 132.84sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_magus shadow_bolt 317791 597520 4498 28.42 7896 15783 62.9 62.9 20.3% 0.0% 0.0% 0.0% 4.52sec 597520 132.84sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1111052 18160 331.96 2727 5446 338.5 338.5 20.4% 0.0% 0.0% 0.0% 0.75sec 1587258 61.18sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 214185 3501 202.75 861 1715 206.7 206.7 20.5% 0.0% 0.0% 0.0% 1.36sec 305986 61.18sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_magus frostbolt 317792 81868 1364 8.00 8521 16917 8.0 8.0 20.4% 0.0% 0.0% 0.0% 31.19sec 81868 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_magus shadow_bolt 317791 375726 6262 35.85 8711 17389 35.8 35.8 20.4% 0.0% 0.0% 0.0% 6.34sec 375726 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 811595 2705 29.42 4588 9176 147.1 147.1 20.3% 0.0% 0.0% 0.0% 2.46sec 1159451 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.77sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy blood_draw 374606 27529 92 0.40 11347 22599 2.0 2.0 21.5% 0.0% 0.0% 0.0% 0.00sec 27529 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy clawing_shadows 207311 2257100 7524 14.15 26520 53000 70.8 70.8 20.3% 0.0% 0.0% 0.0% 4.12sec 2257100 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 45.92sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation_damage 344955 60976 203 1.39 7266 14488 0.0 7.0 20.6% 0.0% 0.0% 0.0% 0.00sec 60976 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_and_decay ticks -43265 78961 263 0.00 705 1412 8.5 0.0 20.4% 0.0% 0.0% 0.0% 36.20sec 78961 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 2114291 7048 19.26 18235 36497 96.3 96.3 20.4% 0.0% 0.0% 0.0% 3.08sec 2114291 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 622931 2076 27.43 4542 0 0.0 137.1 0.0% 0.0% 0.0% 0.0% 0.00sec 622931 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 278797 929 1.37 33983 67977 6.8 6.8 20.2% 0.0% 0.0% 0.0% 46.67sec 398291 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 167.60sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 449853 1500 4.54 16478 32919 22.7 22.7 20.4% 0.0% 0.0% 0.0% 13.23sec 642664 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 723535 2412 19.63 6125 12269 98.1 98.1 20.3% 0.0% 0.0% 0.0% 3.79sec 723535 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 382154 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 25133 84 2.32 1796 3586 11.6 11.6 20.5% 0.0% 0.0% 0.0% 27.02sec 25133 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak_aoe 196780 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 27.02sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy overwhelming_rage ticks -374037 264271 881 3.96 13341 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 59.07sec 324807 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 304.64sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul auto_attack 0 1584003 5280 37.21 7078 14139 186.1 186.1 20.3% 0.0% 0.0% 0.0% 1.61sec 2262919 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 578127 1927 12.65 7599 15172 63.3 63.3 20.3% 0.0% 0.0% 0.0% 4.63sec 578127 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 123457 412 7.81 2629 5255 39.1 39.1 20.3% 0.0% 0.0% 0.0% 7.81sec 176372 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 407 1 0.75 90 181 3.7 3.7 20.7% 0.0% 0.0% 0.0% 90.13sec 582 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 212279 708 3.10 11385 22776 15.5 15.5 20.2% 0.0% 0.0% 0.0% 6.90sec 212279 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 986708 3289 3.10 52879 105520 15.5 15.5 20.4% 0.0% 0.0% 0.0% 6.90sec 986708 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.83sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 869102 17382 32.76 26486 52693 27.3 27.3 20.4% 0.0% 0.0% 0.0% 7.78sec 869102 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 112634 375 0.73 25601 51325 3.7 3.7 20.3% 0.0% 0.0% 0.0% 91.24sec 112634 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 20.7 0.0 0.0% 0.0% 0.0% 0.0% 14.12sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 367032 1223 19.90 3063 6126 11.6 99.5 20.4% 0.0% 0.0% 0.0% 27.02sec 367032 300.00sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 540042 1800 4.19 22761 45645 20.9 20.9 13.3% 0.0% 0.0% 0.0% 14.29sec 1195829 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 655787 2186 12.99 8907 17827 20.9 64.9 13.4% 0.0% 0.0% 0.0% 14.29sec 1195829 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 85.9 0.0 0.0% 0.0% 0.0% 0.0% 3.41sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 733792 2446 7.16 18096 36261 35.8 35.8 13.3% 0.0% 0.0% 0.0% 8.45sec 733792 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 2000966 6670 35.33 9994 20027 176.6 176.6 13.3% 0.0% 0.0% 0.0% 1.69sec 2000966 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 17986 60 6.60 545 0 33.0 33.0 0.0% 0.0% 0.0% 0.0% 6.42sec 17986 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 255903 853 1.24 36300 72994 6.2 6.2 13.8% 0.0% 0.0% 0.0% 10.34sec 255903 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage 32409 129221 431 1.22 21198 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 10.34sec 133280 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowfiend 34433 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 311242 1037 15.90 3915 0 7.0 79.5 0.0% 0.0% 0.0% 0.0% 38.40sec 311242 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 603047 2010 25.57 4161 8339 13.5 127.8 13.3% 0.0% 0.0% 0.0% 21.04sec 603047 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 127.8 0.0 0.0% 0.0% 0.0% 0.0% 2.33sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_shadowfiend melee 0 146728 4192 56.57 3935 7867 33.0 33.0 13.0% 0.0% 0.0% 0.0% 6.42sec 146728 35.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement doom_winds 384352 30085 100 0.75 6661 13341 3.7 3.7 20.9% 0.0% 0.0% 0.0% 90.42sec 42980 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 308.67sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 15.5 0.0 0.0% 0.0% 0.0% 0.0% 20.45sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 98068 327 5.91 2749 5503 29.5 29.5 20.7% 0.0% 0.0% 0.0% 10.02sec 459148 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 361080 1204 36.84 1626 3252 29.5 184.2 20.6% 0.0% 0.0% 0.0% 10.02sec 459148 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 410594 1369 198.55 343 686 992.8 992.8 20.7% 0.0% 0.0% 0.0% 0.68sec 410594 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 371990 1240 5.71 10809 21620 28.5 28.5 20.6% 0.0% 0.0% 0.0% 7.72sec 371990 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 290555 969 2.85 16919 33941 14.2 14.2 20.6% 0.0% 0.0% 0.0% 19.46sec 290555 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 564034 1880 4.31 21699 43397 21.5 21.5 20.7% 0.0% 0.0% 0.0% 13.80sec 564034 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 528002 1760 4.01 21881 43790 20.0 20.0 20.5% 0.0% 0.0% 0.0% 14.70sec 528002 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 4127310 13758 13.60 50277 100597 68.0 68.0 20.7% 0.0% 0.0% 0.0% 4.38sec 4127310 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 1 536465 1788 38.68 2661 5326 193.4 193.4 20.6% 16.4% 0.0% 0.0% 1.81sec 766398 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 2 268618 895 38.69 1332 2665 193.4 193.4 20.6% 16.4% 0.0% 0.0% 1.80sec 383749 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement overwhelming_rage ticks -374037 261012 870 3.93 13283 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.31sec 266246 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 301.88sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 90.9 0.0 0.0% 0.0% 0.0% 0.0% 3.29sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 1580963 5270 24.22 10812 21663 121.1 121.1 20.6% 0.0% 0.0% 0.0% 2.46sec 2258576 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_mh 390287 364002 1213 10.54 6906 0 52.7 52.7 0.0% 0.0% 0.0% 0.0% 5.61sec 364002 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 790535 2635 24.22 5406 10828 121.1 121.1 20.7% 0.0% 0.0% 0.0% 2.46sec 1129364 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_offhand 390287 182023 607 10.54 3454 0 52.7 52.7 0.0% 0.0% 0.0% 0.0% 5.61sec 182023 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 291673 972 1.20 40280 80320 6.0 6.0 20.6% 0.0% 0.0% 0.0% 50.67sec 291673 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement tempest_strikes 428078 1134187 3781 32.53 5779 11564 162.7 162.7 20.6% 0.0% 0.0% 0.0% 1.83sec 1134187 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_totem 8512 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 114.03sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 2066677 6889 75.15 4554 9127 375.7 375.7 20.7% 0.0% 0.0% 0.0% 2.49sec 2952471 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 26538 432 37.99 565 1130 38.9 38.9 20.7% 0.0% 0.0% 0.0% 2.21sec 37913 61.46sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_spirit_wolf melee 0 906636 7996 202.70 1961 3927 383.0 383.0 20.6% 0.0% 0.0% 0.0% 1.56sec 1295228 113.38sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 310.87sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele elemental_blast 117014 3408233 11361 4.95 113424 227093 24.8 24.8 21.3% 0.0% 0.0% 0.0% 12.22sec 3408233 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele feral_spirit 51533 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 22.14sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock 188389 769774 2566 18.07 7007 14023 90.3 90.3 21.6% 0.0% 0.0% 0.0% 3.32sec 1756787 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock ticks -188389 987012 3290 39.19 4139 8292 90.3 196.0 21.6% 0.0% 0.0% 0.0% 3.32sec 1756787 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_attack 10444 290364 968 122.06 391 783 610.3 610.3 21.6% 0.0% 0.0% 0.0% 0.74sec 290364 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele forgestorm_ignited_damage 381700 376856 1256 5.73 10808 21622 28.6 28.6 21.8% 0.0% 0.0% 0.0% 7.69sec 376856 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele frost_shock 196840 1943859 6480 8.56 37327 74584 42.8 42.8 21.7% 0.0% 0.0% 0.0% 6.95sec 1943859 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele ice_strike 342240 719498 2398 4.82 24513 49016 24.1 24.1 21.7% 0.0% 0.0% 0.0% 12.56sec 719498 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lava_lash 60103 3782128 12607 14.72 42222 84497 73.6 73.6 21.7% 0.0% 0.0% 0.0% 4.04sec 3782128 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt 188196 1811882 6040 5.73 52070 104279 28.6 28.6 21.5% 0.0% 0.0% 0.0% 10.38sec 1811882 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele main_hand 1 543002 1810 38.80 2658 5318 194.0 194.0 21.7% 16.4% 0.0% 0.0% 1.80sec 775737 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele offhand 2 278248 927 39.64 1332 2668 198.2 198.2 21.7% 16.3% 0.0% 0.0% 1.76sec 397508 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele overwhelming_rage ticks -374037 261572 872 3.94 13283 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 58.91sec 266817 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 303.35sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave 375982 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 46.16sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave_damage 375984 300912 1003 1.40 35383 71005 7.0 7.0 21.7% 0.0% 0.0% 0.0% 46.16sec 300912 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt_pw 188196 790638 2635 1.39 93667 187792 6.9 6.9 21.7% 0.0% 0.0% 0.0% 45.75sec 790638 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike 17364 0 0 0.00 0 0 32.3 0.0 0.0% 0.0% 0.0% 0.0% 9.13sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_mh 32175 377857 1260 6.46 9621 19246 32.3 32.3 21.5% 0.0% 0.0% 0.0% 9.13sec 539810 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_offhand 32176 189089 630 6.46 4809 9632 32.3 32.3 21.6% 0.0% 0.0% 0.0% 9.13sec 270133 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_totem 8512 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 116.94sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_attack 25504 270735 902 24.00 1854 3714 120.0 120.0 21.6% 0.0% 0.0% 0.0% 5.14sec 386774 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_greater_earth_elemental melee 0 31873 501 41.71 593 1186 44.2 44.2 21.6% 0.0% 0.0% 0.0% 2.50sec 45533 63.59sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_frost_wolf melee 0 287921 7436 186.65 1964 3933 120.4 120.4 21.7% 0.0% 0.0% 0.0% 2.68sec 411327 38.72sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_fiery_wolf melee 0 288516 7656 192.19 1963 3930 120.7 120.7 21.7% 0.0% 0.0% 0.0% 2.68sec 412176 37.68sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_lightning_wolf melee 0 286440 7101 178.32 1963 3932 119.9 119.9 21.7% 0.0% 0.0% 0.0% 2.69sec 409210 40.34sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
227652.6 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.6 2.2 22.3s 18.8s 5.5s 23.00% 0.00% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 216.0s
  • trigger_min/max:0.6s / 216.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s
  • uptime_min/max:5.98% / 44.51%

Stack Uptimes

  • brittle_1:23.00%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.3s 18.8s 5.5s 23.20% 0.00% 2.2 (2.2) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 234.0s
  • trigger_min/max:3.0s / 234.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:5.50% / 45.74%

Stack Uptimes

  • brittle_1:23.20%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 114.9 155.1s 2.6s 293.1s 98.53% 0.00% 105.8 (105.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.4s / 280.7s
  • trigger_min/max:0.0s / 14.6s
  • trigger_pct:100.00%
  • duration_min/max:32.6s / 355.6s
  • uptime_min/max:96.69% / 98.80%

Stack Uptimes

  • death_rot_1:0.28%
  • death_rot_2:0.29%
  • death_rot_3:0.75%
  • death_rot_4:0.80%
  • death_rot_5:0.68%
  • death_rot_6:0.60%
  • death_rot_7:0.57%
  • death_rot_8:0.57%
  • death_rot_9:0.53%
  • death_rot_10:93.46%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% from you for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 6.5 232.1 49.4s 1.3s 45.6s 98.27% 0.00% 175.1 (175.1) 5.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 227.4s
  • trigger_min/max:0.0s / 16.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 226.7s
  • uptime_min/max:94.14% / 99.94%

Stack Uptimes

  • everfrost_1:2.15%
  • everfrost_2:2.14%
  • everfrost_3:2.14%
  • everfrost_4:2.13%
  • everfrost_5:2.12%
  • everfrost_6:2.11%
  • everfrost_7:2.10%
  • everfrost_8:2.09%
  • everfrost_9:2.09%
  • everfrost_10:79.21%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 23.5 33.5 12.7s 5.3s 10.3s 81.14% 0.00% 1.8 (2.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 112.3s
  • trigger_min/max:0.0s / 30.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 111.0s
  • uptime_min/max:66.75% / 92.34%

Stack Uptimes

  • festering_wound_1:23.58%
  • festering_wound_2:26.20%
  • festering_wound_3:18.04%
  • festering_wound_4:7.44%
  • festering_wound_5:3.28%
  • festering_wound_6:2.60%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 72.6 2.7s 4.0s 296.7s 98.90% 99.06% 72.6 (72.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 3.6s
  • trigger_min/max:0.8s / 15.8s
  • trigger_pct:100.00%
  • duration_min/max:236.5s / 358.0s
  • uptime_min/max:98.19% / 99.50%

Stack Uptimes

  • lashing_flames_1:98.90%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.1 59.2 181.1s 4.9s 279.0s 99.11% 0.00% 55.0 (55.0) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 347.5s
  • trigger_min/max:0.9s / 51.8s
  • trigger_pct:100.00%
  • duration_min/max:2.0s / 357.9s
  • uptime_min/max:91.32% / 99.42%

Stack Uptimes

  • razorice_1:1.09%
  • razorice_2:0.87%
  • razorice_3:0.79%
  • razorice_4:0.93%
  • razorice_5:95.43%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Rotten Touch 11.8 7.7 25.2s 15.0s 13.6s 53.46% 0.00% 7.7 (7.7) 11.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rotten_touch
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.3s / 91.2s
  • trigger_min/max:0.8s / 56.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.0s
  • uptime_min/max:31.34% / 79.57%

Stack Uptimes

  • rotten_touch_1:53.46%

Spelldata

  • id:390276
  • name:Rotten Touch
  • tooltip:Scourge Strike damage taken from {$@=}auracaster is increased by {$s1=50}%.
  • description:{$@spelldesc390275=Sudden Doom causes your next Death Coil to also increase your {$?s207311=true}[Clawing Shadows][Scourge Strike] damage against the target by {$390276s1=50}% for {$390276d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 231167.58
Minimum 214316.21
Maximum 250647.95
Spread ( max - min ) 36331.74
Range [ ( max - min ) / 2 * 100% ] 7.86%
Standard Deviation 5214.8049
5th Percentile 222870.03
95th Percentile 239964.87
( 95th Percentile - 5th Percentile ) 17094.85
Mean Distribution
Standard Deviation 60.2194
95.00% Confidence Interval ( 231049.55 - 231285.61 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1955
0.1 Scale Factor Error with Delta=300 232146
0.05 Scale Factor Error with Delta=300 928581
0.01 Scale Factor Error with Delta=300 23214525
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3759
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 81727447 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.