SimulationCraft 1010-01

for World of Warcraft 10.1.0.49741 Live (hotfix 2023-05-24/49741, git build 59bb014213)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2022-11-14 Ebonbolt is slower than spell data suggests.
Ebonbolt prj_speed 20.00 30.00
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 48010 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
48010.4 48010.4 51.4 / 0.107% 8795.5 / 18.3% 3805.5
APS APS Error APS Range APR
164.8 3.8 / 2.299% 430.9 / 261.5% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.6 Runic Power 2.59% 53.8 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 48010
Abomination Limb 0 (535) 0.0% (1.1%) 3.0 120.51s 53133 42814

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.00 1.2411 0.0000 0.00 0.00 0.00% 42813.65 42813.65

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [e]:0.10
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<12
    cooldowns
    [f]:2.89
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
    Abomination Limb (_damage) 535 1.1% 38.2 6.91s 4157 0 Direct 38.2 3157 6332 4157 31.5% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.25 38.25 0.00 0.00 0.00 0.0000 0.0000 159009.90 159009.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.48% 26.19 12 36 3156.60 2279 5190 3157.33 2604 3784 82679 82679 0.00%
crit 31.52% 12.05 2 23 6331.98 4559 10506 6334.30 5043 8967 76331 76331 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 2644 5.5% 191.4 1.83s 4143 2280 Direct 191.4 3598 7200 4143 31.4% 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 191.37 191.37 0.00 0.00 0.00 1.8168 0.0000 792829.06 1132641.83 30.00% 2280.41 2280.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.23% 99.96 54 145 3597.91 2435 6655 3597.70 3335 3880 359638 513781 30.00%
crit 31.44% 60.16 32 97 7200.10 4870 13201 7197.03 6532 8066 433191 618861 30.00%
miss 16.33% 31.24 12 57 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1289 2.7% 187.2 1.83s 2065 1137 Direct 187.2 1799 3599 2065 31.5% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 187.16 187.16 0.00 0.00 0.00 1.8166 0.0000 386571.74 552259.43 30.00% 1137.00 1137.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.85% 97.04 59 139 1798.83 1217 3300 1798.69 1670 1951 174559 249376 30.00%
crit 31.47% 58.91 29 89 3599.11 2435 6655 3597.82 3249 3979 212013 302883 30.00%
miss 16.68% 31.21 12 53 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 98 0.2% 2.0 179.75s 14496 0 Direct 2.0 11061 22151 14495 31.0% 0.0%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 28994.36 28994.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.02% 1.38 0 3 11061.00 9631 19540 9972.67 0 17766 15271 15271 0.00%
crit 30.98% 0.62 0 2 22150.97 19263 38532 11557.47 0 35532 13724 13724 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}
Breath of Sindragosa 0 (10070) 0.0% (20.9%) 2.9 120.51s 1021768 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [i]:2.95
  • if_expr:!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
    Breath of Sindragosa (_tick) 10070 20.9% 133.1 2.01s 22609 0 Direct 133.1 17227 34331 22609 31.5% 0.0%

Stats Details: Breath Of Sindragosa Tick

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 133.14 133.14 0.00 0.00 0.00 0.0000 0.0000 3010257.81 3010257.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.53% 91.25 39 143 17226.67 8853 33567 17242.69 15439 19719 1571848 1571848 0.00%
crit 31.47% 41.90 15 75 34330.67 17706 65064 34357.87 29819 39816 1438410 1438410 0.00%

Action Details: Breath Of Sindragosa Tick

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}
Burnout Wave 683 1.4% 2.8 119.21s 72693 0 Direct 2.7 58983 118252 77258 30.8% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.83 2.67 0.00 0.00 0.00 0.0000 0.0000 205883.19 205883.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.17% 1.84 0 3 58982.68 22015 66044 56053.02 0 66044 108736 108736 0.00%
crit 30.83% 0.82 0 3 118251.77 44029 132088 73005.80 0 132088 97147 97147 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 12 0.0% 0.6 80.36s 5923 4549 Direct 6.4 417 835 547 31.1% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.60 6.45 0.00 0.00 0.00 1.3029 0.0000 3525.57 3525.57 0.00% 4549.12 4549.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.90% 4.44 0 44 416.69 304 742 184.74 0 633 1851 1851 0.00%
crit 31.10% 2.01 0 16 834.90 608 1484 364.52 0 1448 1674 1674 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    breath
    [W]:0.60
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
Dragon Games Equipment 1097 2.3% 7.5 48.06s 43367 0 Direct 7.5 33171 66341 43395 30.8% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.49 7.48 0.00 0.00 0.00 0.0000 0.0000 324802.15 464014.91 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.17% 5.18 0 9 33170.70 33171 33171 33166.28 0 33171 171737 245344 30.00%
crit 30.83% 2.31 0 8 66341.40 66341 66341 61254.55 0 66341 153066 218671 27.70%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 2505 5.2% 60.4 4.94s 12442 0 Periodic 98.7 5802 11565 7616 31.5% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.41 0.00 98.69 98.69 59.40 0.0000 2.9998 751653.66 751653.66 0.00% 2538.88 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.52% 67.63 42 98 5801.80 27 11910 5800.83 5276 6353 392363 392363 0.00%
crit 31.48% 31.07 13 52 11565.41 51 23468 11562.27 10146 13364 359291 359291 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.28
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 2434 (3652) 5.1% (7.7%) 43.4 5.02s 25377 18929 Direct 43.4 (86.7) 12903 25687 16916 31.4% (31.4%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.37 43.37 0.00 0.00 0.00 1.3407 0.0000 733633.99 733633.99 0.00% 18928.64 18928.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.61% 29.75 9 55 12902.75 7881 27244 12880.48 11009 14813 383902 383902 0.00%
crit 31.39% 13.62 2 34 25687.14 15763 52540 25617.53 19923 32527 349732 349732 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    high_prio_actions
    [l]:2.75
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [n]:28.88
  • if_expr:buff.killing_machine.stack<2&runic_power.deficit<20&!variable.2h_check
    single_target
    [q]:4.15
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [u]:7.59
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 1218 2.6% 43.4 5.02s 8461 0 Direct 43.4 6445 12873 8461 31.4% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.37 43.37 0.00 0.00 0.00 0.0000 0.0000 366933.98 366933.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.64% 29.77 11 54 6444.53 3941 13622 6433.71 5440 7287 191834 191834 0.00%
crit 31.36% 13.60 1 31 12873.48 7881 26920 12838.66 10541 16021 175100 175100 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Howling Blast 6590 (7893) 13.7% (16.4%) 60.4 4.94s 39108 32241 Direct 60.4 (120.8) 24879 49598 32649 31.4% (31.4%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.41 60.41 0.00 0.00 0.00 1.2130 0.0000 1972438.89 1972438.89 0.00% 32241.41 32241.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.57% 41.42 21 62 24878.81 4355 52062 24876.79 22115 28167 1030540 1030540 0.00%
crit 31.43% 18.99 3 34 49597.78 11371 98262 49580.52 41103 59190 941898 941898 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [S]:37.32
  • if_expr:variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
    breath
    [X]:0.21
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
    breath
    [Z]:0.55
  • if_expr:buff.rime.react
    single_target
    [p]:22.33
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 1303 2.7% 60.4 4.94s 6459 0 Direct 60.4 4919 9812 6459 31.5% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.41 60.41 0.00 0.00 0.00 0.0000 0.0000 390179.29 390179.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.54% 41.40 22 63 4919.30 2620 10356 4918.70 4377 5550 203683 203683 0.00%
crit 31.46% 19.01 5 35 9812.03 5241 19540 9809.58 7876 12285 186497 186497 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Obliterate 1286 (10297) 2.7% (21.5%) 49.1 5.98s 62852 23742 Direct 49.1 (212.2) 5975 11961 7841 31.2% (68.1%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.11 49.11 0.00 0.00 0.00 2.6473 0.0000 385108.63 550169.21 30.00% 23742.17 23742.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.82% 33.80 15 61 5974.70 3841 11038 5979.80 5256 6958 201962 288524 30.00%
crit 31.18% 15.31 3 30 11961.29 7682 21414 11958.88 10040 14549 183147 261645 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    breath
    [U]:23.55
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [V]:30.85
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Y]:6.55
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [o]:27.10
  • if_expr:!set_bonus.tier30_4pc&buff.killing_machine.react
    single_target
    [r]:18.04
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 643 1.3% 49.1 5.98s 3921 0 Direct 49.1 2988 5977 3921 31.2% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.11 49.11 0.00 0.00 0.00 0.0000 0.0000 192579.42 275120.47 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.79% 33.79 13 57 2988.17 1920 5519 2990.59 2632 3512 100956 144226 30.00%
crit 31.21% 15.33 3 33 5977.00 3841 10707 5974.54 4662 7428 91624 130894 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 5579 11.6% 57.0 5.21s 29366 0 Direct 57.0 0 29366 29366 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 56.97 56.97 0.00 0.00 0.00 0.0000 0.0000 1672845.55 1672845.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 56.97 32 87 29365.61 15945 60331 29337.68 25950 32862 1672846 1672846 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 2789 5.8% 57.0 5.21s 14683 0 Direct 57.0 0 14683 14683 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 56.97 56.97 0.00 0.00 0.00 0.0000 0.0000 836422.77 836422.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 56.97 32 87 14682.81 7972 30165 14668.84 12975 16431 836423 836423 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Remorseless Winter 0 (5716) 0.0% (11.9%) 15.2 20.39s 112977 89572

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.16 0.00 0.00 0.00 0.00 1.2613 0.0000 0.00 0.00 0.00% 89572.17 89572.17

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    breath
    [R]:5.96
  • if_expr:variable.rw_buffs|variable.adds_remain
    single_target
    [m]:9.21
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5716 11.9% 239.6 1.25s 7150 0 Direct 239.6 5442 10875 7150 31.4% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 239.58 239.58 0.00 0.00 0.00 0.0000 0.0000 1713067.66 1713067.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.56% 164.25 105 215 5442.31 1156 14048 5442.74 4701 6236 893919 893919 0.00%
crit 31.44% 75.32 42 113 10875.06 2312 29245 10874.38 8925 13178 819148 819148 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}
Strike Twice 203 0.4% 20.2 14.40s 3015 0 Direct 20.2 2296 4593 3015 31.3% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.22 20.22 0.00 0.00 0.00 0.0000 0.0000 60955.64 87081.70 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.69% 13.89 3 30 2296.31 2296 2296 2296.31 2296 2296 31885 45552 30.00%
crit 31.31% 6.33 0 17 4592.63 4593 4593 4587.11 0 4593 29070 41530 29.97%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 203 0.4% 20.2 14.48s 3017 0 Direct 20.2 2296 4593 3017 31.4% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.19 20.19 0.00 0.00 0.00 0.0000 0.0000 60913.07 87020.90 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.60% 13.85 3 29 2296.31 2296 2296 2296.31 2296 2296 31803 45434 30.00%
crit 31.40% 6.34 0 18 4592.63 4593 4593 4589.56 0 4593 29110 41587 29.98%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 2039 / 1113
auto_attack 1366 1.6% 95.2 2.91s 2346 1516 Direct 95.2 1784 3568 2346 31.5% 0.0%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.24 95.24 0.00 0.00 0.00 1.5471 0.0000 223404.75 319157.77 30.00% 1516.21 1516.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.50% 65.24 38 90 1783.92 1112 3197 1785.35 1622 1987 116383 166266 30.00%
crit 31.50% 30.00 12 52 3567.84 2225 6202 3570.54 3084 4157 107021 152892 30.00%

Action Details: Auto Attack

  • id:0
  • school:none
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:2.94
Claw 672 0.8% 52.7 5.34s 2084 2085 Direct 52.7 1586 3173 2084 31.4% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.71 52.71 0.00 0.00 0.00 1.0000 0.0000 109876.87 156970.96 30.00% 2084.51 2084.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.57% 36.15 16 50 1585.53 1001 2827 1586.55 1402 1759 57310 81873 30.00%
crit 31.43% 16.57 4 34 3173.16 2002 5671 3176.08 2646 3867 52567 75098 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.71
  • if_expr:energy>70
Gnaw 1 0.0% 2.9 120.69s 68 68 Direct 2.9 52 104 68 31.7% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.92 2.92 0.00 0.00 0.00 1.0000 0.0000 200.26 286.10 30.00% 68.49 68.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.26% 2.00 0 3 52.01 35 72 50.07 0 72 104 148 28.86%
crit 31.74% 0.93 0 3 103.88 73 146 69.69 0 146 96 138 20.11%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.92
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Frost 0
Anti-Magic Shell 165 100.1% 7.4 43.47s 6693 0 Direct 3.1 16014 0 16014 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 7.40 3.09 0.00 0.00 0.00 0.0000 0.0000 49514.30 49514.30 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.09 0 14 16013.62 16014 16014 13617.66 0 16014 49514 49514 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    high_prio_actions
    [k]:7.40
  • if_expr:runic_power.deficit>40
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Arcane Torrent 2.0 145.66s

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.97 0.00 0.00 0.00 0.00 1.2741 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [a]:0.92
  • if_expr:runic_power<60
    single_target
    [t]:1.04
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 3.9 82.90s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [c]:0.28
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [d]:3.67
  • if_expr:buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 4.0 76.34s

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.96 0.00 0.00 0.00 0.00 1.1877 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [T]:3.07
  • if_expr:rune<2&runic_power.deficit>25
    single_target
    [s]:0.88
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
Pillar of Frost 8.7 36.04s

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.66 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [g]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [h]:8.34
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
Elemental Potion of Ultimate Power 1.4 304.43s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [b]:1.45
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.69s

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [j]:2.98
Unholy Strength 20.1 14.50s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.14 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.5s 120.5s 11.8s 11.88% 0.00% 32.4 (32.4) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 122.6s
  • trigger_min/max:120.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:9.92% / 14.28%

Stack Uptimes

  • abomination_limb_1:11.88%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Anti-Magic Shell 7.4 0.0 43.3s 43.5s 6.9s 17.08% 18.31% 0.0 (0.0) 7.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 100.9s
  • trigger_min/max:40.0s / 100.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:11.57% / 19.50%

Stack Uptimes

  • antimagic_shell_1:17.08%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 10.5 37.0 29.3s 6.2s 18.9s 66.17% 0.00% 0.0 (0.0) 3.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 71.5s
  • trigger_min/max:0.9s / 48.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.0s
  • uptime_min/max:50.08% / 83.43%

Stack Uptimes

  • bonegrinder_crit_1:17.30%
  • bonegrinder_crit_2:14.88%
  • bonegrinder_crit_3:12.83%
  • bonegrinder_crit_4:11.21%
  • bonegrinder_crit_5:9.94%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 5.9 0.0 48.9s 48.9s 9.8s 19.45% 16.44% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:17.4s / 241.0s
  • trigger_min/max:17.4s / 241.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:2.96% / 32.07%

Stack Uptimes

  • bonegrinder_frost_1:19.45%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.8 13.9 120.1s 14.9s 19.4s 18.31% 0.00% 1.8 (1.8) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 147.0s
  • trigger_min/max:0.0s / 128.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:14.36% / 21.42%

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.94%
  • bound_by_fire_and_blaze_2:4.15%
  • bound_by_fire_and_blaze_3:4.03%
  • bound_by_fire_and_blaze_4:3.51%
  • bound_by_fire_and_blaze_5:2.58%
  • bound_by_fire_and_blaze_6:3.10%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.5s 120.5s 45.1s 44.47% 0.00% 132.8 (132.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 127.5s
  • trigger_min/max:120.0s / 127.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 105.0s
  • uptime_min/max:24.16% / 65.96%

Stack Uptimes

  • breath_of_sindragosa_1:44.47%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.2s 58.8s 50.3s 80.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 344.0s
  • trigger_min/max:15.0s / 306.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.8s
  • uptime_min/max:47.55% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.26%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dragon Games Equipment 3.0 0.0 120.0s 120.0s 0.8s 0.80% 0.00% 7.5 (7.5) 3.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.74
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.2s
  • trigger_min/max:120.0s / 120.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s
  • uptime_min/max:0.62% / 1.06%

Stack Uptimes

  • dragon_games_equipment_1:0.80%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 304.4s 304.4s 27.1s 12.87% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 327.9s
  • trigger_min/max:300.0s / 327.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.74% / 17.88%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.87%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 83.0s 82.8s 19.6s 25.89% 0.00% 11.6 (11.6) 3.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 246.1s
  • trigger_min/max:0.0s / 246.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.0s
  • uptime_min/max:21.50% / 30.13%

Stack Uptimes

  • empower_rune_weapon_1:25.89%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 8.3 0.0 36.0s 36.0s 12.7s 35.33% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.1s / 55.1s
  • trigger_min/max:26.1s / 55.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s
  • uptime_min/max:25.38% / 45.71%

Stack Uptimes

  • enduring_strength_1:35.33%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 8.6 21.0 36.3s 9.8s 10.0s 28.42% 98.85% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.5s / 115.4s
  • trigger_min/max:0.9s / 104.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:18.19% / 36.07%

Stack Uptimes

  • enduring_strength_builder_1:10.18%
  • enduring_strength_builder_2:8.75%
  • enduring_strength_builder_3:5.44%
  • enduring_strength_builder_4:2.56%
  • enduring_strength_builder_5:1.04%
  • enduring_strength_builder_6:0.35%
  • enduring_strength_builder_7:0.08%
  • enduring_strength_builder_8:0.01%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storm 12.8 122.6 24.3s 2.2s 15.7s 66.91% 86.80% 70.5 (112.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 105.4s
  • trigger_min/max:0.9s / 24.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 97.7s
  • uptime_min/max:53.66% / 76.49%

Stack Uptimes

  • gathering_storm_1:2.39%
  • gathering_storm_2:5.69%
  • gathering_storm_3:4.78%
  • gathering_storm_4:3.96%
  • gathering_storm_5:5.16%
  • gathering_storm_6:3.71%
  • gathering_storm_7:3.66%
  • gathering_storm_8:2.85%
  • gathering_storm_9:2.29%
  • gathering_storm_10:32.42%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 1.0 175.2 165.4s 1.7s 289.4s 97.78% 0.00% 173.1 (173.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.5s / 244.0s
  • trigger_min/max:1.0s / 13.0s
  • trigger_pct:100.00%
  • duration_min/max:8.5s / 354.3s
  • uptime_min/max:96.61% / 98.57%

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.09%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 45.2 13.9 6.6s 5.0s 2.3s 35.12% 53.70% 1.7 (1.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 60.6s
  • trigger_min/max:0.0s / 44.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.1s
  • uptime_min/max:18.28% / 56.92%

Stack Uptimes

  • killing_machine_1:29.85%
  • killing_machine_2:5.26%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 8.7 0.0 36.0s 36.0s 11.8s 34.02% 36.04% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.1s / 55.1s
  • trigger_min/max:26.1s / 55.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:29.28% / 38.32%

Stack Uptimes

  • pillar_of_frost_1:34.02%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 8.6 57.2 36.1s 4.4s 11.5s 33.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.2s / 55.1s
  • trigger_min/max:0.9s / 44.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:27.37% / 37.58%

Stack Uptimes

  • pillar_of_frost_bonus_1:2.10%
  • pillar_of_frost_bonus_2:3.13%
  • pillar_of_frost_bonus_3:3.50%
  • pillar_of_frost_bonus_4:2.86%
  • pillar_of_frost_bonus_5:3.32%
  • pillar_of_frost_bonus_6:3.28%
  • pillar_of_frost_bonus_7:2.93%
  • pillar_of_frost_bonus_8:2.66%
  • pillar_of_frost_bonus_9:1.91%
  • pillar_of_frost_bonus_10:1.39%
  • pillar_of_frost_bonus_11:1.17%
  • pillar_of_frost_bonus_12:1.07%
  • pillar_of_frost_bonus_13:0.95%
  • pillar_of_frost_bonus_14:0.85%
  • pillar_of_frost_bonus_15:0.65%
  • pillar_of_frost_bonus_16:0.42%
  • pillar_of_frost_bonus_17:0.28%
  • pillar_of_frost_bonus_18:0.21%
  • pillar_of_frost_bonus_19:0.17%
  • pillar_of_frost_bonus_20:0.13%
  • pillar_of_frost_bonus_21:0.06%
  • pillar_of_frost_bonus_22:0.02%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 12.9 2.3 24.2s 20.4s 17.4s 74.89% 0.00% 219.9 (219.9) 12.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 105.1s
  • trigger_min/max:20.0s / 26.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 98.7s
  • uptime_min/max:65.80% / 82.67%

Stack Uptimes

  • remorseless_winter_1:74.89%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 60.8 11.7 4.9s 4.2s 2.0s 40.89% 100.00% 11.7 (11.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 44.7s
  • trigger_min/max:0.0s / 44.7s
  • trigger_pct:63.16%
  • duration_min/max:0.0s / 32.3s
  • uptime_min/max:26.09% / 58.48%

Stack Uptimes

  • rime_1:40.89%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.5 13.7 22.2s 10.7s 11.6s 52.37% 0.00% 13.7 (13.7) 13.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 154.6s
  • trigger_min/max:0.9s / 151.3s
  • trigger_pct:14.94%
  • duration_min/max:0.0s / 76.5s
  • uptime_min/max:23.71% / 78.13%

Stack Uptimes

  • rune_mastery_1:52.37%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.4 23.3s 14.4s 10.2s 43.30% 42.37% 7.4 (7.4) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 85.4s
  • trigger_min/max:0.0s / 62.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.0s
  • uptime_min/max:24.54% / 69.50%

Stack Uptimes

  • rune_of_hysteria_1:43.30%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Ground 0.5 0.1 125.9s 77.7s 10.1s 1.80% 0.00% 0.1 (0.1) 0.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 250.2s
  • trigger_min/max:1.2s / 250.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 228.5s
  • uptime_min/max:0.00% / 76.15%

Stack Uptimes

  • unholy_ground_1:1.80%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 11.7 35.9s 14.4s 23.5s 66.15% 0.00% 11.7 (11.7) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 184.4s
  • trigger_min/max:0.0s / 62.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 174.7s
  • uptime_min/max:43.68% / 88.90%

Stack Uptimes

  • unholy_strength_1:66.15%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 1.0 175.2 165.4s 1.7s 289.4s 97.78% 0.00% 173.1 (173.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.5s / 244.0s
  • trigger_min/max:1.0s / 13.0s
  • trigger_pct:100.00%
  • duration_min/max:8.5s / 354.3s
  • uptime_min/max:96.61% / 98.57%

Stack Uptimes

  • unleashed_frenzy_1:0.34%
  • unleashed_frenzy_2:0.34%
  • unleashed_frenzy_3:97.09%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=10 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.6 9.0 50.0 11.0s 1.3s 131.8s
windfury_totem_extra_attack_oh 22.4 7.0 41.0 12.9s 1.3s 154.5s
Killing Machine spent on Obliterate 57.0 32.0 87.0 5.2s 0.9s 43.4s
Killing Machine: Critical auto attacks 57.4 33.0 87.0 5.5s 1.3s 44.8s
Killing Machine wasted: Critical auto attacks 1.7 0.0 11.0 63.8s 1.3s 328.3s
Rune ready 224.2 157.0 284.0 1.5s 0.0s 13.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 3.40% 0.00% 11.52% 0.8s 0.0s 9.1s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Remorseless Winter0.4310.0006.6186.5492.11917.942
Horn of Winter28.4090.000238.729132.79160.048274.885
Death and Decay121.1700.000322.119283.122132.000359.936
Empower Rune Weapon1.4530.00026.1415.7374.13732.357
Abomination Limb0.3290.0002.6310.9870.0003.428
Pillar of Frost1.5570.00015.13713.4995.69834.921
Breath of Sindragosa2.2260.0007.5026.5594.14113.619
Raise Dead0.8060.0003.0392.4051.3435.829

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=455878)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0771.404 / 1.1163.78520.159
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
16.24246.53785.354 / 83.371130.939201.136

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Anti-Magic ShellRunic Power3.0915.140.40%4.900.322.04%
Breath of SindragosaRune11.1210.724.78%0.960.403.63%
Empower Rune WeaponRunic Power19.1988.692.35%4.627.287.58%
Empower Rune WeaponRune19.1919.058.49%0.990.150.77%
Frost FeverRunic Power32.66154.364.08%4.738.945.48%
Horn of WinterRunic Power3.9698.882.62%25.000.000.00%
Horn of WinterRune7.917.913.53%1.000.000.00%
Murderous EfficiencyRune28.6028.6012.75%1.000.000.00%
Rage of the Frozen ChampionRunic Power60.41474.7212.56%7.868.581.77%
Rune RegenerationRune84.7784.7737.80%1.000.000.00%
Rune of HysteriaRunic Power158.51322.378.53%2.0331.368.87%
Runic AttenuationRunic Power71.22341.729.04%4.8014.364.03%
Runic EmpowermentRune73.8373.1932.64%0.990.640.86%
Arcane TorrentRunic Power1.9739.351.04%20.000.000.00%
Death and DecayRunic Power0.605.950.16%10.000.000.00%
Howling BlastRunic Power60.410.010.00%0.000.000.00%
ObliterateRunic Power106.082092.8855.39%19.7328.741.35%
Remorseless WinterRunic Power15.16144.703.83%9.546.934.57%
pet - ghoul
energy_regenEnergy1111.151927.99100.00%1.74170.518.13%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_tick)Runic Power 132.812390.6364.76%18.0017.961259.19
Death and DecayRune 0.600.600.26%1.001.005924.13
Frost StrikeRunic Power 43.371301.0535.24%30.0030.00845.91
Howling BlastRune 60.410.000.00%0.000.001611090815.23
ObliterateRune 106.08212.1693.09%2.004.3214550.04
Remorseless WinterRune 15.1615.166.65%1.001.00112977.49
pet - ghoul
ClawEnergy 52.712108.50100.00%40.0040.0052.11
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 330760.0 760.72 884.33 251432.8 293675.3 -14972.7 330760.0
Runic Power 0.0 12.60 12.31 106.5 87.1 0.0 124.0
Rune 6.0 0.75 0.76 0.0 2.3 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 48010.42
Minimum 39648.62
Maximum 56061.70
Spread ( max - min ) 16413.08
Range [ ( max - min ) / 2 * 100% ] 17.09%
Standard Deviation 2269.3354
5th Percentile 44369.28
95th Percentile 51780.44
( 95th Percentile - 5th Percentile ) 7411.16
Mean Distribution
Standard Deviation 26.2058
95.00% Confidence Interval ( 47959.06 - 48061.78 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 86
0.1% Error 8583
0.1 Scale Factor Error with Delta=300 43963
0.05 Scale Factor Error with Delta=300 175850
0.01 Scale Factor Error with Delta=300 4396237
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 48010.42
Minimum 39648.62
Maximum 56061.70
Spread ( max - min ) 16413.08
Range [ ( max - min ) / 2 * 100% ] 17.09%
Standard Deviation 2269.3354
5th Percentile 44369.28
95th Percentile 51780.44
( 95th Percentile - 5th Percentile ) 7411.16
Mean Distribution
Standard Deviation 26.2058
95.00% Confidence Interval ( 47959.06 - 48061.78 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 86
0.1% Error 8583
0.1 Scale Factor Error with Delta=300 43963
0.05 Scale Factor Error with Delta=300 175850
0.01 Scale Factor Error with Delta=300 4396237
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 48010.42
Minimum 39648.62
Maximum 56061.70
Spread ( max - min ) 16413.08
Range [ ( max - min ) / 2 * 100% ] 17.09%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 14048606.35
Minimum 9265478.89
Maximum 17751618.65
Spread ( max - min ) 8486139.76
Range [ ( max - min ) / 2 * 100% ] 30.20%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 883.73
Minimum 0.00
Maximum 2364.79
Spread ( max - min ) 2364.79
Range [ ( max - min ) / 2 * 100% ] 133.80%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 759.39
Minimum 0.00
Maximum 1919.23
Spread ( max - min ) 1919.23
Range [ ( max - min ) / 2 * 100% ] 126.37%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
B 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
C 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
D 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
E 0.00 variable,name=2h_check,value=main_hand.2h
Default action list Executed every time the actor is available.
# count action,conditions
F 1.00 auto_attack
G 0.00 call_action_list,name=variables
Choose Action list to run
H 0.00 call_action_list,name=high_prio_actions
I 0.00 call_action_list,name=trinkets
J 0.00 call_action_list,name=cooldowns
K 0.00 call_action_list,name=racials
L 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
M 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
N 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
O 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
P 0.00 call_action_list,name=aoe,if=active_enemies>=2
Q 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
R 5.96 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Breath Active Rotation
S 37.32 howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
T 3.07 horn_of_winter,if=rune<2&runic_power.deficit>25
U 23.55 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&runic_power>45
V 30.85 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
W 0.60 death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
0.00 remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
X 0.21 howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
Y 6.55 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
Z 0.55 howling_blast,if=buff.rime.react
a 0.92 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
b 1.45 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
c 0.28 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
d 3.67 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
e 0.10 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<12
f 2.89 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
g 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
h 8.34 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
i 2.95 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&cooldown.empower_rune_weapon.charges<1&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains>10|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
j 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.high_prio_actions
# count action,conditions
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
k 7.40 antimagic_shell,if=runic_power.deficit>40
0.00 antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up&cooldown.empower_rune_weapon.charges<2|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up)
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
l 2.75 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
actions.single_target
# count action,conditions
m 9.21 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
n 28.88 frost_strike,if=buff.killing_machine.stack<2&runic_power.deficit<20&!variable.2h_check
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 obliterate,if=set_bonus.tier30_4pc&(talent.fatal_fixation&buff.killing_machine.stack>1&buff.killing_machine.react)|(!talent.fatal_fixation&buff.killing_machine.react)
o 27.10 obliterate,if=!set_bonus.tier30_4pc&buff.killing_machine.react
p 22.33 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
q 4.15 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
r 18.04 obliterate,if=!variable.pooling_runes
s 0.88 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
t 1.04 arcane_torrent,if=runic_power.deficit>20
u 7.59 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
Trinkets
v 2.83 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&cooldown.empower_rune_weapon.charges<1|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&cooldown.empower_rune_weapon.charges<1|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
w 3.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
0.00 use_item,use_off_gcd=1,slot=main_hand,if=(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFkwfjmoopridhbSVSVVVSSUSVSUSUSvTRVYSVSVSUSdVSVSVShVSkaRUVVSUVUUXrrpmuuorsqophnrnrnpmnonpnkrnrnononpmnoonohponpqoowfjnmpiUSUSUSkVSVVSvdUSRVVhSTVVSVVWrprrtmluoponpqkuopononhmponpqornonpnonpmononpnrnrnhrnpnkomnonpnopnornwofjnomiSSYSYhVSVSdVSvVVTVRSYSkUVYYSUSYSYSUSRUSVSrtguuopo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 4 trinket_1_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 5 trinket_2_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 6 trinket_1_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 7 trinket_2_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat A trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat B trinket_1_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat C trinket_2_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat D rw_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat E 2h_check PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
0:00.000 default F auto_attack Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
0:00.000 high_prio_actions k antimagic_shell PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, killing_machine, corrupting_rage
0:00.000 trinkets w use_item_dragon_games_equipment Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, killing_machine, corrupting_rage
0:00.000 cooldowns f abomination_limb Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, killing_machine, dragon_games_equipment, corrupting_rage
0:01.035 cooldowns j raise_dead Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, abomination_limb, killing_machine, rime, corrupting_rage
0:01.035 single_target m remorseless_winter Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, abomination_limb, killing_machine, rime, corrupting_rage
0:02.071 single_target o obliterate Fluffy_Pillow 10.0/124: 8% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, abomination_limb, killing_machine(2), remorseless_winter, rime, corrupting_rage
0:03.108 single_target o obliterate Fluffy_Pillow 30.0/124: 24% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit, corrupting_rage
0:04.143 single_target p howling_blast Fluffy_Pillow 50.0/124: 40% runic_power
2.0/6: 33% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(2), corrupting_rage
0:05.179 single_target r obliterate Fluffy_Pillow 58.0/124: 47% runic_power
2.0/6: 33% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, gathering_storm(5), remorseless_winter, bonegrinder_crit(2), corrupting_rage
0:06.215 cooldowns i breath_of_sindragosa Fluffy_Pillow 78.0/124: 63% runic_power
0.0/6: 0% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, gathering_storm(7), remorseless_winter, rime, bonegrinder_crit(2), corrupting_rage
0:06.215 cooldowns d empower_rune_weapon Fluffy_Pillow 78.0/124: 63% runic_power
2.0/6: 33% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(7), remorseless_winter, rime, bonegrinder_crit(2), corrupting_rage
0:06.215 cooldowns h pillar_of_frost Fluffy_Pillow 83.0/124: 67% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(7), remorseless_winter, rime, bonegrinder_crit(2), corrupting_rage
0:06.215 cooldowns b potion Fluffy_Pillow 83.0/124: 67% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(7), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), corrupting_rage
0:06.215 breath S howling_blast Fluffy_Pillow 83.0/124: 67% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(7), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), corrupting_rage, elemental_potion_of_ultimate_power
0:07.116 breath V obliterate Fluffy_Pillow 96.0/124: 77% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(2), corrupting_rage, elemental_potion_of_ultimate_power
0:08.018 breath S howling_blast Fluffy_Pillow 103.0/124: 83% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons, breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy, corrupting_rage, elemental_potion_of_ultimate_power
0:08.918 breath V obliterate Fluffy_Pillow 93.0/124: 75% runic_power
6.0/6: 100% rune
bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(2), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(2), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:09.818 breath V obliterate Fluffy_Pillow 99.8/124: 80% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:10.719 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:11.619 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:12.521 breath S howling_blast Fluffy_Pillow 97.9/124: 79% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:13.423 breath U obliterate Fluffy_Pillow 96.0/124: 77% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:14.323 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:15.224 breath V obliterate Fluffy_Pillow 97.9/124: 79% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:16.126 breath S howling_blast Fluffy_Pillow 122.7/124: 99% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(17), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(5), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:17.026 breath U obliterate Fluffy_Pillow 112.2/124: 90% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(5), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:17.926 breath S howling_blast Fluffy_Pillow 112.2/124: 90% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(20), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(6), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:18.827 breath U obliterate Fluffy_Pillow 104.1/124: 84% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:19.727 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:20.015 trinkets v use_item_blazebinders_hoof Fluffy_Pillow 115.9/124: 93% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:20.628 breath T horn_of_winter Fluffy_Pillow 97.9/124: 79% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:21.528 breath R remorseless_winter Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:22.427 Waiting     0.889s 100.4/124: 81% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:23.316 breath V obliterate Fluffy_Pillow 82.4/124: 66% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:24.216 breath Y obliterate Fluffy_Pillow 89.2/124: 72% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:25.117 breath S howling_blast Fluffy_Pillow 114.0/124: 92% runic_power
2.0/6: 33% rune
bloodlust, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:26.017 Waiting     1.229s 112.2/124: 90% runic_power
3.0/6: 50% rune
bloodlust, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:27.246 breath V obliterate Fluffy_Pillow 81.2/124: 65% runic_power
5.0/6: 83% rune
bloodlust, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:28.281 breath S howling_blast Fluffy_Pillow 83.2/124: 67% runic_power
4.0/6: 67% rune
bloodlust, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:29.316 breath V obliterate Fluffy_Pillow 78.2/124: 63% runic_power
4.0/6: 67% rune
bloodlust, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:30.350 breath S howling_blast Fluffy_Pillow 80.2/124: 65% runic_power
3.0/6: 50% rune
bloodlust, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:31.386 breath U obliterate Fluffy_Pillow 70.2/124: 57% runic_power
3.0/6: 50% rune
bloodlust, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:32.420 breath S howling_blast Fluffy_Pillow 72.2/124: 58% runic_power
2.0/6: 33% rune
bloodlust, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:33.226 cooldowns d empower_rune_weapon Fluffy_Pillow 62.2/124: 50% runic_power
2.0/6: 33% rune
bloodlust, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:33.457 breath V obliterate Fluffy_Pillow 67.2/124: 54% runic_power
3.0/6: 50% rune
bloodlust, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:34.357 breath S howling_blast Fluffy_Pillow 74.2/124: 60% runic_power
3.0/6: 50% rune
bloodlust, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:35.257 breath V obliterate Fluffy_Pillow 69.2/124: 56% runic_power
3.0/6: 50% rune
bloodlust, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:36.156 breath S howling_blast Fluffy_Pillow 89.2/124: 72% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage, elemental_potion_of_ultimate_power
0:37.056 breath V obliterate Fluffy_Pillow 79.2/124: 64% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
0:37.956 breath S howling_blast Fluffy_Pillow 81.2/124: 65% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
0:38.855 cooldowns h pillar_of_frost Fluffy_Pillow 76.2/124: 61% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
0:38.855 breath V obliterate Fluffy_Pillow 76.2/124: 61% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
0:39.756 breath S howling_blast Fluffy_Pillow 84.4/124: 68% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, corrupting_rage
0:40.656 high_prio_actions k antimagic_shell PR_Death_Knight_Frost 76.3/124: 62% runic_power
1.0/6: 17% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:40.656 Waiting     0.588s 76.3/124: 62% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:41.244 breath a arcane_torrent Fluffy_Pillow 58.3/124: 47% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:42.414 breath R remorseless_winter Fluffy_Pillow 65.1/124: 53% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:43.585 breath U obliterate Fluffy_Pillow 65.7/124: 53% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:44.756 breath V obliterate Fluffy_Pillow 72.5/124: 58% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:45.925 Waiting     1.892s 79.3/124: 64% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:47.817 breath V obliterate Fluffy_Pillow 43.3/124: 35% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:48.988 breath S howling_blast Fluffy_Pillow 62.5/124: 50% runic_power
1.0/6: 17% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:50.160 breath U obliterate Fluffy_Pillow 66.8/124: 54% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:51.332 breath V obliterate Fluffy_Pillow 55.6/124: 45% runic_power
2.0/6: 33% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:52.503 Waiting     0.740s 62.4/124: 50% runic_power
1.0/6: 17% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:53.243 breath U obliterate Fluffy_Pillow 49.4/124: 40% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:54.587 Waiting     1.302s 56.4/124: 46% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:55.889 breath U obliterate Fluffy_Pillow 43.4/124: 35% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:57.233 breath X howling_blast Fluffy_Pillow 27.4/124: 22% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:58.576 single_target r obliterate Fluffy_Pillow 17.4/124: 14% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:59.920 single_target r obliterate Fluffy_Pillow 37.4/124: 30% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:01.265 single_target p howling_blast Fluffy_Pillow 62.4/124: 50% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:02.610 single_target m remorseless_winter Fluffy_Pillow 70.4/124: 57% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
1:03.955 single_target u frost_strike Fluffy_Pillow 85.4/124: 69% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
1:05.300 single_target u frost_strike Fluffy_Pillow 60.4/124: 49% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
1:06.646 single_target o obliterate Fluffy_Pillow 30.4/124: 25% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:07.991 single_target r obliterate Fluffy_Pillow 50.4/124: 41% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:09.337 single_target s horn_of_winter Fluffy_Pillow 70.4/124: 57% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(4), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:10.681 single_target q frost_strike Fluffy_Pillow 101.4/124: 82% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(4), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:12.025 single_target o obliterate Fluffy_Pillow 77.6/124: 63% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(4), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:13.370 single_target p howling_blast Fluffy_Pillow 102.4/124: 83% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(6), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:14.714 cooldowns h pillar_of_frost Fluffy_Pillow 112.4/124: 91% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:14.855 single_target n frost_strike Fluffy_Pillow 112.4/124: 91% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:16.201 single_target r obliterate Fluffy_Pillow 88.6/124: 71% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:17.544 single_target n frost_strike Fluffy_Pillow 113.4/124: 91% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:18.890 single_target r obliterate Fluffy_Pillow 83.4/124: 67% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:20.235 single_target n frost_strike Fluffy_Pillow 120.6/124: 97% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:21.579 single_target p howling_blast Fluffy_Pillow 90.6/124: 73% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:22.924 single_target m remorseless_winter Fluffy_Pillow 100.5/124: 81% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:24.268 single_target n frost_strike Fluffy_Pillow 112.9/124: 91% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:25.614 single_target o obliterate Fluffy_Pillow 89.1/124: 72% runic_power
5.0/6: 83% rune
rune_mastery, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:26.959 single_target n frost_strike Fluffy_Pillow 113.9/124: 92% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:28.302 single_target p howling_blast Fluffy_Pillow 90.1/124: 73% runic_power
5.0/6: 83% rune
rune_mastery, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:29.646 single_target n frost_strike Fluffy_Pillow 106.2/124: 86% runic_power
5.0/6: 83% rune
rune_mastery, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:30.992 high_prio_actions k antimagic_shell PR_Death_Knight_Frost 82.4/124: 66% runic_power
6.0/6: 100% rune
icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:30.992 single_target r obliterate Fluffy_Pillow 82.4/124: 66% runic_power
6.0/6: 100% rune
antimagic_shell, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:32.335 single_target n frost_strike Fluffy_Pillow 107.2/124: 86% runic_power
4.0/6: 67% rune
antimagic_shell, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:33.680 single_target r obliterate Fluffy_Pillow 77.2/124: 62% runic_power
5.0/6: 83% rune
antimagic_shell, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:35.025 single_target n frost_strike Fluffy_Pillow 114.4/124: 92% runic_power
3.0/6: 50% rune
antimagic_shell, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:36.372 single_target o obliterate Fluffy_Pillow 84.4/124: 68% runic_power
3.0/6: 50% rune
antimagic_shell, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:37.716 single_target n frost_strike Fluffy_Pillow 109.4/124: 88% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:39.062 single_target o obliterate Fluffy_Pillow 84.4/124: 68% runic_power
2.0/6: 33% rune
icy_talons(3), killing_machine(2), bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:40.407 single_target n frost_strike Fluffy_Pillow 115.4/124: 93% runic_power
1.0/6: 17% rune
icy_talons(3), killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:41.751 single_target p howling_blast Fluffy_Pillow 85.4/124: 69% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:43.094 single_target m remorseless_winter Fluffy_Pillow 95.3/124: 77% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:44.438 single_target n frost_strike Fluffy_Pillow 107.7/124: 87% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:45.784 single_target o obliterate Fluffy_Pillow 77.7/124: 63% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), killing_machine(2), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:47.128 single_target o obliterate Fluffy_Pillow 114.9/124: 93% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm(2), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
1:48.473 single_target n frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), gathering_storm(4), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
1:49.820 single_target o obliterate Fluffy_Pillow 99.0/124: 80% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm(4), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
1:51.164 cooldowns h pillar_of_frost Fluffy_Pillow 119.0/124: 96% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), gathering_storm(6), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
1:51.164 single_target p howling_blast Fluffy_Pillow 119.0/124: 96% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), gathering_storm(6), killing_machine(2), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
1:52.508 single_target o obliterate Fluffy_Pillow 124.0/124: 100% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), gathering_storm(7), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
1:53.854 single_target n frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), gathering_storm(9), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:55.197 single_target p howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), gathering_storm(9), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:56.542 single_target q frost_strike Fluffy_Pillow 102.0/124: 82% runic_power
1.0/6: 17% rune
icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:57.888 single_target o obliterate Fluffy_Pillow 72.0/124: 58% runic_power
3.0/6: 50% rune
icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:59.232 single_target o obliterate Fluffy_Pillow 97.0/124: 78% runic_power
2.0/6: 33% rune
icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
2:00.000 trinkets w use_item_dragon_games_equipment Fluffy_Pillow 117.0/124: 94% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:00.577 cooldowns f abomination_limb Fluffy_Pillow 117.0/124: 94% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), dragon_games_equipment, rune_of_hysteria, corrupting_rage
2:01.923 cooldowns j raise_dead Fluffy_Pillow 117.0/124: 94% runic_power
2.0/6: 33% rune
rune_mastery, abomination_limb, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:01.923 single_target n frost_strike Fluffy_Pillow 117.0/124: 94% runic_power
2.0/6: 33% rune
rune_mastery, abomination_limb, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:03.268 single_target m remorseless_winter Fluffy_Pillow 87.0/124: 70% runic_power
2.0/6: 33% rune
rune_mastery, abomination_limb, icy_talons(3), killing_machine, rime, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:04.614 single_target p howling_blast Fluffy_Pillow 105.6/124: 85% runic_power
1.0/6: 17% rune
rune_mastery, abomination_limb, icy_talons(3), killing_machine(2), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:05.960 Waiting     0.099s 115.5/124: 93% runic_power
1.0/6: 17% rune
rune_mastery, abomination_limb, icy_talons(3), gathering_storm, killing_machine(2), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:06.059 cooldowns i breath_of_sindragosa Fluffy_Pillow 115.5/124: 93% runic_power
1.0/6: 17% rune
rune_mastery, abomination_limb, icy_talons(3), gathering_storm, killing_machine(2), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:06.215 breath U obliterate Fluffy_Pillow 121.7/124: 98% runic_power
3.0/6: 50% rune
rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine(2), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:07.560 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune
rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:08.905 breath U obliterate Fluffy_Pillow 97.9/124: 79% runic_power
5.0/6: 83% rune
rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine(2), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:10.250 breath S howling_blast Fluffy_Pillow 92.9/124: 75% runic_power
4.0/6: 67% rune
rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:11.595 breath U obliterate Fluffy_Pillow 84.8/124: 68% runic_power
5.0/6: 83% rune
rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(7), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:12.939 breath S howling_blast Fluffy_Pillow 91.6/124: 74% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:14.286 high_prio_actions k antimagic_shell PR_Death_Knight_Frost 65.6/124: 53% runic_power
6.0/6: 100% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:14.286 breath V obliterate Fluffy_Pillow 65.6/124: 53% runic_power
6.0/6: 100% rune
antimagic_shell, rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:15.630 breath S howling_blast Fluffy_Pillow 72.4/124: 58% runic_power
4.0/6: 67% rune
antimagic_shell, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:16.973 breath V obliterate Fluffy_Pillow 76.7/124: 62% runic_power
4.0/6: 67% rune
antimagic_shell, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:18.317 breath V obliterate Fluffy_Pillow 71.7/124: 58% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
2:19.662 breath S howling_blast Fluffy_Pillow 73.7/124: 59% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
2:20.097 trinkets v use_item_blazebinders_hoof Fluffy_Pillow 81.7/124: 66% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
2:20.310 cooldowns d empower_rune_weapon Fluffy_Pillow 63.7/124: 51% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:21.006 breath U obliterate Fluffy_Pillow 68.7/124: 55% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:22.177 breath S howling_blast Fluffy_Pillow 70.7/124: 57% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:23.349 breath R remorseless_winter Fluffy_Pillow 42.7/124: 34% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:24.519 breath V obliterate Fluffy_Pillow 34.7/124: 28% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:25.689 breath V obliterate Fluffy_Pillow 46.7/124: 38% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:26.860 cooldowns h pillar_of_frost Fluffy_Pillow 48.7/124: 39% runic_power
0.0/6: 0% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:26.860 breath S howling_blast Fluffy_Pillow 48.7/124: 39% runic_power
0.0/6: 0% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:28.030 breath T horn_of_winter Fluffy_Pillow 43.7/124: 35% runic_power
1.0/6: 17% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:29.202 breath V obliterate Fluffy_Pillow 50.7/124: 41% runic_power
3.0/6: 50% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:30.371 breath V obliterate Fluffy_Pillow 39.7/124: 32% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(7), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:31.541 breath S howling_blast Fluffy_Pillow 41.7/124: 34% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:32.713 breath V obliterate Fluffy_Pillow 36.7/124: 30% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:33.883 breath V obliterate Fluffy_Pillow 43.7/124: 35% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:35.052 Waiting     0.203s 45.7/124: 37% runic_power
1.0/6: 17% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:35.255 breath W death_and_decay Fluffy_Pillow 27.7/124: 22% runic_power
1.0/6: 17% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:36.426 Waiting     0.822s 29.7/124: 24% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
2:37.248 single_target r obliterate Fluffy_Pillow 11.7/124: 9% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
2:38.362 single_target p howling_blast Fluffy_Pillow 31.7/124: 26% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
2:39.475 single_target r obliterate Fluffy_Pillow 39.7/124: 32% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(10), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), corrupting_rage
2:40.589 single_target r obliterate Fluffy_Pillow 72.1/124: 58% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), killing_machine(2), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:41.872 single_target t arcane_torrent Fluffy_Pillow 96.9/124: 78% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:43.153 single_target m remorseless_winter Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:44.629 high_prio_actions l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:45.911 single_target u frost_strike Fluffy_Pillow 94.0/124: 76% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:47.192 single_target o obliterate Fluffy_Pillow 70.2/124: 57% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:48.474 single_target p howling_blast Fluffy_Pillow 95.0/124: 77% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(2), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:49.755 single_target o obliterate Fluffy_Pillow 113.0/124: 91% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:51.036 single_target n frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
2:52.316 single_target p howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(5), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
2:53.597 single_target q frost_strike Fluffy_Pillow 107.0/124: 86% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(6), killing_machine(2), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
2:54.880 high_prio_actions k antimagic_shell PR_Death_Knight_Frost 77.0/124: 62% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
2:54.880 single_target u frost_strike Fluffy_Pillow 77.0/124: 62% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
2:56.160 single_target o obliterate Fluffy_Pillow 57.0/124: 46% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
2:57.442 single_target p howling_blast Fluffy_Pillow 83.2/124: 67% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:58.722 single_target o obliterate Fluffy_Pillow 93.1/124: 75% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:00.003 single_target n frost_strike Fluffy_Pillow 117.9/124: 95% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine, rime, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:01.284 single_target o obliterate Fluffy_Pillow 87.9/124: 71% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine, rime, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:02.567 single_target n frost_strike Fluffy_Pillow 112.7/124: 91% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:03.849 cooldowns h pillar_of_frost Fluffy_Pillow 88.9/124: 72% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), killing_machine, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:03.849 single_target m remorseless_winter Fluffy_Pillow 88.9/124: 72% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:05.130 single_target p howling_blast Fluffy_Pillow 107.5/124: 87% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:06.413 single_target o obliterate Fluffy_Pillow 117.4/124: 95% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm, killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:07.697 single_target n frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:08.977 single_target p howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:10.259 single_target q frost_strike Fluffy_Pillow 103.9/124: 84% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:11.541 single_target o obliterate Fluffy_Pillow 73.9/124: 60% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:12.821 single_target r obliterate Fluffy_Pillow 98.7/124: 80% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:14.103 single_target n frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:15.384 single_target o obliterate Fluffy_Pillow 94.0/124: 76% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:16.665 single_target n frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:17.945 single_target p howling_blast Fluffy_Pillow 99.0/124: 80% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:19.227 single_target n frost_strike Fluffy_Pillow 107.0/124: 86% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:20.509 single_target o obliterate Fluffy_Pillow 82.0/124: 66% runic_power
5.0/6: 83% rune
unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
3:21.791 single_target n frost_strike Fluffy_Pillow 113.0/124: 91% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
3:23.073 single_target p howling_blast Fluffy_Pillow 83.0/124: 67% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
3:24.354 single_target m remorseless_winter Fluffy_Pillow 99.1/124: 80% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
3:25.635 single_target o obliterate Fluffy_Pillow 123.9/124: 100% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
3:26.917 single_target n frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
3:28.198 single_target o obliterate Fluffy_Pillow 100.2/124: 81% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
3:29.480 single_target n frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
3:30.762 single_target p howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria
3:32.043 single_target n frost_strike Fluffy_Pillow 116.3/124: 94% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:33.325 single_target r obliterate Fluffy_Pillow 86.3/124: 70% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:34.607 single_target n frost_strike Fluffy_Pillow 111.1/124: 90% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:35.889 single_target r obliterate Fluffy_Pillow 87.3/124: 70% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:37.173 single_target n frost_strike Fluffy_Pillow 117.1/124: 94% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
3:38.455 cooldowns h pillar_of_frost Fluffy_Pillow 92.1/124: 74% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, unleashed_frenzy(3), corrupting_rage
3:38.455 single_target r obliterate Fluffy_Pillow 92.1/124: 74% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, unleashed_frenzy(3), corrupting_rage
3:39.736 single_target n frost_strike Fluffy_Pillow 112.1/124: 90% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:41.017 single_target p howling_blast Fluffy_Pillow 92.1/124: 74% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:42.298 single_target n frost_strike Fluffy_Pillow 105.1/124: 85% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:43.580 high_prio_actions k antimagic_shell PR_Death_Knight_Frost 75.1/124: 61% runic_power
5.0/6: 83% rune
unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:43.580 single_target o obliterate Fluffy_Pillow 75.1/124: 61% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
3:44.861 single_target m remorseless_winter Fluffy_Pillow 100.1/124: 81% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:46.142 single_target n frost_strike Fluffy_Pillow 112.5/124: 91% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:47.425 single_target o obliterate Fluffy_Pillow 88.7/124: 72% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:48.708 single_target n frost_strike Fluffy_Pillow 119.7/124: 97% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:49.991 single_target p howling_blast Fluffy_Pillow 95.9/124: 77% runic_power
5.0/6: 83% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:51.272 single_target n frost_strike Fluffy_Pillow 105.8/124: 85% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:52.554 single_target o obliterate Fluffy_Pillow 75.8/124: 61% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:53.836 single_target p howling_blast Fluffy_Pillow 100.8/124: 81% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:55.119 single_target n frost_strike Fluffy_Pillow 108.8/124: 88% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:56.401 single_target o obliterate Fluffy_Pillow 78.8/124: 64% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:57.682 single_target r obliterate Fluffy_Pillow 98.8/124: 80% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:58.964 single_target n frost_strike Fluffy_Pillow 118.8/124: 96% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:00.000 trinkets w use_item_dragon_games_equipment Fluffy_Pillow 88.8/124: 72% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:00.245 single_target o obliterate Fluffy_Pillow 88.8/124: 72% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), dragon_games_equipment, rune_of_hysteria, corrupting_rage
4:01.528 cooldowns f abomination_limb Fluffy_Pillow 119.8/124: 97% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), killing_machine, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:02.809 cooldowns j raise_dead Fluffy_Pillow 119.8/124: 97% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:02.809 single_target n frost_strike Fluffy_Pillow 119.8/124: 97% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:04.091 single_target o obliterate Fluffy_Pillow 96.0/124: 77% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:05.373 single_target m remorseless_winter Fluffy_Pillow 120.8/124: 97% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:06.653 cooldowns i breath_of_sindragosa Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria
4:06.653 breath S howling_blast Fluffy_Pillow 124.0/124: 100% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria
4:07.933 Waiting     0.509s 106.0/124: 85% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria
4:08.442 breath S howling_blast Fluffy_Pillow 112.2/124: 90% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria
4:09.722 breath Y obliterate Fluffy_Pillow 86.1/124: 69% runic_power
6.0/6: 100% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria
4:11.002 breath S howling_blast Fluffy_Pillow 92.9/124: 75% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(4), remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria
4:12.282 breath Y obliterate Fluffy_Pillow 91.0/124: 73% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria
4:13.564 cooldowns h pillar_of_frost Fluffy_Pillow 97.8/124: 79% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(7), remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria
4:13.564 breath V obliterate Fluffy_Pillow 97.8/124: 79% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(7), pillar_of_frost, remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria
4:14.846 breath S howling_blast Fluffy_Pillow 86.6/124: 70% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria
4:16.128 breath V obliterate Fluffy_Pillow 78.6/124: 63% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria
4:17.409 breath S howling_blast Fluffy_Pillow 85.4/124: 69% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
4:18.690 cooldowns d empower_rune_weapon Fluffy_Pillow 59.3/124: 48% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
4:18.690 breath V obliterate Fluffy_Pillow 65.5/124: 53% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
4:19.807 breath S howling_blast Fluffy_Pillow 78.5/124: 63% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria
4:20.097 trinkets v use_item_blazebinders_hoof Fluffy_Pillow 88.4/124: 71% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria
4:20.922 breath V obliterate Fluffy_Pillow 70.4/124: 57% runic_power
5.0/6: 83% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2)
4:22.036 breath V obliterate Fluffy_Pillow 77.4/124: 62% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:23.148 breath T horn_of_winter Fluffy_Pillow 84.4/124: 68% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:24.262 breath V obliterate Fluffy_Pillow 96.4/124: 78% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(13), bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:25.376 breath R remorseless_winter Fluffy_Pillow 98.4/124: 79% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(15), rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:26.491 breath S howling_blast Fluffy_Pillow 95.4/124: 77% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:27.607 breath Y obliterate Fluffy_Pillow 85.4/124: 69% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:28.722 breath S howling_blast Fluffy_Pillow 84.4/124: 68% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:29.838 high_prio_actions k antimagic_shell PR_Death_Knight_Frost 74.4/124: 60% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:29.838 breath U obliterate Fluffy_Pillow 74.4/124: 60% runic_power
5.0/6: 83% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:30.953 breath V obliterate Fluffy_Pillow 76.4/124: 62% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:32.067 breath Y obliterate Fluffy_Pillow 84.6/124: 68% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, corrupting_rage
4:33.182 breath Y obliterate Fluffy_Pillow 91.4/124: 74% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, corrupting_rage
4:34.296 breath S howling_blast Fluffy_Pillow 110.6/124: 89% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, corrupting_rage
4:35.409 breath U obliterate Fluffy_Pillow 102.5/124: 83% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, corrupting_rage
4:36.524 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, corrupting_rage
4:37.638 breath Y obliterate Fluffy_Pillow 97.9/124: 79% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, corrupting_rage
4:38.752 breath S howling_blast Fluffy_Pillow 92.9/124: 75% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, corrupting_rage
4:40.033 breath Y obliterate Fluffy_Pillow 89.8/124: 72% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), corrupting_rage
4:41.315 breath S howling_blast Fluffy_Pillow 96.8/124: 78% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:42.596 breath U obliterate Fluffy_Pillow 86.8/124: 70% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:43.879 breath S howling_blast Fluffy_Pillow 75.8/124: 61% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:45.160 breath R remorseless_winter Fluffy_Pillow 70.8/124: 57% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:46.657 breath U obliterate Fluffy_Pillow 44.8/124: 36% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), corrupting_rage
4:47.938 breath S howling_blast Fluffy_Pillow 46.8/124: 38% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
4:49.220 breath V obliterate Fluffy_Pillow 41.8/124: 34% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
4:50.501 breath S howling_blast Fluffy_Pillow 43.8/124: 35% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
4:51.782 single_target r obliterate Fluffy_Pillow 15.8/124: 13% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), corrupting_rage
4:53.064 single_target t arcane_torrent Fluffy_Pillow 40.8/124: 33% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3)
4:54.344 cooldowns g pillar_of_frost Fluffy_Pillow 65.8/124: 53% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3)
4:54.344 single_target u frost_strike Fluffy_Pillow 65.8/124: 53% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3)
4:55.626 single_target u frost_strike Fluffy_Pillow 35.8/124: 29% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3)
4:56.908 single_target o obliterate Fluffy_Pillow 12.0/124: 10% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria
4:58.190 single_target p howling_blast Fluffy_Pillow 43.0/124: 35% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
4:59.473 single_target o obliterate Fluffy_Pillow 53.0/124: 43% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5770 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3848 0 16538 15751 9278
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 330760 315020 0
Runic Power 124 124 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 30.85% 24.64% 2995
Haste 11.86% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 6058 5598 0
Mastery 45.29% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +923 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +111 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +519 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h

# Executed every time the actor is available.
actions=auto_attack
# Choose Action list to run
actions+=/call_action_list,name=variables
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&cooldown.empower_rune_weapon.charges<1&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains>10|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# High Priority Actions Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
actions.high_prio_actions=invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions.high_prio_actions+=/mind_freeze,if=target.debuff.casting.react
actions.high_prio_actions+=/antimagic_shell,if=runic_power.deficit>40
actions.high_prio_actions+=/antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up&cooldown.empower_rune_weapon.charges<2|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up)
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions.high_prio_actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions.high_prio_actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions.high_prio_actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions.high_prio_actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/howling_blast,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&buff.rime.react
actions.obliteration+=/frost_strike,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd
actions.obliteration+=/glacial_advance,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!death_knight.runeforge.razorice&!buff.killing_machine.react&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(rune<2|variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&!buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frost_strike,if=buff.killing_machine.stack<2&runic_power.deficit<20&!variable.2h_check
actions.single_target+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=set_bonus.tier30_4pc&(talent.fatal_fixation&buff.killing_machine.stack>1&buff.killing_machine.react)|(!talent.fatal_fixation&buff.killing_machine.react)
actions.single_target+=/obliterate,if=!set_bonus.tier30_4pc&buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets
actions.trinkets=use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(talent.obliteration&cooldown.empower_rune_weapon.charges<1|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(talent.obliteration&cooldown.empower_rune_weapon.charges<1|!talent.obliteration)&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

# Variables
actions.variables=variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions.variables+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions.variables+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions.variables+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
actions.variables+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up&(talent.obliteration&cooldown.empower_rune_weapon.charges<1|!talent.obliteration)|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions.variables+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions.variables+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions.variables+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=3,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions.variables+=/variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions.variables+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=9278
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 49718 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
49717.6 49717.6 43.4 / 0.087% 7195.3 / 14.5% 3165.0
APS APS Error APS Range APR
170.3 4.0 / 2.322% 451.0 / 264.9% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.9 8.0 Runic Power 1.72% 54.6 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 49718
Apocalypse 217 0.4% 6.9 46.11s 9481 7797 Direct 6.9 7874 15747 9482 20.4%

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.85 6.85 0.00 0.00 0.00 1.2162 0.0000 64955.36 64955.36 0.00% 7796.83 7796.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.58% 5.45 1 8 7874.04 6078 10204 7872.64 6686 9132 42930 42930 0.00%
crit 20.42% 1.40 0 6 15747.44 12278 20289 12465.14 0 20216 22026 22026 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for each burst Festering Wound. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [T]:5.85
  • if_expr:variable.st_planning&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [X]:1.00
  • if_expr:debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<21|!talent.commander_of_the_dead)
auto_attack_mh 2868 5.8% 154.4 2.34s 5569 2397 Direct 154.4 4628 9250 5569 20.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 154.41 154.41 0.00 0.00 0.00 2.3233 0.0000 859982.92 1228578.35 30.00% 2397.13 2397.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.64% 122.97 81 171 4628.05 3725 6467 4627.37 4371 4837 569116 813044 30.00%
crit 20.36% 31.44 12 55 9250.40 7451 12934 9248.74 8472 10120 290867 415534 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 92 0.2% 2.0 0.00s 13670 0 Direct 2.0 11258 22345 13670 21.8%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 27342.40 27342.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.24% 1.56 0 3 11257.50 10112 14636 10761.49 0 14636 17617 17617 0.00%
crit 21.76% 0.44 0 2 22344.91 20224 29271 8724.12 0 29271 9726 9726 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}
Clawing Shadows 5869 11.8% 73.3 3.95s 24001 21148 Direct 73.3 19961 39956 24001 20.2%

Stats Details: Clawing Shadows

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 73.30 73.30 0.00 0.00 0.00 1.1349 0.0000 1759336.98 1759336.98 0.00% 21147.91 21147.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.79% 58.49 35 82 19960.99 10396 36033 19976.18 16797 23259 1167518 1167518 0.00%
crit 20.21% 14.81 2 31 39956.31 20463 72065 39980.40 30193 54577 591819 591819 0.00%

Action Details: Clawing Shadows

  • id:207311
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207311
  • name:Clawing Shadows
  • school:shadow
  • tooltip:
  • description:Deals {$s2=0} Shadow damage and causes 1 Festering Wound to burst.

Action Priority List

    generic
    [g]:73.30
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
Dark Transformation 203 0.4% 6.9 46.13s 8758 6904 Direct 6.9 7278 14567 8758 20.3%

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.95 6.95 0.00 0.00 0.00 1.2686 0.0000 60856.57 60856.57 0.00% 6903.75 6903.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.70% 5.54 0 8 7278.19 5438 9372 7274.44 0 8368 40307 40307 0.00%
crit 20.30% 1.41 0 6 14566.64 11963 18744 11493.38 0 18162 20550 20550 0.00%

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [S]:5.95
  • if_expr:cooldown.apocalypse.remains<5
    garg_setup
    [b]:1.00
  • if_expr:talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
Death and Decay 232 0.5% 8.4 37.48s 8323 7474 Direct 90.7 639 1278 769 20.4%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.38 90.65 0.00 0.00 0.00 1.1138 0.0000 69751.44 69751.44 0.00% 7473.64 7473.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.62% 72.17 42 102 639.21 442 934 639.69 583 688 46134 46134 0.00%
crit 20.38% 18.48 5 40 1278.07 933 1868 1278.76 1095 1474 23617 23617 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    garg_setup
    [c]:1.00
  • if_expr:!death_and_decay.ticking&debuff.festering_wound.stack>0
    generic
    [f]:7.38
  • if_expr:!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=10|pet.gargoyle.active&pet.gargoyle.remains>5|pet.army_ghoul.active&pet.army_ghoul.remains>5))&death_knight.fwounded_targets=active_enemies
Death Coil 5627 (7285) 11.3% (14.7%) 99.9 2.97s 21854 18917 Direct 99.8 (235.8) 14036 28050 16887 20.3% (20.3%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 99.86 99.81 0.00 0.00 0.00 1.1552 0.0000 1685472.20 1685472.20 0.00% 18917.07 18917.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 79.50 51 107 14035.50 8993 21748 14042.65 13262 15016 1115815 1115815 0.00%
crit 20.35% 20.31 6 37 28050.49 17986 43495 28059.44 23742 32196 569657 569657 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Priority List

    generic
    [e]:92.78
  • if_expr:!variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
    high_prio_actions
    [k]:7.07
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
    Coil of Devastation 1658 3.3% 0.0 0.00s 0 0 Periodic 136.0 3652 0 3652 0.0% 90.7%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 136.02 136.02 84.88 0.0000 2.0000 496762.69 496762.69 0.00% 1826.09 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 136.02 104 167 3652.16 1349 15442 3658.35 3109 4447 496763 496763 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 730 1.5% 5.5 46.67s 40104 0 Direct 5.5 33373 66746 40135 20.3%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.47 5.47 0.00 0.00 0.00 0.0000 0.0000 219379.36 313407.08 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.74% 4.36 0 6 33373.08 33373 33373 33346.38 0 33373 145450 207792 29.98%
crit 20.26% 1.11 0 6 66746.15 66746 66746 46773.04 0 66746 73929 105616 21.02%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1104 2.2% 25.0 11.98s 13253 11056 Direct 25.0 11002 22006 13253 20.5%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.99 24.99 0.00 0.00 0.00 1.1988 0.0000 331130.86 473056.15 30.00% 11055.75 11055.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.55% 19.88 10 31 11002.12 8211 18050 10991.12 9868 12096 218671 312395 30.00%
crit 20.45% 5.11 0 14 22006.39 16421 36101 21899.72 0 32558 112460 160661 29.87%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [d]:1.60
  • if_expr:debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40
    generic
    [h]:23.39
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
Festering Wound 1880 3.8% 100.7 3.66s 5596 0 Direct 100.7 4650 9299 5596 20.4%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 100.70 100.70 0.00 0.00 0.00 0.0000 0.0000 563571.72 563571.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 80.21 54 110 4650.26 3322 7381 4650.74 4389 4912 372995 372995 0.00%
crit 20.35% 20.49 6 40 9298.66 6643 14563 9299.45 8234 10736 190577 190577 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}
Outbreak 79 0.2% 11.6 27.05s 2034 1720 Direct 11.6 1690 3381 2034 20.3%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.1821 0.0000 23640.57 23640.57 0.00% 1720.31 1720.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.70% 9.26 3 14 1690.46 1216 2496 1691.08 1484 1939 15662 15662 0.00%
crit 20.30% 2.36 0 8 3381.06 2674 4992 3128.16 0 4965 7979 7979 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    high_prio_actions
    [l]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
Soul Reaper 574 (3352) 1.2% (6.8%) 15.6 6.86s 64497 52958 Direct 15.6 (31.2) 9191 18389 11042 20.1% (20.3%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.63 15.63 0.00 0.00 0.00 1.2179 0.0000 172566.44 172566.44 0.00% 52958.05 52958.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.87% 12.48 5 19 9190.98 5751 12644 9191.53 8187 10402 114710 114710 0.00%
crit 20.13% 3.15 0 10 18388.73 11503 24916 17690.19 0 24174 57857 57857 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [W]:15.63
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
    Soul Reaper (_execute) 2778 5.6% 15.6 6.86s 53468 0 Direct 15.6 44366 88764 53469 20.5%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.62 15.62 0.00 0.00 0.00 0.0000 0.0000 835331.08 835331.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.50% 12.42 4 19 44366.20 35109 57609 44375.69 39396 48524 551025 551025 0.00%
crit 20.50% 3.20 0 11 88763.84 72220 115217 86042.87 0 113527 284306 284306 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}
Unholy Assault 198 0.4% 3.6 91.71s 16337 13998 Direct 3.6 13572 27121 16337 20.4%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.63 3.63 0.00 0.00 0.00 1.1671 0.0000 59380.86 59380.86 0.00% 13998.32 13998.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.59% 2.89 0 4 13571.62 11318 16466 13510.98 0 16466 39261 39261 0.00%
crit 20.41% 0.74 0 4 27121.49 22636 32932 15167.18 0 32932 20119 20119 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [V]:3.52
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [a]:0.11
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=21
Virulent Plague 841 1.7% 11.6 27.05s 21701 0 Periodic 99.5 2105 4211 2535 20.4% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.50 99.50 10.62 0.0000 3.0000 252267.76 252267.76 0.00% 845.14 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.57% 79.17 52 106 2105.16 1535 3331 2105.09 1995 2209 166668 166668 0.00%
crit 20.43% 20.33 6 41 4211.26 3039 6662 4210.94 3780 4685 85600 85600 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.125000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.
pet - ghoul 6291 / 6291
auto_attack 4511 9.1% 195.4 1.53s 6911 4513 Direct 195.4 5747 11476 6911 20.3%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 195.39 195.39 0.00 0.00 0.00 1.5312 0.0000 1350352.78 1929124.59 30.00% 4513.50 4513.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.68% 155.68 111 202 5746.79 2022 12252 5755.53 5110 6458 894683 1278151 30.00%
crit 20.32% 39.71 17 71 11476.22 4044 24174 11497.19 6809 15729 455670 650973 30.00%

Action Details: Auto Attack

  • id:0
  • school:none
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:1.00
Claw 336 0.7% 38.0 8.04s 2659 2647 Direct 38.0 2210 4420 2659 20.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.00 38.00 0.00 0.00 0.00 1.0045 0.0000 101036.17 144341.06 30.00% 2647.28 2647.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.69% 30.28 14 46 2210.34 1820 7875 2207.95 2022 2411 66923 95606 30.00%
crit 20.31% 7.72 0 20 4419.83 3639 14880 4414.70 0 5581 34114 48735 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:37.99
  • if_expr:energy>70
Gnaw 1 0.0% 3.7 90.15s 95 94 Direct 3.7 78 157 95 20.6%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0045 0.0000 353.12 504.47 30.00% 94.27 94.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.36% 2.96 0 4 78.41 64 101 78.11 0 96 232 332 29.89%
crit 20.64% 0.77 0 4 157.19 129 195 91.36 0 195 121 173 17.43%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:3.73
Sweeping Claws 1443 2.9% 69.3 4.22s 6225 6197 Direct 69.3 5170 10333 6225 20.4%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 69.32 69.32 0.00 0.00 0.00 1.0045 0.0000 431534.82 431534.82 0.00% 6197.10 6197.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.57% 55.16 37 75 5170.22 3899 7877 5172.73 4838 5504 285190 285190 0.00%
crit 20.43% 14.16 3 30 10332.50 7798 15541 10338.12 8921 12214 146345 146345 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:69.32
pet - gargoyle 27334 / 4615
Gargoyle Strike 27334 9.2% 32.0 6.62s 42711 32004 Direct 32.0 35522 70960 42712 20.3%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.00 32.00 0.00 0.00 0.00 1.3346 0.0000 1366682.07 1366682.07 0.00% 32003.61 32003.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.71% 25.51 17 32 35521.97 9915 79795 35524.32 28228 43553 906035 906035 0.00%
crit 20.29% 6.49 0 15 70960.12 19830 154276 71029.00 0 133361 460648 460648 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.
pet - army_ghoul 26057 / 5762
auto_attack 21810 9.6% 366.8 0.66s 3895 3552 Direct 366.8 3237 6468 3895 20.3%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 366.80 366.80 0.00 0.00 0.00 1.0963 0.0000 1428522.32 2040798.21 30.00% 3552.35 3552.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.65% 292.16 245 326 3237.03 1587 4388 3236.74 2820 3479 945735 1351085 30.00%
crit 20.35% 74.64 43 110 6467.95 3175 8658 6466.63 5500 7112 482787 689713 30.00%

Action Details: Auto Attack

  • id:0
  • school:none
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:2.00
Claw 4248 1.9% 219.9 1.21s 1265 1265 Direct 219.9 1051 2101 1265 20.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 219.90 219.90 0.00 0.00 0.00 1.0000 0.0000 278212.75 397456.92 30.00% 1265.21 1265.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.64% 175.11 145 197 1051.47 530 1447 1051.39 922 1126 184128 263046 30.00%
crit 20.36% 44.78 23 72 2101.00 1061 2893 2100.67 1655 2341 94085 134411 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:27.38
    default
    [ ]:27.22
    default
    [ ]:27.20
    default
    [ ]:30.26
    default
    [ ]:26.96
    default
    [ ]:26.96
    default
    [ ]:26.96
    default
    [ ]:26.96
pet - magus_of_the_dead 7485 / 3789
Frostbolt 1487 1.5% 27.9 10.79s 8059 5560 Direct 27.9 6711 13396 8062 20.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.90 27.89 0.00 0.00 0.00 1.4496 0.0000 224830.21 224830.21 0.00% 5559.74 5559.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.78% 22.25 11 31 6711.28 3697 9806 6712.81 6074 7480 149314 149314 0.00%
crit 20.22% 5.64 0 14 13395.83 7394 19341 13375.65 0 18796 75516 75516 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:13.96
    default
    [ ]:14.04
Shadow Bolt 5998 6.1% 112.3 2.60s 8059 6376 Direct 112.3 6700 13395 8062 20.3%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.32 112.28 0.00 0.00 0.00 1.2640 0.0000 905175.46 905175.46 0.00% 6375.82 6375.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.66% 89.45 66 112 6699.99 3477 9478 6702.33 6180 7230 599286 599286 0.00%
crit 20.34% 22.84 7 42 13394.68 6953 18955 13398.35 11340 15643 305889 305889 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:60.40
    default
    [ ]:60.67
pet - apoc_ghoul 9765 / 4312
auto_attack 7978 7.1% 290.8 3.84s 3627 2676 Direct 290.8 3015 6030 3627 20.3%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 290.78 290.78 0.00 0.00 0.00 1.3553 0.0000 1054815.53 1506917.76 30.00% 2676.46 2676.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.68% 231.68 166 300 3014.56 1742 4329 3017.29 2771 3253 698417 997765 30.00%
crit 20.32% 59.10 28 97 6030.29 3484 8658 6035.06 5408 6688 356398 509153 30.00%

Action Details: Auto Attack

  • id:0
  • school:none
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:6.76
Claw 1787 1.6% 198.3 5.69s 1191 1191 Direct 198.3 990 1980 1191 20.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 198.32 198.32 0.00 0.00 0.00 1.0000 0.0000 236237.03 337490.08 30.00% 1191.20 1191.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.70% 158.06 111 208 990.20 582 1447 991.11 910 1072 156516 223600 30.00%
crit 20.30% 40.26 16 66 1980.40 1164 2893 1982.22 1756 2194 79721 113890 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:49.58
    default
    [ ]:49.58
    default
    [ ]:49.58
    default
    [ ]:49.58
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 0
Anti-Magic Shell 168 99.0% 7.1 44.54s 7130 0 Direct 3.2 15824 0 15824 0.0%

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 7.08 3.19 0.00 0.00 0.00 0.0000 0.0000 50491.29 50491.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.19 0 15 15823.90 15824 15824 13568.16 0 15824 50491 50491 0.00%

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    default
    [G]:7.08
  • if_expr:runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Algeth'ar Puzzle (_box_channel) 2.0 0.00s

Stats Details: Algethar Puzzle Box Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 2.00 0.00 0.00 1.5585 1.5585 0.00 0.00 0.00% 0.00 0.00

Action Details: Algethar Puzzle Box Channel

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
Army of the Dead 2.0 0.00s

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6619 0.4688 0.00 0.00 0.00% 0.00 0.00

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    high_prio_actions
    [j]:1.00
  • if_expr:talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 184.45s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [m]:2.00
  • if_expr:(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
Empower Rune Weapon 2.4 169.53s

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.38 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [U]:2.26
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=21|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
    garg_setup
    [Z]:0.11
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=21
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Outbreak (_aoe) 11.6 27.05s

Stats Details: Outbreak Aoe

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Outbreak Aoe

  • id:196780
  • school:shadow
  • range:200.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196780
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:{$@spelldesc77575=Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}}
Elemental Potion of Ultimate Power 1.5 0.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    high_prio_actions
    [i]:1.50
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Raise Dead 1.0 0.00s

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
Summon Gargoyle 2.0 185.43s

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [R]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead
    garg_setup
    [Y]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
Unholy Strength 21.9 13.38s

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 21.89 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 181.8s 181.8s 30.0s 20.27% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1411.05

Trigger Details

  • interval_min/max:181.8s / 182.3s
  • trigger_min/max:181.8s / 182.3s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s
  • uptime_min/max:16.67% / 25.00%

Stack Uptimes

  • algethar_puzzle_1:20.27%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Anti-Magic Shell 7.1 0.0 44.6s 44.6s 6.9s 16.39% 18.60% 0.0 (0.0) 7.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 106.1s
  • trigger_min/max:40.0s / 106.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:12.71% / 17.75%

Stack Uptimes

  • antimagic_shell_1:16.39%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Berserking 2.0 0.0 184.4s 184.4s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 188.6s
  • trigger_min/max:180.0s / 188.6s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Commander of the Dead 6.9 0.0 46.1s 46.1s 28.6s 66.15% 90.31% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 57.2s
  • trigger_min/max:45.0s / 57.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:62.73% / 69.02%

Stack Uptimes

  • commander_of_the_dead_1:66.15%

Spelldata

  • id:390260
  • name:Commander of the Dead
  • tooltip:Your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead ghouls deal {$390264s1=35}% increased damage.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.0s 58.6s 50.0s 80.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 351.0s
  • trigger_min/max:15.0s / 309.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.2s
  • uptime_min/max:42.99% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.14%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Transformation 6.9 0.0 46.1s 46.1s 22.6s 52.39% 58.57% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 57.2s
  • trigger_min/max:45.0s / 57.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.0s
  • uptime_min/max:47.20% / 59.01%

Stack Uptimes

  • dark_transformation_1:52.39%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Dragon Games Equipment 2.7 0.0 120.0s 120.0s 0.7s 0.62% 0.00% 5.5 (5.5) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.75
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.0s
  • trigger_min/max:120.0s / 120.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.7s
  • uptime_min/max:0.45% / 0.82%

Stack Uptimes

  • dragon_games_equipment_1:0.62%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 300.3s 0.0s 27.5s 13.46% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 327.6s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.98% / 18.18%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.46%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 169.4s 169.4s 19.3s 15.22% 0.00% 6.9 (6.9) 2.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 189.6s
  • trigger_min/max:120.0s / 189.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:12.59% / 18.04%

Stack Uptimes

  • empower_rune_weapon_1:15.22%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Festermight 13.1 67.0 23.2s 3.7s 19.3s 84.26% 0.00% 0.0 (0.0) 12.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 45.5s
  • trigger_min/max:0.8s / 26.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:73.65% / 92.81%

Stack Uptimes

  • festermight_1:7.73%
  • festermight_2:8.15%
  • festermight_3:8.64%
  • festermight_4:15.98%
  • festermight_5:10.84%
  • festermight_6:9.93%
  • festermight_7:7.76%
  • festermight_8:5.54%
  • festermight_9:4.20%
  • festermight_10:2.55%
  • festermight_11:1.27%
  • festermight_12:0.78%
  • festermight_13:0.50%
  • festermight_14:0.32%
  • festermight_15:0.07%
  • festermight_16:0.00%
  • festermight_17:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 98.8 161.5s 3.0s 293.1s 98.53% 0.00% 96.8 (96.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:46.7s / 321.7s
  • trigger_min/max:0.8s / 15.9s
  • trigger_pct:100.00%
  • duration_min/max:23.9s / 355.6s
  • uptime_min/max:96.65% / 98.80%

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.85%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 12.1 8.3 24.6s 14.2s 10.7s 43.04% 0.00% 8.3 (8.3) 11.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 147.4s
  • trigger_min/max:0.8s / 145.7s
  • trigger_pct:15.03%
  • duration_min/max:0.0s / 61.4s
  • uptime_min/max:16.16% / 70.69%

Stack Uptimes

  • rune_mastery_1:43.04%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 41.8 6.2 7.1s 6.2s 2.6s 36.38% 0.00% 6.2 (6.2) 41.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 83.3s
  • trigger_min/max:0.8s / 83.3s
  • trigger_pct:48.09%
  • duration_min/max:0.0s / 22.0s
  • uptime_min/max:21.32% / 51.04%

Stack Uptimes

  • runic_corruption_1:36.38%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 21.2 0.2 13.8s 13.7s 1.0s 7.19% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.3s / 57.0s
  • trigger_min/max:1.3s / 57.0s
  • trigger_pct:14.25%
  • duration_min/max:0.0s / 7.8s
  • uptime_min/max:1.84% / 15.11%

Stack Uptimes

  • sudden_doom_1:7.19%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.6 0.0 91.7s 91.7s 19.5s 23.66% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.8s
  • trigger_min/max:90.0s / 97.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.95% / 26.59%

Stack Uptimes

  • unholy_assault_1:23.66%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Ground 8.4 0.0 37.5s 37.5s 9.8s 27.43% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 93.4s
  • trigger_min/max:10.0s / 93.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.8s
  • uptime_min/max:21.53% / 33.91%

Stack Uptimes

  • unholy_ground_1:27.43%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 13.4 36.1s 13.4s 24.7s 69.57% 0.00% 13.4 (13.4) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 171.0s
  • trigger_min/max:0.0s / 59.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 163.6s
  • uptime_min/max:45.66% / 91.28%

Stack Uptimes

  • unholy_strength_1:69.57%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 184.4s 184.4s 24.5s 98.06% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.3s / 188.5s
  • trigger_min/max:181.3s / 188.5s
  • trigger_pct:100.00%
  • duration_min/max:24.0s / 25.0s
  • uptime_min/max:98.05% / 98.06%

Stack Uptimes

  • dark_empowerment_1:98.06%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 25.7 9.0 50.0 11.4s 1.3s 135.7s
Rune ready 158.0 116.0 203.0 2.0s 0.0s 13.5s
Runic Corruption from Runic Power Spent 48.0 23.0 73.0 6.2s 0.8s 83.3s
Festering Wound from Festering Strike 62.4 40.0 87.0 12.0s 1.1s 67.1s
Festering Wound from Infected Claws 32.2 11.0 55.0 9.2s 1.0s 97.6s
Festering Wound from Unholy Assault 14.5 12.0 16.0 91.7s 90.0s 97.8s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 3.05% 0.00% 13.87% 2.0s 0.0s 18.2s
ghoul - Energy Cap 0.53% 0.03% 1.56% 0.2s 0.0s 1.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Raise Dead0.0000.0000.000299.999240.015359.992
Army of the Dead3.8930.000142.5417.7870.000142.541
Summon Gargoyle4.3972.2739.5078.7945.67212.857
Apocalypse2.1630.00011.63014.8658.47429.065
Unholy Assault3.7420.0009.24713.6038.56318.783
Dark Transformation1.4560.00012.22210.1274.49624.449
Empower Rune Weapon32.4750.00069.57977.20569.945100.317
Death and Decay7.0540.00063.35861.22435.817111.248
Soul Reaper13.0510.000233.495206.317156.911253.416

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=317606)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1101.891 / 1.1136.49922.733
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
33.17056.49580.060 / 79.213106.977139.412

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
Anti-Magic ShellRunic Power3.1915.880.67%4.980.070.44%
ApocalypseRune13.7012.547.93%0.921.168.49%
Empower Rune WeaponRunic Power11.3956.632.37%4.970.330.57%
Empower Rune WeaponRune11.3910.116.39%0.891.2911.29%
Festering WoundRunic Power100.70294.2712.32%2.927.842.59%
Rune RegenerationRune135.40135.4085.67%1.000.000.00%
Runic AttenuationRunic Power75.36366.0615.33%4.8610.722.85%
Army of the DeadRunic Power2.0019.770.83%9.890.231.14%
Clawing ShadowsRunic Power73.30716.2030.00%9.7716.802.29%
Death and DecayRunic Power8.3882.323.45%9.821.481.77%
Festering StrikeRunic Power24.99482.5920.21%19.3117.133.43%
OutbreakRunic Power11.62113.004.73%9.723.252.80%
Soul ReaperRunic Power15.63149.446.26%9.566.834.37%
Summon GargoyleRunic Power2.0091.543.83%45.778.468.46%
pet - ghoul
Dark TransformationEnergy6.95336.917.97%48.48357.9751.52%
energy_regenEnergy1332.983888.1992.03%2.9229.090.74%
pet - army_ghoul
energy_regenEnergy916.947531.30100.00%8.21770.049.28%
pet - apoc_ghoul
energy_regenEnergy729.825814.50100.00%7.971757.1923.21%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.24%1.001.000.00
Clawing ShadowsRune 73.3073.3045.56%1.001.0024001.58
Death and DecayRune 8.388.385.21%1.001.008323.08
Death CoilRunic Power 99.862361.92100.00%23.6523.65923.92
Festering StrikeRune 24.9949.9731.06%2.002.006626.33
OutbreakRune 11.6211.627.22%1.001.002033.62
Soul ReaperRune 15.6315.639.71%1.001.0064496.71
pet - ghoul
ClawEnergy 37.991519.7635.40%40.0040.0066.48
Sweeping ClawsEnergy 69.322773.0064.60%40.0040.00155.62
pet - army_ghoul
ClawEnergy 219.898795.80100.00%40.0040.0031.63
pet - apoc_ghoul
ClawEnergy 198.327932.85100.00%40.0040.0029.78
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 327940.0 766.69 873.29 286798.0 295959.9 -37251.2 327940.0
Runic Power 8.0 7.96 7.88 73.1 23.8 0.0 75.0
Rune 5.0 0.53 0.54 0.0 3.1 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 49717.64
Minimum 44187.80
Maximum 55955.31
Spread ( max - min ) 11767.51
Range [ ( max - min ) / 2 * 100% ] 11.83%
Standard Deviation 1917.4735
5th Percentile 46889.11
95th Percentile 53200.70
( 95th Percentile - 5th Percentile ) 6311.60
Mean Distribution
Standard Deviation 22.1426
95.00% Confidence Interval ( 49674.24 - 49761.04 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 58
0.1% Error 5714
0.1 Scale Factor Error with Delta=300 31387
0.05 Scale Factor Error with Delta=300 125546
0.01 Scale Factor Error with Delta=300 3138647
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 49717.64
Minimum 44187.80
Maximum 55955.31
Spread ( max - min ) 11767.51
Range [ ( max - min ) / 2 * 100% ] 11.83%
Standard Deviation 1917.4735
5th Percentile 46889.11
95th Percentile 53200.70
( 95th Percentile - 5th Percentile ) 6311.60
Mean Distribution
Standard Deviation 22.1426
95.00% Confidence Interval ( 49674.24 - 49761.04 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 58
0.1% Error 5714
0.1 Scale Factor Error with Delta=300 31387
0.05 Scale Factor Error with Delta=300 125546
0.01 Scale Factor Error with Delta=300 3138647
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 49717.64
Minimum 44187.80
Maximum 55955.31
Spread ( max - min ) 11767.51
Range [ ( max - min ) / 2 * 100% ] 11.83%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 7481729.20
Minimum 5515637.21
Maximum 9373987.78
Spread ( max - min ) 3858350.58
Range [ ( max - min ) / 2 * 100% ] 25.79%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 873.42
Minimum 0.00
Maximum 2465.72
Spread ( max - min ) 2465.72
Range [ ( max - min ) / 2 * 100% ] 141.15%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 765.39
Minimum 0.00
Maximum 2061.83
Spread ( max - min ) 2061.83
Range [ ( max - min ) / 2 * 100% ] 134.69%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2
6 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
7 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
A 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
B 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
E 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Default action list Executed every time the actor is available.
# count action,conditions
F 1.00 auto_attack
0.00 mind_freeze,if=target.debuff.casting.react
G 7.08 antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
0.00 antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle)
0.00 variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
Variables
0.00 variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle|time>20
0.00 variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
0.00 variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
0.00 variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4)|fight_remains<5&debuff.festering_wound.stack>=1
0.00 variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
0.00 variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
0.00 variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
0.00 invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=20|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))|fight_remains<=21
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
H 0.00 call_action_list,name=high_prio_actions
Call Action Lists
I 0.00 call_action_list,name=trinkets
J 0.00 run_action_list,name=garg_setup,if=variable.garg_setup=0
K 0.00 call_action_list,name=cooldowns,if=variable.st_planning
L 0.00 call_action_list,name=aoe_cooldowns,if=variable.adds_remain
M 0.00 call_action_list,name=racials
N 0.00 call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
O 0.00 call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
P 0.00 call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
Q 0.00 call_action_list,name=generic,if=active_enemies<=3
actions.cooldowns
# count action,conditions
R 1.00 summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
ST/Cleave Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
S 5.95 dark_transformation,if=cooldown.apocalypse.remains<5
T 5.85 apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
U 2.26 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=21|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 abomination_limb,if=rune<3&variable.st_planning
V 3.52 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
W 15.63 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.garg_setup
# count action,conditions
X 1.00 apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<21|!talent.commander_of_the_dead)
Garg Setup
0.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
0.00 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
Y 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
Z 0.11 empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=21
a 0.11 unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=21
0.00 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
b 1.00 dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
c 1.00 any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>0
d 1.60 festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40
0.00 death_coil,if=rune<=1
actions.generic
# count action,conditions
e 92.78 death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
Generic
0.00 epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
f 7.38 any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=10|pet.gargoyle.active&pet.gargoyle.remains>5|pet.army_ghoul.active&pet.army_ghoul.remains>5))&death_knight.fwounded_targets=active_enemies
g 73.30 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
h 23.39 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 death_coil
actions.high_prio_actions
# count action,conditions
i 1.50 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Priority Actions
j 1.00 army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
k 7.07 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
l 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
m 2.00 berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.trinkets
# count action,conditions
n 2.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
Trinkets
0.00 use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<13|!talent.summon_gargoyle&pet.army_ghoul.active)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
o 2.74 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
0.00 use_item,use_off_gcd=1,slot=main_hand,if=(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFilndcbYkkkGkZaXeeggefgehmgeglegeghegeggeghgeoeggehgegeeehelGhSeehTfgghkeeggegelgehegeggehgGeggeeSeVhlTfggkgheegegheegggegheleGeeggeghegeSghTfgkogglegegheegegheeggeheegnjlfeSRkkGkVTUWefgeegWmehegeglWeheggeWgggeWegheWehGgelSWeTfgWeegeWgheeWegelWeggeWogGeghWegSeVTWfleeeWeggege

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 4 raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 5 army_of_the_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 6 trinket_1_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat 7 trinket_2_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat A trinket_1_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat B trinket_2_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat E trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
0:00.000 default F auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
0:00.000 high_prio_actions i potion Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, corrupting_rage
0:00.000 high_prio_actions l outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 trinkets n use_item_algethar_puzzle_box Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, corrupting_rage, elemental_potion_of_ultimate_power
0:01.359 garg_setup d festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:02.379 garg_setup c death_and_decay Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:03.400 garg_setup b dark_transformation Fluffy_Pillow 48.0/100: 48% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_ground, sudden_doom, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:03.400 garg_setup Y summon_gargoyle Fluffy_Pillow 48.0/100: 48% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_ground, dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:04.373 high_prio_actions k death_coil Fluffy_Pillow 98.0/100: 98% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_ground, dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:05.346 high_prio_actions k death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.318 high_prio_actions k death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons(2), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.292 default G antimagic_shell PR_Death_Knight_Unholy 45.0/100: 45% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.292 high_prio_actions k death_coil Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:08.265 garg_setup Z empower_rune_weapon Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:08.265 garg_setup a unholy_assault Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.110 garg_setup X apocalypse Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.865 generic e death_coil Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:10.620 generic e death_coil Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:11.374 generic g clawing_shadows Fluffy_Pillow 2.0/100: 2% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:12.131 generic g clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:12.886 generic e death_coil Fluffy_Pillow 33.0/100: 33% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.640 generic f death_and_decay Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:14.395 generic g clawing_shadows Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:15.150 generic e death_coil Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:15.903 generic h festering_strike Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:16.658 racials m berserking Fluffy_Pillow 26.0/100: 26% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:16.658 generic g clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:17.412 generic e death_coil Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune
bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:18.166 generic g clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:18.921 high_prio_actions l outbreak Fluffy_Pillow 37.0/100: 37% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:19.675 generic e death_coil Fluffy_Pillow 47.0/100: 47% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:20.429 generic g clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:21.183 generic e death_coil Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:21.936 generic g clawing_shadows Fluffy_Pillow 5.0/100: 5% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:22.691 generic h festering_strike Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:23.444 generic e death_coil Fluffy_Pillow 48.0/100: 48% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:24.197 generic g clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:24.951 generic e death_coil Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:25.706 generic g clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:26.462 generic g clawing_shadows Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:27.218 generic e death_coil Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:27.973 generic g clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:28.727 generic h festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(15), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:29.747 generic g clawing_shadows Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:30.765 generic e death_coil Fluffy_Pillow 63.0/100: 63% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, algethar_puzzle, corrupting_rage
0:31.440 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, corrupting_rage
0:31.787 generic e death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, dragon_games_equipment, corrupting_rage
0:32.807 generic g clawing_shadows Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, corrupting_rage
0:33.827 generic g clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, icy_talons(3), dark_transformation, festermight(2), corrupting_rage
0:34.849 generic e death_coil Fluffy_Pillow 39.0/100: 39% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, icy_talons(3), festermight(3), corrupting_rage
0:35.868 generic h festering_strike Fluffy_Pillow 9.0/100: 9% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, icy_talons(3), festermight(3), corrupting_rage
0:36.889 generic g clawing_shadows Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, icy_talons(3), festermight(3), corrupting_rage
0:37.908 generic e death_coil Fluffy_Pillow 47.0/100: 47% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, icy_talons(3), festermight(4), corrupting_rage
0:38.929 Waiting     0.371s 17.0/100: 17% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
0:39.300 generic g clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
0:40.319 generic e death_coil Fluffy_Pillow 35.0/100: 35% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), sudden_doom, festermight(5), corrupting_rage
0:41.646 generic e death_coil Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
0:42.972 generic e death_coil Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, sudden_doom, festermight(5), corrupting_rage
0:44.299 generic h festering_strike Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, festermight(5), corrupting_rage
0:45.623 generic e death_coil Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(5), corrupting_rage
0:46.948 high_prio_actions l outbreak Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
0:48.274 default G antimagic_shell PR_Death_Knight_Unholy 45.0/100: 45% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
0:48.274 generic h festering_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
0:49.598 cooldowns S dark_transformation Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
0:50.924 generic e death_coil Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:52.250 generic e death_coil Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, corrupting_rage
0:53.575 generic h festering_strike Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:54.900 cooldowns T apocalypse Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:56.225 generic f death_and_decay Fluffy_Pillow 47.0/100: 47% runic_power
6.0/6: 100% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
0:57.550 generic g clawing_shadows Fluffy_Pillow 57.0/100: 57% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
0:58.812 generic g clawing_shadows Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
1:00.075 generic h festering_strike Fluffy_Pillow 88.0/100: 88% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
1:01.337 high_prio_actions k death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
1:02.598 generic e death_coil Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
1:03.861 generic e death_coil Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
1:05.123 generic g clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
1:06.385 generic g clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead
1:07.711 generic e death_coil Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead
1:09.036 generic g clawing_shadows Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead
1:10.360 Waiting     1.313s 29.0/100: 29% runic_power
1.0/6: 17% rune
icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead
1:11.673 generic e death_coil Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune
icy_talons(3), sudden_doom, festermight(9), commander_of_the_dead
1:12.998 high_prio_actions l outbreak Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, festermight(9), commander_of_the_dead
1:14.323 generic g clawing_shadows Fluffy_Pillow 39.0/100: 39% runic_power
3.0/6: 50% rune
icy_talons(3), festermight(9), commander_of_the_dead, corrupting_rage
1:15.648 generic e death_coil Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune
icy_talons(3), commander_of_the_dead, corrupting_rage
1:16.973 generic h festering_strike Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, commander_of_the_dead, corrupting_rage
1:18.298 generic e death_coil Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune
icy_talons(3), commander_of_the_dead, corrupting_rage
1:19.624 generic g clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, corrupting_rage
1:20.951 generic e death_coil Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight, corrupting_rage
1:22.277 generic g clawing_shadows Fluffy_Pillow 0.0/100: 0% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight, corrupting_rage
1:23.601 generic g clawing_shadows Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
1:24.926 generic e death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
1:26.252 generic h festering_strike Fluffy_Pillow 1.0/100: 1% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
1:27.576 generic g clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
1:28.902 default G antimagic_shell PR_Death_Knight_Unholy 34.0/100: 34% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(4), corrupting_rage
1:28.902 generic e death_coil Fluffy_Pillow 34.0/100: 34% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
1:30.227 generic g clawing_shadows Fluffy_Pillow 4.0/100: 4% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
1:31.553 generic g clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
1:32.879 generic e death_coil Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
1:34.204 generic e death_coil Fluffy_Pillow 10.0/100: 10% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), sudden_doom, festermight(6), corrupting_rage
1:35.530 cooldowns S dark_transformation Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
1:36.856 generic e death_coil Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, corrupting_rage
1:38.181 cooldowns V unholy_assault Fluffy_Pillow 10.0/100: 10% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
1:39.590 generic h festering_strike Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
1:40.695 high_prio_actions l outbreak Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
1:41.801 cooldowns T apocalypse Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
1:42.906 generic f death_and_decay Fluffy_Pillow 62.0/100: 62% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:44.013 generic g clawing_shadows Fluffy_Pillow 72.0/100: 72% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, corrupting_rage
1:45.066 generic g clawing_shadows Fluffy_Pillow 90.0/100: 90% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
1:46.118 high_prio_actions k death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
1:47.170 generic g clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
1:48.222 generic h festering_strike Fluffy_Pillow 88.0/100: 88% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:49.275 generic e death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:50.328 generic e death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:51.380 generic g clawing_shadows Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:52.433 generic e death_coil Fluffy_Pillow 53.0/100: 53% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, corrupting_rage
1:53.487 generic g clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, corrupting_rage
1:54.591 generic h festering_strike Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, corrupting_rage
1:55.697 generic e death_coil Fluffy_Pillow 56.0/100: 56% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(9), commander_of_the_dead, corrupting_rage
1:56.803 generic e death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(9), commander_of_the_dead, corrupting_rage
1:57.909 generic g clawing_shadows Fluffy_Pillow 1.0/100: 1% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, unholy_assault, festermight(9), commander_of_the_dead, corrupting_rage
1:59.014 generic g clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(10), commander_of_the_dead, corrupting_rage
2:00.337 generic g clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(11), commander_of_the_dead, corrupting_rage
2:01.662 generic e death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(12), commander_of_the_dead, corrupting_rage
2:02.987 generic g clawing_shadows Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, commander_of_the_dead, corrupting_rage
2:04.314 generic h festering_strike Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
2:05.638 generic e death_coil Fluffy_Pillow 73.0/100: 73% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, corrupting_rage
2:06.963 high_prio_actions l outbreak Fluffy_Pillow 48.0/100: 48% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, corrupting_rage
2:08.287 generic e death_coil Fluffy_Pillow 58.0/100: 58% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight, corrupting_rage
2:09.613 default G antimagic_shell PR_Death_Knight_Unholy 33.0/100: 33% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), sudden_doom, festermight, corrupting_rage
2:09.613 generic e death_coil Fluffy_Pillow 33.0/100: 33% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), sudden_doom, festermight, corrupting_rage
2:10.940 generic e death_coil Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight, corrupting_rage
2:12.265 generic g clawing_shadows Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight, corrupting_rage
2:13.590 generic g clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), festermight(2), corrupting_rage
2:14.916 generic e death_coil Fluffy_Pillow 39.0/100: 39% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, icy_talons(3), festermight(3), corrupting_rage
2:16.242 generic g clawing_shadows Fluffy_Pillow 9.0/100: 9% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
2:17.568 generic h festering_strike Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(4), corrupting_rage
2:18.891 generic e death_coil Fluffy_Pillow 47.0/100: 47% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(4), corrupting_rage
2:20.216 generic g clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
2:21.542 generic e death_coil Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(5), corrupting_rage
2:22.869 cooldowns S dark_transformation Fluffy_Pillow 0.0/100: 0% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
2:24.193 generic g clawing_shadows Fluffy_Pillow 0.0/100: 0% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
2:25.518 generic h festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, corrupting_rage
2:26.843 cooldowns T apocalypse Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, corrupting_rage
2:28.169 generic f death_and_decay Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:29.494 generic g clawing_shadows Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:30.757 high_prio_actions k death_coil Fluffy_Pillow 78.0/100: 78% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:31.440 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 48.0/100: 48% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
2:32.019 generic g clawing_shadows Fluffy_Pillow 48.0/100: 48% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, dragon_games_equipment, corrupting_rage
2:33.281 generic g clawing_shadows Fluffy_Pillow 66.0/100: 66% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
2:34.544 high_prio_actions l outbreak Fluffy_Pillow 79.0/100: 79% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, corrupting_rage
2:35.807 generic e death_coil Fluffy_Pillow 94.0/100: 94% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(8), commander_of_the_dead, corrupting_rage
2:37.069 generic g clawing_shadows Fluffy_Pillow 94.0/100: 94% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, corrupting_rage
2:38.331 generic e death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, corrupting_rage
2:39.653 generic g clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(9), commander_of_the_dead, corrupting_rage
2:40.978 generic h festering_strike Fluffy_Pillow 83.0/100: 83% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(10), commander_of_the_dead, corrupting_rage
2:42.303 generic e death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(10), commander_of_the_dead, corrupting_rage
2:43.629 generic e death_coil Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(10), commander_of_the_dead, corrupting_rage
2:44.953 generic g clawing_shadows Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
2:46.280 generic e death_coil Fluffy_Pillow 63.0/100: 63% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
2:47.604 generic g clawing_shadows Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight, commander_of_the_dead, corrupting_rage
2:48.928 generic h festering_strike Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(2), commander_of_the_dead, corrupting_rage
2:50.252 generic e death_coil Fluffy_Pillow 71.0/100: 71% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(2), commander_of_the_dead, corrupting_rage
2:51.579 generic e death_coil Fluffy_Pillow 46.0/100: 46% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(2), commander_of_the_dead, corrupting_rage
2:52.904 generic g clawing_shadows Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), corrupting_rage
2:54.232 generic g clawing_shadows Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3), corrupting_rage
2:55.558 generic e death_coil Fluffy_Pillow 77.0/100: 77% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:56.882 generic h festering_strike Fluffy_Pillow 52.0/100: 52% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:58.208 generic e death_coil Fluffy_Pillow 72.0/100: 72% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:59.535 generic e death_coil Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
3:00.862 generic g clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
3:01.361 trinkets n use_item_algethar_puzzle_box Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
3:03.128 high_prio_actions j army_of_the_dead Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune
icy_talons(3), runic_corruption, festermight(5), algethar_puzzle, corrupting_rage
3:04.454 high_prio_actions l outbreak Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
icy_talons(3), festermight(5), algethar_puzzle, corrupting_rage
3:05.780 generic f death_and_decay Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
icy_talons(3), algethar_puzzle, corrupting_rage
3:07.105 generic e death_coil Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), algethar_puzzle
3:08.367 cooldowns S dark_transformation Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), runic_corruption, algethar_puzzle
3:09.629 cooldowns R summon_gargoyle Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:09.629 high_prio_actions k death_coil Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:10.893 high_prio_actions k death_coil Fluffy_Pillow 60.0/100: 60% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:12.155 default G antimagic_shell PR_Death_Knight_Unholy 30.0/100: 30% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:12.155 high_prio_actions k death_coil Fluffy_Pillow 30.0/100: 30% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:13.418 cooldowns V unholy_assault Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:14.679 cooldowns T apocalypse Fluffy_Pillow 10.0/100: 10% runic_power
6.0/6: 100% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, algethar_puzzle
3:15.732 cooldowns U empower_rune_weapon Fluffy_Pillow 27.0/100: 27% runic_power
6.0/6: 100% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:15.732 cooldowns W soul_reaper Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune
antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:16.647 generic e death_coil Fluffy_Pillow 47.0/100: 47% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:17.608 generic f death_and_decay Fluffy_Pillow 17.0/100: 17% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:18.571 generic g clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:19.489 generic e death_coil Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle
3:20.404 generic e death_coil Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle
3:21.321 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle
3:22.238 cooldowns W soul_reaper Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:23.155 racials m berserking Fluffy_Pillow 53.0/100: 53% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:23.155 generic e death_coil Fluffy_Pillow 53.0/100: 53% runic_power
4.0/6: 67% rune
berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:23.989 generic h festering_strike Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:24.821 generic e death_coil Fluffy_Pillow 48.0/100: 48% runic_power
3.0/6: 50% rune
berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:25.656 generic g clawing_shadows Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:26.488 generic e death_coil Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune
berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:27.320 generic g clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
5.0/6: 83% rune
berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:28.155 high_prio_actions l outbreak Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:29.030 cooldowns W soul_reaper Fluffy_Pillow 34.0/100: 34% runic_power
4.0/6: 67% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:29.903 generic e death_coil Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:30.778 generic h festering_strike Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:31.653 generic e death_coil Fluffy_Pillow 39.0/100: 39% runic_power
2.0/6: 33% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle
3:32.526 generic g clawing_shadows Fluffy_Pillow 9.0/100: 9% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle
3:33.400 generic g clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead
3:34.273 generic e death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(10), commander_of_the_dead
3:35.322 cooldowns W soul_reaper Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead
3:36.476 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead
3:37.802 generic g clawing_shadows Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead
3:39.129 generic g clawing_shadows Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2)
3:40.455 generic e death_coil Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3)
3:41.782 cooldowns W soul_reaper Fluffy_Pillow 39.0/100: 39% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3)
3:43.105 generic e death_coil Fluffy_Pillow 49.0/100: 49% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3)
3:44.430 generic g clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3)
3:45.755 generic h festering_strike Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4)
3:47.080 generic e death_coil Fluffy_Pillow 57.0/100: 57% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:48.405 cooldowns W soul_reaper Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:49.732 generic e death_coil Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:51.055 generic h festering_strike Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:52.379 default G antimagic_shell PR_Death_Knight_Unholy 27.0/100: 27% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:52.379 generic g clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
3:53.704 generic e death_coil Fluffy_Pillow 45.0/100: 45% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
3:55.029 high_prio_actions l outbreak Fluffy_Pillow 15.0/100: 15% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
3:56.353 cooldowns S dark_transformation Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), sudden_doom, festermight(5), corrupting_rage
3:57.679 cooldowns W soul_reaper Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, corrupting_rage
3:59.005 generic e death_coil Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, corrupting_rage
4:00.331 cooldowns T apocalypse Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, corrupting_rage
4:01.653 generic f death_and_decay Fluffy_Pillow 62.0/100: 62% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:02.979 generic g clawing_shadows Fluffy_Pillow 72.0/100: 72% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:04.241 cooldowns W soul_reaper Fluffy_Pillow 85.0/100: 85% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:05.503 generic e death_coil Fluffy_Pillow 95.0/100: 95% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:06.764 generic e death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(5), commander_of_the_dead, corrupting_rage
4:08.026 generic g clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:09.289 generic e death_coil Fluffy_Pillow 83.0/100: 83% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
4:10.553 cooldowns W soul_reaper Fluffy_Pillow 53.0/100: 53% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, corrupting_rage
4:11.815 generic g clawing_shadows Fluffy_Pillow 68.0/100: 68% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
4:13.140 generic h festering_strike Fluffy_Pillow 81.0/100: 81% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
4:14.467 generic e death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
4:15.792 generic e death_coil Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
4:17.116 cooldowns W soul_reaper Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
4:18.442 generic e death_coil Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(7), commander_of_the_dead, corrupting_rage
4:19.768 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(7), commander_of_the_dead, corrupting_rage
4:21.092 generic e death_coil Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
4:22.419 high_prio_actions l outbreak Fluffy_Pillow 13.0/100: 13% runic_power
3.0/6: 50% rune
icy_talons(3), commander_of_the_dead, corrupting_rage
4:23.744 cooldowns W soul_reaper Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
icy_talons(3), commander_of_the_dead, corrupting_rage
4:25.069 generic e death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
icy_talons(3), commander_of_the_dead, corrupting_rage
4:26.395 generic g clawing_shadows Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, corrupting_rage
4:27.719 generic g clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune
icy_talons(3), festermight, corrupting_rage
4:29.045 generic e death_coil Fluffy_Pillow 39.0/100: 39% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(2), corrupting_rage
4:30.372 cooldowns W soul_reaper Fluffy_Pillow 9.0/100: 9% runic_power
3.0/6: 50% rune
icy_talons(3), festermight(2), corrupting_rage
4:31.440 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(2), corrupting_rage
4:31.698 generic g clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(2), dragon_games_equipment, corrupting_rage
4:33.025 default G antimagic_shell PR_Death_Knight_Unholy 32.0/100: 32% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(3), corrupting_rage
4:33.025 generic e death_coil Fluffy_Pillow 32.0/100: 32% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), festermight(3), corrupting_rage
4:34.351 generic g clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
4:35.677 generic h festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), festermight(4), corrupting_rage
4:37.003 cooldowns W soul_reaper Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), festermight(4), corrupting_rage
4:38.327 generic e death_coil Fluffy_Pillow 50.0/100: 50% runic_power
0.0/6: 0% rune
antimagic_shell, icy_talons(3), festermight(4), corrupting_rage
4:39.651 Waiting     0.841s 20.0/100: 20% runic_power
0.0/6: 0% rune
antimagic_shell, icy_talons(3), festermight(4), corrupting_rage
4:40.492 generic g clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(4), corrupting_rage
4:41.816 cooldowns S dark_transformation Fluffy_Pillow 33.0/100: 33% runic_power
0.0/6: 0% rune
icy_talons(3), sudden_doom, festermight(5), corrupting_rage
4:43.140 generic e death_coil Fluffy_Pillow 33.0/100: 33% runic_power
0.0/6: 0% rune
icy_talons(3), dark_transformation, sudden_doom, festermight(5), commander_of_the_dead, corrupting_rage
4:44.467 cooldowns V unholy_assault Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:45.793 cooldowns T apocalypse Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
4:46.898 cooldowns W soul_reaper Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:48.004 generic f death_and_decay Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:49.109 high_prio_actions l outbreak Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:50.162 generic e death_coil Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:51.215 generic e death_coil Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, commander_of_the_dead, corrupting_rage
4:52.267 generic e death_coil Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:53.319 cooldowns W soul_reaper Fluffy_Pillow 35.0/100: 35% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:54.371 generic e death_coil Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:55.423 generic g clawing_shadows Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, corrupting_rage
4:56.476 generic g clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight, commander_of_the_dead, corrupting_rage
4:57.531 generic e death_coil Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
4:58.584 generic g clawing_shadows Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(2), commander_of_the_dead, corrupting_rage
4:59.689 generic e death_coil Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(3), commander_of_the_dead, corrupting_rage

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6095 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3848 0 16397 15616 9166
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 327940 312320 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 21.57% 15.36% 1504
Haste 13.49% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6400 5922 0
Mastery 44.26% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +923 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +923 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.irideus_fragment|trinket.1.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.irideus_fragment|trinket.2.is.vial_of_animated_blood
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze,if=target.debuff.casting.react
actions+=/antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
actions+=/antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle)
# Variables
actions+=/variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
actions+=/variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle|time>20
actions+=/variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
actions+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
actions+=/variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4)|fight_remains<5&debuff.festering_wound.stack>=1
actions+=/variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions+=/variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
actions+=/variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
actions+=/invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=20|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))|fight_remains<=21
# Call Action Lists
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=trinkets
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup=0
actions+=/call_action_list,name=cooldowns,if=variable.st_planning
actions+=/call_action_list,name=aoe_cooldowns,if=variable.adds_remain
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
actions+=/call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
actions+=/call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
actions+=/call_action_list,name=generic,if=active_enemies<=3

# Generic AoE
actions.aoe=epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# AoE Burst
actions.aoe_burst=epidemic,if=(!talent.bursting_sores|rune<1|talent.bursting_sores&debuff.festering_wound.stack=0)&!variable.pooling_runic_power&(active_enemies>=6|runic_power.deficit<30|buff.festermight.stack=20)
actions.aoe_burst+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=1
actions.aoe_burst+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_burst+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe_burst+=/wound_spender

# AoE Cooldowns
actions.aoe_cooldowns=vile_contagion,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.aoe_cooldowns+=/summon_gargoyle
actions.aoe_cooldowns+=/abomination_limb,if=rune<2|buff.festermight.stack>10|!talent.festermight|buff.festermight.up&buff.festermight.remains<12
actions.aoe_cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=talent.bursting_sores&debuff.festering_wound.up&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)|!talent.bursting_sores&debuff.festering_wound.stack>=4
actions.aoe_cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.stack<=2|buff.dark_transformation.up
actions.aoe_cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.aoe_cooldowns+=/dark_transformation,if=(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.aoe_cooldowns+=/empower_rune_weapon,if=buff.dark_transformation.up
actions.aoe_cooldowns+=/sacrificial_pact,if=!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# AoE Setup
actions.aoe_setup=any_dnd,if=(!talent.bursting_sores|death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets>=8|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5)
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies&talent.bursting_sores
actions.aoe_setup+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies
actions.aoe_setup+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=cooldown.apocalypse.remains<variable.apoc_timing&debuff.festering_wound.stack<4
actions.aoe_setup+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# ST/Cleave Cooldowns
actions.cooldowns=summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=cooldown.apocalypse.remains<5
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=21|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)

# Garg Setup
actions.garg_setup=apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<21|!talent.commander_of_the_dead)
actions.garg_setup+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
actions.garg_setup+=/empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=21
actions.garg_setup+=/unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=21
actions.garg_setup+=/potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
actions.garg_setup+=/any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>0
actions.garg_setup+=/festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40
actions.garg_setup+=/death_coil,if=rune<=1

# Generic
actions.generic=death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
actions.generic+=/epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
actions.generic+=/any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=10|pet.gargoyle.active&pet.gargoyle.remains>5|pet.army_ghoul.active&pet.army_ghoul.remains>5))&death_knight.fwounded_targets=active_enemies
actions.generic+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.generic+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.generic+=/death_coil

# Priority Actions
actions.high_prio_actions=potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
actions.high_prio_actions+=/army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
actions.high_prio_actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
actions.high_prio_actions+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
actions.high_prio_actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
actions.racials+=/berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Trinkets
actions.trinkets=use_item,use_off_gcd=1,name=algethar_puzzle_box,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&cooldown.any_dnd.remains<10&!death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=irideus_fragment,if=(pet.gargoyle.active&pet.gargoyle.remains<13|!talent.summon_gargoyle&pet.army_ghoul.active)|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,name=vial_of_animated_blood,if=pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|!talent.apocalypse&buff.dark_transformation.up|active_enemies>3&variable.adds_remain&(buff.dark_transformation.up|talent.bursting_sores&death_and_decay.ticking)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=9166
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 10061 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10060.9 10060.9 7.5 / 0.075% 1304.6 / 13.0% 379.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
26.5 26.0 Mana 0.00% 51.9 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 10061
Mind Spike 6554 65.1% 235.0 1.27s 8360 7146 Direct 235.0 7379 14790 8360 13.2%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 234.99 234.99 0.00 0.00 0.00 1.1698 0.0000 1964504.32 1964504.32 0.00% 7146.33 7146.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.76% 203.87 151 257 7378.51 6607 10224 7379.61 7189 7671 1504284 1504284 0.00%
crit 13.24% 31.12 10 54 14789.75 13214 20448 14792.53 14169 16223 460220 460220 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.656374
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage. |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity.|r

Action Priority List

    filler
    [J]:235.84
Shadow Word: Death 659 6.5% 6.4 10.10s 30999 25572 Direct 6.4 27134 54713 30999 14.0%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.36 6.36 0.00 0.00 0.00 1.2123 0.0000 197236.11 197236.11 0.00% 25571.91 25571.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.99% 5.47 1 8 27134.09 24336 35121 27148.58 24336 31796 148455 148455 0.00%
crit 14.01% 0.89 0 5 54712.89 48673 70241 33633.89 0 70241 48781 48781 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.76

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to the target. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target.{$?=}A364675[ Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][ Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s4=0}/100} Insanity.|r][]

Action Priority List

    filler
    [I]:6.38
  • target_if_expr:target.health.pct<20|buff.deathspeaker.up
Soulseeker Arrow 1035 10.3% 7.1 37.69s 43956 0 Periodic 80.1 3876 0 3876 0.0% 37.8%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.06 0.00 80.10 80.10 2.37 0.0000 1.4170 310449.91 310449.91 0.00% 2735.41 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 80.10 17 168 3875.92 119 4407 3874.03 3799 4067 310450 310450 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3629.20
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1730}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 1814 18.0% 13.5 21.05s 40313 34221 Periodic 127.8 3751 7519 4253 13.3% 99.4%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.49 0.00 127.83 127.83 13.49 1.1780 2.3335 543702.25 543702.25 0.00% 1730.59 34220.94
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.67% 110.78 75 145 3750.96 9 5191 3751.67 3622 3900 415541 415541 0.00%
crit 13.33% 17.05 5 34 7518.56 18 10381 7520.42 6617 8441 128161 128161 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.50
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [M]:13.49
  • if_expr:refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
  • target_if_expr:remains
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 1.0 0.00s

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    cds
    [F]:1.00
  • if_expr:buff.power_infusion.up|fight_remains<=15
Desperate Prayer 1.0 0.00s

Stats Details: Desperate Prayer

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Desperate Prayer

  • id:19236
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19236
  • name:Desperate Prayer
  • school:holy
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=false}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.

Action Priority List

    cds
    [H]:1.00
  • if_expr:health.pct<=75
Phial of Static Empowerment 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.00
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Shadowform 1.0 0.00s

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 1.0 0.00s

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 127.8 2.33s

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 127.83 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 1.0 0.0 0.0s 0.0s 14.4s 4.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.5s / 15.0s
  • uptime_min/max:3.84% / 6.24%

Stack Uptimes

  • blood_fury_1:4.86%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Desperate Prayer 1.0 0.0 0.0s 0.0s 10.0s 3.38% 0.00% 9.0 (9.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_desperate_prayer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.0s / 10.0s
  • uptime_min/max:2.78% / 4.17%

Stack Uptimes

  • desperate_prayer_1:3.38%

Spelldata

  • id:19236
  • name:Desperate Prayer
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=false}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0s 0.0s 29.4s 9.92% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.5s / 30.0s
  • uptime_min/max:8.02% / 12.48%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.92%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0s 0.0s 300.0s 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.1s 45.4s 16.6s 23.76% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 206.3s
  • trigger_min/max:0.0s / 206.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 82.2s
  • uptime_min/max:5.16% / 59.14%

Stack Uptimes

  • sophic_devotion_1:23.76%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.3 0.0 0.0s 0.0s 19.4s 1.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.6s / 20.0s
  • uptime_min/max:0.00% / 8.29%

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:1.65%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.2 0.0 0.0s 0.0s 19.4s 1.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.30%

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:1.63%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.3 0.0 0.0s 0.0s 19.4s 1.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.30%

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:1.65%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.2 0.0 0.0s 0.0s 19.4s 1.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s
  • uptime_min/max:0.00% / 8.31%

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:1.62%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0s 0.0s 300.0s 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:Primary stat is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 95.82% 93.71% 97.50% 45.2s 8.8s 288.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Shadow Word: Death37.9110.000289.421241.212192.931292.185

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
mana_regenMana635.237814.42100.00%12.30471373.4198.37%
Mind SpikeInsanity234.9992.0092.00%0.39847.9690.21%
Shadow Word: DeathInsanity6.360.000.00%0.0025.45100.00%
Vampiric TouchInsanity14.498.008.00%0.5549.9586.19%
Usage Type Count Total Tot% Avg RPE APR
PR_Priest_Shadow
Shadow Word: DeathMana 6.367953.27100.00%1250.001249.9824.80
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 273300.0 393.86 714.74 130355.7 164803.2 -43210.4 252358.2
Mana 49999.0 26.05 26.51 471373.3 49860.1 48749.0 49999.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 10060.88
Minimum 8940.69
Maximum 11295.90
Spread ( max - min ) 2355.21
Range [ ( max - min ) / 2 * 100% ] 11.70%
Standard Deviation 333.0519
5th Percentile 9535.44
95th Percentile 10630.04
( 95th Percentile - 5th Percentile ) 1094.61
Mean Distribution
Standard Deviation 3.8460
95.00% Confidence Interval ( 10053.34 - 10068.41 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4210
0.1 Scale Factor Error with Delta=300 947
0.05 Scale Factor Error with Delta=300 3788
0.01 Scale Factor Error with Delta=300 94691
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 10060.88
Minimum 8940.69
Maximum 11295.90
Spread ( max - min ) 2355.21
Range [ ( max - min ) / 2 * 100% ] 11.70%
Standard Deviation 333.0519
5th Percentile 9535.44
95th Percentile 10630.04
( 95th Percentile - 5th Percentile ) 1094.61
Mean Distribution
Standard Deviation 3.8460
95.00% Confidence Interval ( 10053.34 - 10068.41 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4210
0.1 Scale Factor Error with Delta=300 947
0.05 Scale Factor Error with Delta=300 3788
0.01 Scale Factor Error with Delta=300 94691
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 10060.88
Minimum 8940.69
Maximum 11295.90
Spread ( max - min ) 2355.21
Range [ ( max - min ) / 2 * 100% ] 11.70%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 3015892.59
Minimum 2226601.81
Maximum 3900382.41
Spread ( max - min ) 1673780.60
Range [ ( max - min ) / 2 * 100% ] 27.75%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 716.82
Minimum 468.24
Maximum 1501.15
Spread ( max - min ) 1032.91
Range [ ( max - min ) / 2 * 100% ] 72.05%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 397.82
Minimum 329.21
Maximum 505.12
Spread ( max - min ) 175.91
Range [ ( max - min ) / 2 * 100% ] 22.11%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 shadowform,if=!buff.shadowform.up
5 0.00 arcane_torrent
6 0.00 shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(spell_targets.shadow_crash>1|talent.mental_decay)
7 0.00 vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|spell_targets.shadow_crash=1&!talent.mental_decay|fight_style.dungeonslice
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=holding_crash,op=set,value=raid_event.adds.in<15
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
8 0.00 run_action_list,name=aoe,if=active_enemies>2|spell_targets.vampiric_touch>3
9 0.00 run_action_list,name=main
actions.cds
# count action,conditions
E 1.00 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
TODO: Check VE/DA enter conditions based on dots
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
F 1.00 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
Sync Power Infusion with Voidform or Dark Ascension
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
0.00 dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
G 0.00 call_action_list,name=trinkets
H 1.00 desperate_prayer,if=health.pct<=75
Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.filler
# count action,conditions
0.00 vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
I 6.38 shadow_word_death,target_if=target.health.pct<20|buff.deathspeaker.up
0.00 mind_spike_insanity
0.00 mind_flay,if=buff.mind_flay_insanity.up
0.00 halo,if=raid_event.adds.in>20
Save up to 20s if adds are coming soon.
0.00 shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
0.00 divine_star,if=raid_event.adds.in>10
Save up to 10s if adds are coming soon.
0.00 devouring_plague,if=buff.voidform.up&variable.dots_up
J 235.84 mind_spike
0.00 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 shadow_crash,if=raid_event.adds.in>20
Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 divine_star
Use Divine Star while moving as a low-priority action
0.00 shadow_word_death
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain,target_if=min:remains
Use Shadow Word: Pain while moving as a low-priority action
actions.main
# count action,conditions
K 0.00 call_action_list,name=main_variables
L 0.00 call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|active_enemies>2)
0.00 mindbender,if=variable.dots_up&(fight_remains<30|time_to_die>15)
Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active
0.00 mind_blast,target_if=(dot.devouring_plague.ticking&(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time)|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&active_enemies<=7
High priority Mind Blast action when using Inescapable Torment
0.00 void_bolt,if=variable.dots_up
0.00 devouring_plague,target_if=refreshable|!talent.distorted_reality,if=refreshable&!variable.pool_for_cds|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<(buff.voidform.remains+2)
Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
0.00 shadow_crash,if=!variable.holding_crash&dot.vampiric_touch.refreshable
Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
M 13.49 vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
0.00 mind_spike_insanity,if=variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
High Priority Mind Spike: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available
0.00 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available
0.00 mind_blast,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
0.00 void_torrent,if=!variable.holding_crash,target_if=variable.all_dots_up&dot.devouring_plague.remains>=2
Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
0.00 mindgames,target_if=variable.all_dots_up&dot.devouring_plague.remains>=cast_time
Cast Mindgames if all DoTs will be active by the time the cast finishes
N 0.00 call_action_list,name=filler
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance
0.00 use_item,name=erupting_spear_fragment,if=buff.power_infusion.up|raid_event.adds.up|fight_remains<20
Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
0.00 use_item,name=beacon_to_the_beyond,if=!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20
Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
O 1.00 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex

Sample Sequence

01247JJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJIJJJJMJJIJJJJJJJIHJJJJJMJEIJJJJJJJOIJJJFJJMJIJJJJJJJ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 4 shadowform PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 7 vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment
0:00.000 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity
bloodlust, shadowform, static_empowerment
0:00.939 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
8.0/100: 8% insanity
bloodlust, shadowform, static_empowerment
0:01.878 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity
bloodlust, shadowform, static_empowerment(2)
0:02.818 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
16.0/100: 16% insanity
bloodlust, shadowform, static_empowerment(3)
0:03.758 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
bloodlust, shadowform, static_empowerment(4)
0:04.698 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
bloodlust, shadowform, static_empowerment(5)
0:05.635 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity
bloodlust, shadowform, static_empowerment(5)
0:06.574 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity
bloodlust, shadowform, static_empowerment(5)
0:07.513 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
bloodlust, shadowform, static_empowerment(5)
0:08.452 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
bloodlust, shadowform, static_empowerment(5)
0:09.393 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
bloodlust, shadowform, static_empowerment(5)
0:10.334 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity
bloodlust, shadowform, static_empowerment(5)
0:11.274 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
bloodlust, shadowform, static_empowerment(5)
0:12.213 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
bloodlust, shadowform, static_empowerment(5)
0:13.153 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:14.092 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:15.033 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:15.974 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
72.0/100: 72% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:16.914 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:17.854 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:18.795 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:19.734 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
88.0/100: 88% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:20.674 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
92.0/100: 92% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:21.615 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
96.0/100: 96% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:22.554 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:23.493 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:24.432 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:25.372 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:26.312 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:27.251 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:28.191 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:29.131 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:30.071 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:31.010 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:31.948 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:32.889 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:33.828 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:34.768 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:35.708 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:36.646 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:37.585 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:38.524 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:39.463 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:40.403 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:41.624 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:42.843 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:44.064 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:45.284 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:46.503 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:47.724 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:48.944 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:50.165 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:51.384 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:52.604 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:53.825 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:55.043 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:56.265 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:57.485 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:58.705 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:59.925 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:01.147 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:02.369 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:03.590 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:04.809 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:06.030 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:07.252 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:08.471 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:09.691 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:10.913 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:12.135 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:13.356 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:14.577 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:15.798 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:17.020 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:18.239 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:19.460 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:20.681 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:21.903 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:23.124 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:24.343 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:25.564 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:26.783 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:28.003 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:29.224 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:30.446 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:31.668 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:32.888 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:34.108 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:35.327 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:36.546 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:37.766 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:38.988 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:40.209 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:41.428 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:42.650 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:43.871 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:45.093 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:46.311 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:47.532 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:48.752 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:49.970 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:51.193 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:52.414 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:53.635 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:54.857 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:56.079 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:57.300 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:58.522 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:59.744 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:00.964 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:02.182 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:03.401 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:04.621 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:05.842 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:07.062 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:08.284 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:09.505 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:10.726 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:11.947 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:13.169 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:14.391 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:15.613 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:16.833 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:18.053 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:19.272 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:20.494 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:21.714 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:22.935 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:24.154 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:25.373 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:26.593 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:27.812 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:29.033 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:30.254 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:31.472 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:32.692 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:33.912 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:35.132 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:36.350 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:37.571 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:38.793 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:40.013 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:41.235 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:42.455 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:43.676 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:44.897 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:46.118 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:47.339 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:48.559 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:49.780 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:51.000 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:52.218 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:53.440 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:54.661 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:55.884 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:57.104 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:58.325 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:59.546 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:00.768 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:01.987 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:03.208 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:04.430 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:05.651 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:06.871 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:08.091 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:09.311 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:10.532 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:11.753 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:12.973 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:14.192 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:15.412 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:16.632 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:17.852 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:19.073 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:20.294 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:21.514 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:22.736 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:23.959 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:25.180 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:26.400 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:27.621 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:28.842 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:30.063 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:31.284 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:32.504 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:33.724 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:34.943 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:36.163 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:37.385 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:38.605 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:39.826 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:41.044 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:42.266 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:43.487 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:44.706 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:45.926 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:47.147 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:48.368 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:49.588 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:50.809 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:52.030 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:53.250 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:54.469 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:55.690 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:56.909 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:58.131 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:59.352 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:00.573 filler I shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:01.793 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:03.013 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:04.234 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:05.455 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:06.677 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:07.896 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:09.115 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:10.335 filler I shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:11.793 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:13.013 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:14.234 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:15.456 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:16.678 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:17.898 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:19.118 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:20.339 filler I shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:21.794 cds H desperate_prayer PR_Priest_Shadow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:21.794 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, sophic_devotion, static_empowerment(5)
4:23.014 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, sophic_devotion, static_empowerment(5)
4:24.233 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, sophic_devotion, static_empowerment(5)
4:25.453 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, sophic_devotion, static_empowerment(5)
4:26.674 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, sophic_devotion, static_empowerment(5)
4:27.894 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, sophic_devotion, static_empowerment(5)
4:29.114 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5)
4:30.333 cds E potion Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5)
4:30.333 filler I shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:31.793 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:33.013 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:34.233 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:35.451 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:36.672 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:37.892 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:39.111 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.332 trinkets O use_items Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.332 filler I shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:41.793 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:43.013 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:44.233 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.453 cds F blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.453 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:46.674 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:47.894 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:49.115 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:50.336 filler I shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:51.794 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:53.014 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:54.235 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:55.455 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:56.676 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:57.896 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
4:59.116 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3848 1 13665 13015 9166
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 273300 260300 0
Mana 49999 49999 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 1600 1600 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +923 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +692 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +923 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +923 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +111 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +692 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +519 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +519 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +923 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Talents

RowPriest Talents [1]
1
2
3
4
5
6
7
8
9
10
RowShadow Talents [2]
1
2
3
4
5
6
7
8
9
10

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(spell_targets.shadow_crash>1|talent.mental_decay)
actions.precombat+=/vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|spell_targets.shadow_crash=1&!talent.mental_decay|fight_style.dungeonslice

# Executed every time the actor is available.
actions=variable,name=holding_crash,op=set,value=raid_event.adds.in<15
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
actions+=/run_action_list,name=aoe,if=active_enemies>2|spell_targets.vampiric_touch>3
actions+=/run_action_list,name=main

actions.aoe=call_action_list,name=aoe_variables
# High Priority action to put out Vampiric Touch on enemies that will live at least 18 seconds, up to 12 targets manually while prepping AoE
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied),if=variable.max_vts>0&!variable.manual_vts_applied&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Crash to apply Vampiric Touch to as many adds as possible while being efficient with Vampiric Touch refresh windows
actions.aoe+=/shadow_crash,if=!variable.holding_crash,target_if=dot.vampiric_touch.refreshable|dot.vampiric_touch.remains<=target.time_to_die&!buff.voidform.up&(raid_event.adds.in-dot.vampiric_touch.remains)<15
actions.aoe+=/call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend or Mindbender on cooldown if DoTs are active
actions.aoe+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight&talent.whispering_shadows)&(fight_remains<30|time_to_die>15)
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff or if Inescapable Torment is talented with Mindbender active. Only use when facing 3-7 targets.
actions.aoe+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&active_enemies<=7&!buff.mind_devourer.up
actions.aoe+=/void_bolt
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.aoe+=/devouring_plague,target_if=refreshable|!talent.distorted_reality,if=refreshable&!variable.pool_for_cds|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<(buff.voidform.remains+2)
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied),if=variable.max_vts>0&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash)&!action.shadow_crash.in_flight|!talent.whispering_shadows
# High Priority Mind Spike: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_spike_insanity,if=variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# # Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.aoe+=/mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent action list for AoE
actions.aoe+=/call_action_list,name=pl_torrent,target_if=talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=3&(!variable.holding_crash|raid_event.adds.count%(active_dot.vampiric_touch+raid_event.adds.count)<1.5)&((insanity>=50|dot.devouring_plague.ticking|buff.dark_reveries.up)|buff.voidform.up|buff.dark_ascension.up)
actions.aoe+=/mindgames,if=active_enemies<5&dot.devouring_plague.ticking|talent.psychic_link
actions.aoe+=/void_torrent,if=!talent.psychic_link,target_if=variable.dots_up
# High priority action for Mind Flay: Insanity to fish for Idol of C'Thun procs, cancel as soon as something else is more important and most of the channel has completed
actions.aoe+=/mind_flay,if=buff.mind_flay_insanity.up&talent.idol_of_cthun,interrupt_if=ticks>=2,interrupt_immediate=1
actions.aoe+=/call_action_list,name=filler

actions.aoe_variables=variable,name=max_vts,op=set,default=12,value=spell_targets.vampiric_touch>?12
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
# TODO: Revamp to fix undesired behaviour with unstacked fights
actions.aoe_variables+=/variable,name=vts_applied,op=set,value=(active_dot.vampiric_touch+8*(action.shadow_crash.in_flight&talent.whispering_shadows))>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=holding_crash,op=set,value=(variable.max_vts-active_dot.vampiric_touch)<4|raid_event.adds.in<10&raid_event.adds.count>(variable.max_vts-active_dot.vampiric_touch),if=variable.holding_crash&talent.whispering_shadows
actions.aoe_variables+=/variable,name=manual_vts_applied,op=set,value=(active_dot.vampiric_touch+8*!variable.holding_crash)>=variable.max_vts|!variable.is_vt_possible

# TODO: Check VE/DA enter conditions based on dots
actions.cds=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
actions.cds+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions.cds+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions.cds+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions.cds+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
# Sync Power Infusion with Voidform or Dark Ascension
actions.cds+=/power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
# Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
# Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
actions.cds+=/call_action_list,name=trinkets
# Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.cds+=/desperate_prayer,if=health.pct<=75

# Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
actions.filler=vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
actions.filler+=/shadow_word_death,target_if=target.health.pct<20|buff.deathspeaker.up
actions.filler+=/mind_spike_insanity
actions.filler+=/mind_flay,if=buff.mind_flay_insanity.up
# Save up to 20s if adds are coming soon.
actions.filler+=/halo,if=raid_event.adds.in>20
actions.filler+=/shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
# Save up to 10s if adds are coming soon.
actions.filler+=/divine_star,if=raid_event.adds.in>10
actions.filler+=/devouring_plague,if=buff.voidform.up&variable.dots_up
actions.filler+=/mind_spike
actions.filler+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
# Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
actions.filler+=/shadow_crash,if=raid_event.adds.in>20
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.filler+=/shadow_word_death,target_if=target.health.pct<20
# Use Divine Star while moving as a low-priority action
actions.filler+=/divine_star
# Use Shadow Word: Death while moving as a low-priority action
actions.filler+=/shadow_word_death
# Use Shadow Word: Pain while moving as a low-priority action
actions.filler+=/shadow_word_pain,target_if=min:remains

actions.main=call_action_list,name=main_variables
actions.main+=/call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active
actions.main+=/mindbender,if=variable.dots_up&(fight_remains<30|time_to_die>15)
# High priority Mind Blast action when using Inescapable Torment
actions.main+=/mind_blast,target_if=(dot.devouring_plague.ticking&(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time)|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&active_enemies<=7
actions.main+=/void_bolt,if=variable.dots_up
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.main+=/devouring_plague,target_if=refreshable|!talent.distorted_reality,if=refreshable&!variable.pool_for_cds|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<(buff.voidform.remains+2)
# Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
actions.main+=/shadow_crash,if=!variable.holding_crash&dot.vampiric_touch.refreshable
# Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
actions.main+=/vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
# High Priority Mind Spike: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available
actions.main+=/mind_spike_insanity,if=variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.main+=/mind_blast,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
actions.main+=/void_torrent,if=!variable.holding_crash,target_if=variable.all_dots_up&dot.devouring_plague.remains>=2
# Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.main+=/mindgames,target_if=variable.all_dots_up&dot.devouring_plague.remains>=cast_time
actions.main+=/call_action_list,name=filler

actions.main_variables=variable,name=dots_up,op=set,value=(dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking)|action.shadow_crash.in_flight&talent.whispering_shadows
actions.main_variables+=/variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
actions.main_variables+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up

actions.pl_torrent=void_bolt
actions.pl_torrent+=/vampiric_touch,if=remains<=6&cooldown.void_torrent.remains<gcd*2
# Use Devouring Plague before Void Torrent cast
actions.pl_torrent+=/devouring_plague,if=remains<=4&cooldown.void_torrent.remains<gcd*2
actions.pl_torrent+=/mind_blast,if=!talent.mindgames|cooldown.mindgames.remains>=3&!prev_gcd.1.mind_blast
actions.pl_torrent+=/void_torrent,if=dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking|buff.voidform.up
actions.pl_torrent+=/mindgames,if=dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&dot.devouring_plague.ticking|buff.voidform.up

actions.trinkets=use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance
# Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
actions.trinkets+=/use_item,name=erupting_spear_fragment,if=buff.power_infusion.up|raid_event.adds.up|fight_remains<20
# Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
actions.trinkets+=/use_item,name=beacon_to_the_beyond,if=!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
actions.trinkets+=/use_item,name=desperate_invokers_codex

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=9166
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 52285 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
52284.6 52284.6 67.2 / 0.129% 11777.0 / 22.5% 60.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
810.9 808.4 Mana 0.93% 52.3 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAoEhkQCKCk0SSaICQikCC

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 52285
Ascendance (_dre) 0 (1060) 0.0% (2.0%) 8.2 34.44s 38716 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.21 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
    Ascendance (_damage_dre) 1060 2.0% 8.2 34.44s 38716 0 Direct 8.2 32627 65123 38714 18.7% 0.0%

Stats Details: Ascendance Damage Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.21 8.21 0.00 0.00 0.00 0.0000 0.0000 318007.18 318007.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.26% 6.67 1 15 32626.90 27692 54009 32602.40 27692 42432 217782 217782 0.00%
crit 18.74% 1.54 0 8 65122.58 55384 106786 52400.30 0 102732 100225 100225 0.00%

Action Details: Ascendance Damage Dre

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 88 0.2% 3.7 90.41s 7037 6387 Direct 3.7 7037 0 7037 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.1018 0.0000 26264.10 37521.10 30.00% 6387.18 6387.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.73 3 4 7036.74 4017 13843 7056.00 5495 9372 26264 37521 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.73
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 7698 14.7% 25.8 11.67s 89495 75966 Direct 25.8 74652 149267 89532 19.9% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.80 25.79 0.00 0.00 0.00 1.1781 0.0000 2308906.38 2308906.38 0.00% 75965.86 75965.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.06% 20.65 10 30 74652.36 47792 141674 74656.36 61297 87681 1541278 1541278 0.00%
crit 19.94% 5.14 0 16 149266.82 95584 279989 148814.84 0 246001 767628 767628 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.97

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [M]:1.37
  • if_expr:buff.maelstrom_weapon.stack>=5&charges=max_charges
    single
    [N]:24.43
  • if_expr:buff.maelstrom_weapon.stack>=5&(buff.feral_spirit.up|!talent.elemental_spirits.enabled)
Flame Shock 1450 2.8% 24.2 11.95s 17957 34832 Direct 24.2 2919 5843 3519 20.5% 0.0%
Periodic 169.3 1715 3430 2065 20.4% 0.0% 88.0%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.23 24.23 169.34 169.34 20.36 0.5155 1.5598 435015.64 435015.64 0.00% 1572.55 34831.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.48% 19.25 3 36 2918.95 2487 4850 2918.46 2518 3376 56204 56204 0.00%
crit 20.52% 4.97 0 15 5842.92 4973 9700 5815.80 0 8350 29047 29047 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.58% 134.76 66 187 1715.38 1 2885 1714.57 1530 1932 231174 231174 0.00%
crit 20.42% 34.58 14 61 3429.80 2 5770 3428.21 2971 3920 118591 118591 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:1.02
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Fire damage and knocking them into the air.]

Action Priority List

    single
    [R]:3.87
  • if_expr:!ticking
    single
    [Y]:6.78
Flametongue Weapon 0 (1557) 0.0% (3.0%) 1.0 0.00s 466618 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1557 3.0% 1102.6 0.69s 423 0 Direct 1102.6 363 726 423 16.5% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1102.57 1102.57 0.00 0.00 0.00 0.0000 0.0000 466618.30 466618.30 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.53% 921.00 644 1250 363.42 304 590 363.47 337 404 334712 334712 0.00%
crit 16.47% 181.57 109 262 726.47 607 1180 726.59 667 801 131906 131906 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.23

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }
Forgestorm Ignited (_damage) 1248 2.4% 29.0 7.58s 12895 0 Direct 29.0 11080 22159 12895 16.4% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.05 29.05 0.00 0.00 0.00 0.0000 0.0000 374583.52 374583.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.62% 24.29 0 67 11079.61 11080 11080 11078.13 0 11080 269130 269130 0.00%
crit 16.38% 4.76 0 20 22159.22 22159 22159 21674.60 0 22159 105454 105454 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 802 1.5% 12.3 21.79s 19536 16510 Direct 12.3 16766 33535 19536 16.5% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.31 12.31 0.00 0.00 0.00 1.1833 0.0000 240434.31 240434.31 0.00% 16509.94 16509.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.48% 10.27 0 23 16766.42 8034 31338 16848.33 0 22639 172268 172268 0.00%
crit 16.52% 2.03 0 10 33534.81 16068 62676 29164.70 0 60297 68166 68166 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [W]:12.31
Ice Strike 1183 2.3% 16.3 18.37s 21794 18667 Direct 16.3 18693 37306 21794 16.7% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.27 16.27 0.00 0.00 0.00 1.1676 0.0000 354571.38 354571.38 0.00% 18666.56 18666.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.34% 13.56 5 23 18692.53 15744 30707 18689.18 16244 21912 253431 253431 0.00%
crit 16.66% 2.71 0 11 37305.91 31489 61415 35117.49 0 57319 101140 101140 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [P]:1.48
  • if_expr:buff.doom_winds.up
    single
    [T]:14.79
Lava Lash 1026 2.0% 13.6 21.31s 22650 19183 Direct 13.6 19417 38837 22650 16.6% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.58 13.58 0.00 0.00 0.00 1.1808 0.0000 307650.11 307650.11 0.00% 19182.57 19182.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.35% 11.32 3 20 19416.89 16581 32339 19405.99 16843 23104 219831 219831 0.00%
crit 16.65% 2.26 0 9 38836.75 33162 64679 35257.35 0 62223 87819 87819 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [S]:3.23
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [U]:10.35
Lightning Bolt 5564 10.6% 26.4 10.96s 63219 53937 Direct 26.4 52451 104831 63219 20.6% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.39 26.39 0.00 0.00 0.00 1.1721 0.0000 1668592.92 1668592.92 0.00% 53936.93 53936.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.44% 20.97 8 37 52451.17 36272 110045 52442.66 42897 64439 1099834 1099834 0.00%
crit 20.56% 5.43 0 14 104831.08 72543 211735 104500.56 0 191256 568759 568759 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [O]:26.39
  • if_expr:((buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
main_hand 1481 2.8% 162.8 2.15s 2728 1619 Direct 162.8 2724 5445 2728 16.5% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 162.76 162.76 0.00 0.00 0.00 1.6846 0.0000 443985.65 634281.39 30.00% 1619.32 1619.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.13% 109.26 64 162 2724.32 2336 4308 2724.03 2508 2994 297649 425224 30.00%
crit 16.51% 26.87 8 49 5445.49 4671 8616 5445.46 4838 6427 146336 209057 30.00%
miss 16.36% 26.63 10 51 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 741 1.4% 162.6 2.14s 1365 810 Direct 162.6 1364 2729 1365 16.5% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 162.63 162.63 0.00 0.00 0.00 1.6859 0.0000 222049.00 317220.95 30.00% 809.92 809.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.11% 109.13 67 155 1363.92 1168 2154 1363.85 1256 1510 148848 212645 30.00%
crit 16.50% 26.83 9 52 2728.81 2336 4308 2728.63 2390 3132 73201 104576 30.00%
miss 16.40% 26.67 8 49 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (8816) 0.0% (16.9%) 97.9 3.06s 27001 23136

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.88 0.00 0.00 0.00 0.00 1.1671 0.0000 0.00 0.00 0.00% 23135.88 23135.88

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:97.88
  • if_expr:buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|((talent.elemental_assault.enabled&talent.stormflurry.enabled)&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack)
    Stormstrike (_mh) 4811 (5878) 9.2% (11.2%) 130.4 3.06s 13512 0 Direct 130.4 (192.2) 9489 19002 11059 16.5% (11.2%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 130.41 130.41 0.00 0.00 0.00 0.0000 0.0000 1442213.73 2060357.85 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.49% 108.88 60 172 9489.11 2872 24739 9502.67 8209 11469 1033192 1476027 30.00%
crit 16.51% 21.53 5 43 19001.70 5744 49478 19029.88 12649 26993 409021 584331 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 1067 2.0% 61.8 5.45s 5179 0 Direct 61.8 5179 0 5179 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.75 61.75 0.00 0.00 0.00 0.0000 0.0000 319845.86 319845.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.75 28 107 5179.43 1261 21846 5193.36 3787 7093 319846 319846 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2405 (2938) 4.6% (5.6%) 130.4 3.06s 6754 0 Direct 130.4 (192.2) 4745 9493 5529 16.5% (11.2%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 130.41 130.41 0.00 0.00 0.00 0.0000 0.0000 720960.41 1029969.70 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.50% 108.89 66 168 4745.31 1436 12370 4752.02 4054 5583 516743 738223 30.00%
crit 16.50% 21.51 5 45 9493.22 2872 24739 9510.08 6553 13079 204218 291747 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 533 1.0% 61.8 5.45s 2589 0 Direct 61.8 2589 0 2589 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.75 61.75 0.00 0.00 0.00 0.0000 0.0000 159860.67 159860.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.75 28 107 2588.70 630 10924 2595.26 2006 3335 159861 159861 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 927 1.8% 5.6 55.04s 49671 42462 Direct 5.6 42570 85097 49673 16.7% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.60 5.60 0.00 0.00 0.00 1.1699 0.0000 277999.96 277999.96 0.00% 42462.19 42462.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.30% 4.66 0 8 42570.22 27990 83024 42600.96 0 69640 198480 198480 0.00%
crit 16.70% 0.93 0 5 85096.94 55980 147662 53908.38 0 146968 79520 79520 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [Q]:0.67
  • if_expr:buff.doom_winds.up&raid_event.adds.in>=40
    single
    [V]:4.93
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (7629) 0.0% (14.6%) 1.0 0.00s 2284052 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 7629 14.6% 406.9 2.47s 5613 0 Direct 406.9 4819 9639 5613 16.5% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 406.93 406.93 0.00 0.00 0.00 0.0000 0.0000 2284052.03 3263014.66 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.53% 339.93 219 508 4819.26 2003 12361 4818.35 4255 5538 1638194 2340337 30.00%
crit 16.47% 67.01 32 113 9638.68 4005 24722 9638.47 7839 12004 645858 922677 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}
Windlash 457 0.9% 29.5 10.63s 4643 3532 Direct 29.5 3857 7724 4643 20.3% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.49 29.49 0.00 0.00 0.00 1.3145 0.0000 136941.30 136941.30 0.00% 3532.42 3532.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.67% 23.50 6 47 3857.46 3337 6154 3853.74 3337 4688 90634 90634 0.00%
crit 20.33% 6.00 0 22 7723.81 6673 12309 7693.09 0 11328 46307 46307 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 253 0.5% 32.7 9.58s 2323 1741 Direct 32.7 1930 3858 2323 20.4% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.66 32.66 0.00 0.00 0.00 1.3342 0.0000 75876.31 75876.31 0.00% 1741.16 1741.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.60% 26.00 7 54 1929.72 1668 3077 1928.02 1668 2492 50175 50175 0.00%
crit 20.40% 6.66 0 18 3857.78 3337 6154 3846.52 0 5958 25702 25702 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (7047) 0.0% (13.5%) 24.4 10.67s 86413 73445

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.44 0.00 0.00 0.00 0.00 1.1766 0.0000 0.00 0.00 0.00% 73445.04 73445.04

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [K]:24.44
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1&(talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|(talent.elemental_assault.enabled&talent.stormflurry.enabled)|ti_lightning_bolt)
    Windstrike (_mh) 1728 (2025) 3.3% (3.9%) 32.6 10.67s 18613 0 Direct 32.6 (43.2) 13644 27329 15897 16.5% (12.4%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.59 32.57 0.00 0.00 0.00 0.0000 0.0000 517775.66 517775.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.54% 27.21 7 60 13644.49 4103 33720 13680.57 9484 19386 371254 371254 0.00%
crit 16.46% 5.36 0 17 27328.57 8205 69066 27151.25 0 60612 146522 146522 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 297 0.6% 10.7 23.56s 8328 0 Direct 10.7 8328 0 8328 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.66 10.66 0.00 0.00 0.00 0.0000 0.0000 88783.46 88783.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 10.66 0 31 8327.68 3211 31520 8290.58 0 13649 88783 88783 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 862 (1010) 1.6% (1.9%) 32.6 10.67s 9286 0 Direct 32.6 (43.2) 6825 13641 7932 16.2% (12.2%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.59 32.57 0.00 0.00 0.00 0.0000 0.0000 258345.15 258345.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.76% 27.28 8 61 6824.53 2051 17266 6842.98 4792 9965 186170 186170 0.00%
crit 16.24% 5.29 0 20 13640.95 4103 33720 13554.51 0 24951 72176 72176 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 148 0.3% 10.7 23.56s 4151 0 Direct 10.7 4150 0 4150 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.66 10.66 0.00 0.00 0.00 0.0000 0.0000 44250.61 44250.61 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 10.66 0 31 4150.43 1605 14805 4129.70 0 7991 44251 44251 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 4012 7.7% 24.4 10.67s 49213 0 Direct 24.4 40921 81731 49213 20.3% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.44 24.44 0.00 0.00 0.00 0.0000 0.0000 1202757.28 1202757.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.68% 19.47 3 42 40920.57 20151 70743 40851.91 33368 52137 796874 796874 0.00%
crit 20.32% 4.97 0 16 81730.96 40302 141486 80924.06 0 128289 405883 405883 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 437 / 90
melee 437 0.2% 39.0 2.09s 686 444 Direct 39.0 589 1178 686 16.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.99 38.99 0.00 0.00 0.00 1.5446 0.0000 26738.56 38198.91 30.00% 443.95 443.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.58% 32.59 7 61 589.04 520 976 588.61 520 748 19197 27425 30.00%
crit 16.42% 6.40 0 24 1177.60 1040 1952 1176.11 0 1907 7541 10773 29.97%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4199 / 3168
melee 4199 6.1% 397.6 1.50s 2387 2067 Direct 397.6 2050 4099 2387 16.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 397.58 397.58 0.00 0.00 0.00 1.1550 0.0000 949162.03 1355980.33 30.00% 2067.02 2067.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.54% 332.15 215 452 2050.17 1738 3262 2050.36 1899 2275 680965 972832 30.00%
crit 16.46% 65.43 29 108 4099.16 3477 6523 4099.19 3723 4663 268197 383149 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.1 308.55s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.09 0.00 0.00 0.00 0.00 1.0465 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [X]:1.09
Feral Spirit 16.1 19.38s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.09 0.00 0.00 0.00 0.00 1.1661 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:16.09
Phial of Tepid Versatility 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371172
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 301.59s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Windfury Totem 1.0 0.00s

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 8.1 0.0 34.9s 34.9s 6.0s 16.27% 95.83% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 123.7s
  • trigger_min/max:6.0s / 123.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s
  • uptime_min/max:6.84% / 29.73%

Stack Uptimes

  • ascendance_1:16.27%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4s 5.4s 18.4s 12.40% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.6s
  • trigger_pct:100.00%
  • duration_min/max:16.5s / 20.0s
  • uptime_min/max:10.15% / 15.37%

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.41%
  • crumbling_power_3:0.72%
  • crumbling_power_4:0.73%
  • crumbling_power_5:0.72%
  • crumbling_power_6:0.71%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.67%
  • crumbling_power_19:0.68%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4s 90.4s 7.9s 9.88% 11.18% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.4s
  • trigger_min/max:90.0s / 92.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:8.78% / 11.46%

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 16.1 0.0 23.2s 19.2s 18.9s 75.44% 100.00% 0.0 (0.0) 11.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 112.4s
  • trigger_min/max:4.8s / 43.0s
  • trigger_pct:49.99%
  • duration_min/max:0.0s / 101.4s
  • uptime_min/max:61.11% / 91.60%

Stack Uptimes

  • earthen_weapon_2:72.26%
  • earthen_weapon_4:3.17%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 8.6 0.0 34.0s 34.0s 9.8s 28.07% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 233.8s
  • trigger_min/max:10.0s / 233.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:5.73% / 51.56%

Stack Uptimes

  • elemental_blast_critical_strike_1:28.07%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 8.6 0.0 33.7s 33.7s 9.8s 28.36% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 225.2s
  • trigger_min/max:10.0s / 225.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.71% / 52.69%

Stack Uptimes

  • elemental_blast_haste_1:28.36%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 8.6 0.0 33.8s 33.8s 9.8s 28.19% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 229.9s
  • trigger_min/max:10.0s / 229.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.89% / 54.90%

Stack Uptimes

  • elemental_blast_mastery_1:28.19%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 301.0s 301.6s 27.5s 13.45% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 320.3s
  • trigger_min/max:300.0s / 320.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.97% / 18.17%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.45%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 12.0 4.1 26.0s 19.4s 18.9s 75.44% 0.00% 65.7 (65.7) 11.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 112.4s
  • trigger_min/max:4.8s / 43.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 101.4s
  • uptime_min/max:61.13% / 91.61%

Stack Uptimes

  • feral_spirit_1:75.44%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.3 359.9 7.0s 0.7s 5.9s 84.93% 90.73% 359.9 (851.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 65.2s
  • trigger_min/max:0.0s / 17.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.4s
  • uptime_min/max:74.15% / 93.46%

Stack Uptimes

  • flurry_1:20.09%
  • flurry_2:33.99%
  • flurry_3:30.85%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.4 118.3 17.7s 2.2s 14.6s 84.84% 100.00% 55.1 (55.1) 16.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 46.6s
  • trigger_min/max:0.0s / 42.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:70.81% / 94.56%

Stack Uptimes

  • forceful_winds_1:14.67%
  • forceful_winds_2:14.02%
  • forceful_winds_3:12.64%
  • forceful_winds_4:10.70%
  • forceful_winds_5:32.81%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=20}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.2s 46.2s 12.9s 19.60% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 197.8s
  • trigger_min/max:0.2s / 197.8s
  • trigger_pct:98.80%
  • duration_min/max:0.0s / 64.3s
  • uptime_min/max:3.99% / 47.84%

Stack Uptimes

  • forgestorm_ignited_1:19.60%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 15.7 0.6 19.2s 18.4s 7.8s 40.80% 80.06% 0.6 (0.6) 5.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.4s / 130.3s
  • trigger_min/max:8.4s / 130.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.1s
  • uptime_min/max:16.75% / 66.94%

Stack Uptimes

  • ice_strike_1:40.80%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 21.9 27.7 13.7s 6.0s 9.2s 67.29% 100.00% 27.7 (27.7) 21.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 73.7s
  • trigger_min/max:0.8s / 32.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 63.9s
  • uptime_min/max:53.41% / 81.28%

Stack Uptimes

  • legacy_of_the_frost_witch_1:67.29%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 60.0 427.4 5.0s 0.6s 4.3s 86.13% 100.00% 72.2 (80.4) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 31.7s
  • trigger_min/max:0.0s / 7.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 31.2s
  • uptime_min/max:80.02% / 91.50%

Stack Uptimes

  • maelstrom_weapon_1:9.11%
  • maelstrom_weapon_2:10.77%
  • maelstrom_weapon_3:12.35%
  • maelstrom_weapon_4:12.60%
  • maelstrom_weapon_5:8.41%
  • maelstrom_weapon_6:6.64%
  • maelstrom_weapon_7:5.04%
  • maelstrom_weapon_8:4.30%
  • maelstrom_weapon_9:3.50%
  • maelstrom_weapon_10:13.41%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.1s 45.7s 16.5s 23.64% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 224.1s
  • trigger_min/max:0.0s / 214.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 63.6s
  • uptime_min/max:5.08% / 56.37%

Stack Uptimes

  • sophic_devotion_1:23.64%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.3s 45.8s 32.2s 38.26% 0.00% 25.7 (25.7) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 248.9s
  • trigger_min/max:0.0s / 193.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 206.1s
  • uptime_min/max:8.11% / 85.40%

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.28%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.22%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.80%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 8.1 0.0 34.9s 34.9s 6.0s 16.27% 100.00% 40.8 (40.8) 7.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:6.0s / 123.7s
  • trigger_min/max:6.0s / 123.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s
  • uptime_min/max:6.84% / 29.73%

Stack Uptimes

  • static_accumulation_1:16.27%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411={$s2=10}% chance to refund Maelstrom Weapon stacks spent on Lightning Bolt or Chain Lightning. While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 61.3 18.3 4.8s 3.7s 1.1s 23.02% 49.79% 18.3 (18.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 69.8s
  • trigger_min/max:0.0s / 69.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s
  • uptime_min/max:12.76% / 33.81%

Stack Uptimes

  • stormbringer_1:23.02%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Tepid Versatility

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_phial_of_tepid_versatility
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Phial of Tepid Versatility

Stat Details

  • stat:versatility_rating
  • amount:745.00

Spelldata

  • id:371172
  • name:Phial of Tepid Versatility
  • tooltip:Versatility increased by {$=}w1.
  • description:Increases your Versatility by {$s1=315}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.8 36.0 69.0 17.8s 15.0s 61.9s
Windfury-ForcefulWinds: 2 51.4 33.0 69.0 18.0s 0.5s 62.6s
Windfury-ForcefulWinds: 3 49.8 30.0 72.0 18.6s 1.1s 81.5s
Windfury-ForcefulWinds: 4 46.6 24.0 72.0 19.8s 1.1s 89.8s
Windfury-ForcefulWinds: 5 207.3 96.0 339.0 4.8s 0.0s 104.0s
windfury_totem_extra_attack_mh 27.5 10.0 49.0 10.7s 1.3s 133.0s
windfury_totem_extra_attack_oh 27.8 9.0 51.0 10.5s 1.3s 133.0s
Elemental Blast: Critical Strike 8.6 2.0 17.0 34.0s 10.0s 233.8s
Elemental Blast: Haste 8.6 1.0 19.0 33.7s 10.0s 225.2s
Elemental Blast: Mastery 8.6 1.0 19.0 33.8s 10.0s 229.9s
Windfury: Unruly Winds 135.6 88.0 196.0 2.5s 0.0s 42.9s
Maelstrom Weapon: Feral Spirit 84.8 58.0 112.0 3.5s 0.0s 28.0s
Maelstrom Weapon: Elemental Assault 122.3 82.0 165.0 2.4s 0.8s 10.0s
Maelstrom Weapon: Static Accumulation 97.4 36.0 180.0 5.3s 1.0s 118.7s
Maelstrom Weapon: Static Accumulation Refund 59.7 0.0 157.0 25.8s 0.8s 277.4s
Stormflurry 40.7 13.0 78.0 9.6s 0.8s 125.4s
Maelstrom Weapon Swing Reset 5.0 0.0 15.0 45.1s 0.8s 314.9s
Flametongue: Windfury Attack 406.9 264.0 588.0 2.5s 0.0s 42.9s
Stormbringer: Windfury Attack 42.2 14.0 76.0 8.0s 0.0s 120.3s
Flametongue: main_hand 136.1 89.0 189.0 2.6s 1.3s 31.1s
Windfury: main_hand 52.0 28.0 85.0 6.3s 1.3s 80.8s
Flametongue: Windlash 29.5 7.0 57.0 10.6s 1.3s 120.5s
Windfury: Windlash 10.8 0.0 30.0 25.0s 1.3s 278.6s
Flametongue: offhand 136.0 85.0 184.0 2.6s 1.3s 27.1s
Flametongue: Windlash Off-Hand 32.7 9.0 64.0 9.6s 1.3s 120.5s
Flametongue: Lava Lash 13.6 4.0 21.0 21.3s 8.7s 151.3s
Stormbringer: Lava Lash 1.4 0.0 7.0 86.0s 8.8s 319.9s
Flametongue: Windstrike 32.6 10.0 73.0 10.7s 0.8s 120.0s
Stormbringer: Windstrike 3.4 0.0 13.0 55.4s 0.8s 340.3s
Windfury: Windstrike 11.8 0.0 32.0 24.1s 0.8s 290.1s
Flametongue: Windstrike Off-Hand 32.6 10.0 73.0 10.7s 0.8s 120.0s
Stormbringer: Windstrike Off-Hand 3.3 0.0 13.0 55.5s 0.8s 326.2s
Flametongue: Sundering 5.6 2.0 8.0 55.1s 40.0s 186.9s
Stormbringer: Sundering 0.6 0.0 4.0 113.8s 40.0s 335.8s
Windfury: Sundering 2.2 0.0 6.0 101.7s 40.0s 344.4s
Flametongue: Ice Strike 16.3 7.0 25.0 18.4s 8.4s 130.3s
Stormbringer: Ice Strike 1.7 0.0 7.0 85.0s 8.4s 337.0s
Windfury: Ice Strike 6.0 0.0 14.0 47.0s 8.4s 347.9s
Flametongue: Stormstrike 130.4 80.0 200.0 3.1s 0.8s 24.3s
Stormbringer: Stormstrike 13.5 1.0 31.0 21.4s 0.8s 241.3s
Windfury: Stormstrike 52.8 26.0 89.0 6.6s 0.8s 79.9s
Flametongue: Stormstrike Off-Hand 130.4 80.0 200.0 3.1s 0.8s 24.3s
Stormbringer: Stormstrike Off-Hand 13.5 2.0 33.0 21.5s 0.8s 225.8s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 27.36% 18.67% 37.66% 0.8s 0.0s 17.8s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7480.0001.48912.0553.91020.599
Doom Winds0.5330.0002.4431.9910.8636.521
Lava Lash10.1040.000138.991142.60459.914247.811
Elemental Blast0.1900.00018.8144.9072.59325.062
Windstrike
Stormstrike
1.0540.0004.087129.19976.043189.951
Sundering15.3120.000146.92090.46912.669233.857
Ice Strike6.7640.000117.997113.38535.432215.862
Frost Shock18.0750.000225.826242.287151.899330.726
Flame Shock21.9630.000176.624250.455172.352324.482
Earth Elemental38.4190.000259.27643.8228.533348.352

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack67.913.613.43%16.97%
main_hand24.23.04.80%3.76%
Windlash4.61.30.91%1.64%
offhand24.03.24.74%3.96%
Windlash Off-Hand5.11.41.02%1.79%
Feral Spirit73.811.114.59%13.81%
Doom Winds0.70.10.13%0.10%
Lightning Bolt37.10.07.34%0.00%
Lava Lash2.70.00.54%0.00%
Windstrike22.81.64.51%2.05%
Windstrike (_mh)5.90.71.16%0.83%
Windstrike Off-Hand5.80.71.15%0.86%
Sundering1.10.00.22%0.00%
Ice Strike3.30.00.64%0.00%
Stormstrike81.116.816.04%20.92%
Stormstrike (_mh)22.23.84.39%4.79%
Stormstrike Off-Hand22.04.14.36%5.07%
Lightning Bolt (_ti)22.60.04.48%0.00%
Ascendance (_dre)78.618.815.55%23.44%
Overflow Stacks0.080.40.00%13.72%
Actual Stacks505.40.086.28%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt185.236.97%
Elemental Blast202.940.49%
Lightning Bolt (_ti)112.922.54%
Total Spent501.1100.00%

Deeply Rooted Elements Proc Details

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
mana_regenMana642.38242511.33100.00%377.52236873.8649.41%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 808.36 810.94 236876.3 49228.5 40921.6 50000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.001000.000.41%1000.001000.000.00
Elemental BlastMana 25.8035473.9414.58%1375.001375.0065.09
Flame ShockMana 10.647982.243.28%750.00329.4954.50
Frost ShockMana 12.316153.052.53%500.00499.9539.08
Ice StrikeMana 16.2726844.1211.03%1650.001650.0213.21
Lava LashMana 13.585433.142.23%400.00400.0056.62
Lightning BoltMana 26.3913197.115.42%500.00500.00126.44
StormstrikeMana 130.41130408.4853.60%1000.001332.3320.27
SunderingMana 5.6016790.566.90%3000.002999.9916.56

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 52284.58
Minimum 42302.67
Maximum 64345.42
Spread ( max - min ) 22042.75
Range [ ( max - min ) / 2 * 100% ] 21.08%
Standard Deviation 2970.3395
5th Percentile 47565.31
95th Percentile 57334.50
( 95th Percentile - 5th Percentile ) 9769.19
Mean Distribution
Standard Deviation 34.3008
95.00% Confidence Interval ( 52217.35 - 52351.80 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 124
0.1% Error 12399
0.1 Scale Factor Error with Delta=300 75318
0.05 Scale Factor Error with Delta=300 301270
0.01 Scale Factor Error with Delta=300 7531750
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 52284.58
Minimum 42302.67
Maximum 64345.42
Spread ( max - min ) 22042.75
Range [ ( max - min ) / 2 * 100% ] 21.08%
Standard Deviation 2970.3395
5th Percentile 47565.31
95th Percentile 57334.50
( 95th Percentile - 5th Percentile ) 9769.19
Mean Distribution
Standard Deviation 34.3008
95.00% Confidence Interval ( 52217.35 - 52351.80 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 124
0.1% Error 12399
0.1 Scale Factor Error with Delta=300 75318
0.05 Scale Factor Error with Delta=300 301270
0.01 Scale Factor Error with Delta=300 7531750
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 52284.58
Minimum 42302.67
Maximum 64345.42
Spread ( max - min ) 22042.75
Range [ ( max - min ) / 2 * 100% ] 21.08%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 14696340.93
Minimum 10005734.72
Maximum 20450860.72
Spread ( max - min ) 10445125.99
Range [ ( max - min ) / 2 * 100% ] 35.54%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
G 16.09 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1))
H 3.73 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
0.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>42|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=40
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
K 24.44 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1&(talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|(talent.elemental_assault.enabled&talent.stormflurry.enabled)|ti_lightning_bolt)
L 97.88 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|((talent.elemental_assault.enabled&talent.stormflurry.enabled)&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack)
0.00 lava_lash,if=buff.hot_hand.up
0.00 windfury_totem,if=!buff.windfury_totem.up
M 1.37 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
N 24.43 elemental_blast,if=buff.maelstrom_weapon.stack>=5&(buff.feral_spirit.up|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
O 26.39 lightning_bolt,if=((buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
P 1.48 ice_strike,if=buff.doom_winds.up
Q 0.67 sundering,if=buff.doom_winds.up&raid_event.adds.in>=40
0.00 crash_lightning,if=buff.doom_winds.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
0.00 primordial_wave,if=raid_event.adds.in>42|raid_event.adds.in<6
R 3.87 flame_shock,if=!ticking
S 3.23 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
T 14.79 ice_strike
0.00 frost_shock,if=buff.hailstorm.up
U 10.35 lava_lash
0.00 windstrike
0.00 stormstrike
V 4.93 sundering,if=raid_event.adds.in>=40
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
0.00 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
W 12.31 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
X 1.09 earth_elemental
Y 6.78 flame_shock
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

012346789BCDEFGHLPMQRLLLLLKKGKKKLLMLSNTLOLWGXYLNLLLKKKOKGOLNLLOSTVLLLNLWYUTLLGOLLNLOLLKKOKGNLRTLLOLHLLNLPOLSNVWLGLKKOKLNLLGOLLLLLNLROLTUWYLLLLNGLLOLTLLKNKSGLNLLLOLOLTULNLGVEFOHLLOPLNLOLSLOGLNLTOWULLLLLNLTLOLUVGLNLKTKKOLUWNGLOOLLKNKTLGLOLOLRUTVLLKKGKHLMLLNLLOOGLNLLOLLOLRTLK

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 2 augmentation PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement 50000.0/50000: 100% mana
0:00.000 default B bloodlust Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 default C potion Fluffy_Pillow 49000.0/50000: 98% mana bloodlust
0:00.000 default D auto_attack Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(2), elemental_potion_of_ultimate_power
0:00.000 default F berserking Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry, crumbling_power(20), elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, berserking, flurry, crumbling_power(19), elemental_potion_of_ultimate_power
0:00.867 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, feral_spirit, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_potion_of_ultimate_power
0:01.734 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), doom_winds, crumbling_power(18), elemental_potion_of_ultimate_power
0:02.600 single P ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), doom_winds, crumbling_power(17), elemental_potion_of_ultimate_power
0:03.464 single M elemental_blast Fluffy_Pillow 49732.4/50000: 99% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), doom_winds, ice_strike, crumbling_power(16), elemental_potion_of_ultimate_power
0:04.331 single Q sundering Fluffy_Pillow 49744.6/50000: 99% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds, ice_strike, crumbling_power(15), elemental_potion_of_ultimate_power
0:05.197 single R flame_shock Fluffy_Pillow 48130.2/50000: 96% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), doom_winds, ice_strike, crumbling_power(14), elemental_potion_of_ultimate_power
0:06.065 single L stormstrike Fluffy_Pillow 48769.0/50000: 98% mana bloodlust, berserking, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), doom_winds, ice_strike, crumbling_power(13), elemental_potion_of_ultimate_power
0:06.933 single L stormstrike Fluffy_Pillow 49157.8/50000: 98% mana bloodlust, berserking, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds, ice_strike, crumbling_power(12), elemental_potion_of_ultimate_power
0:07.800 single L stormstrike Fluffy_Pillow 49545.0/50000: 99% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(11), elemental_potion_of_ultimate_power
0:08.666 single L stormstrike Fluffy_Pillow 45930.6/50000: 92% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(10), elemental_potion_of_ultimate_power
0:09.533 single L stormstrike Fluffy_Pillow 46317.8/50000: 93% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, crumbling_power(9), elemental_potion_of_ultimate_power
0:10.399 single K windstrike Fluffy_Pillow 46703.4/50000: 93% mana bloodlust, berserking, ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, crumbling_power(8), elemental_potion_of_ultimate_power
0:11.267 single K windstrike Fluffy_Pillow 48092.2/50000: 96% mana bloodlust, berserking, ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_potion_of_ultimate_power
0:12.136 default G feral_spirit Fluffy_Pillow 49482.6/50000: 99% mana bloodlust, ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), elemental_potion_of_ultimate_power
0:13.091 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(5), elemental_potion_of_ultimate_power
0:14.043 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), elemental_potion_of_ultimate_power
0:14.997 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, crumbling_power(3), elemental_potion_of_ultimate_power
0:15.952 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, crumbling_power(2), elemental_potion_of_ultimate_power
0:16.903 single L stormstrike Fluffy_Pillow 49521.6/50000: 99% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power, elemental_potion_of_ultimate_power
0:17.854 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, elemental_potion_of_ultimate_power
0:18.807 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, elemental_potion_of_ultimate_power
0:19.761 single S lava_lash Fluffy_Pillow 49526.4/50000: 99% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_potion_of_ultimate_power
0:20.714 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, forgestorm_ignited, elemental_potion_of_ultimate_power
0:21.667 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, elemental_potion_of_ultimate_power
0:22.593 single L stormstrike Fluffy_Pillow 49831.6/50000: 100% mana bloodlust, flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds, forgestorm_ignited, elemental_potion_of_ultimate_power
0:23.518 single O lightning_bolt Fluffy_Pillow 48311.6/50000: 97% mana bloodlust, flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds, forgestorm_ignited, elemental_potion_of_ultimate_power
0:24.443 single L stormstrike Fluffy_Pillow 49291.6/50000: 99% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_potion_of_ultimate_power
0:25.369 single W frost_shock Fluffy_Pillow 49773.2/50000: 100% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_potion_of_ultimate_power
0:26.297 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(3), forgestorm_ignited, elemental_potion_of_ultimate_power
0:27.223 single X earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(3), forgestorm_ignited, elemental_potion_of_ultimate_power
0:28.148 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_potion_of_ultimate_power
0:29.075 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(4), forgestorm_ignited, elemental_potion_of_ultimate_power
0:30.000 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), spiraling_winds(5), forgestorm_ignited
0:30.927 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, legacy_of_the_frost_witch, spiraling_winds(5)
0:31.880 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(5)
0:32.836 single L stormstrike Fluffy_Pillow 49529.6/50000: 99% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(6)
0:33.789 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(6)
0:34.743 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(7)
0:35.696 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(7)
0:36.649 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(8)
0:37.604 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(8)
0:38.560 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion
0:39.516 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(4), maelstrom_weapon(9), legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion
0:40.469 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
0:41.708 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
0:43.093 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
0:44.296 single L stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
0:45.498 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
0:46.701 single S lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited
0:47.903 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), sophic_devotion, forgestorm_ignited
0:49.105 single V sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, sophic_devotion, forgestorm_ignited
0:50.306 single L stormstrike Fluffy_Pillow 48921.6/50000: 98% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, sophic_devotion, forgestorm_ignited
0:51.508 single L stormstrike Fluffy_Pillow 49844.8/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, sophic_devotion, forgestorm_ignited
0:52.712 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, forgestorm_ignited
0:53.952 single N elemental_blast Fluffy_Pillow 49984.0/50000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(10), ice_strike, forgestorm_ignited
0:55.189 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
0:56.428 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
0:57.666 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited
0:58.904 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(3), legacy_of_the_frost_witch
1:00.142 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(4)
1:01.382 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(4), ice_strike, spiraling_winds
1:02.621 single L stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(2)
1:03.862 default G feral_spirit Fluffy_Pillow 49968.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(9), ice_strike, spiraling_winds(2)
1:05.099 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(3)
1:06.335 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4)
1:07.572 single L stormstrike Fluffy_Pillow 49979.2/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4)
1:08.810 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited
1:10.048 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited
1:11.288 single O lightning_bolt Fluffy_Pillow 49984.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited
1:12.528 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited
1:13.766 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited
1:15.005 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, spiraling_winds(8), forgestorm_ignited
1:16.244 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited
1:17.482 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited
1:18.720 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited
1:19.960 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(9), legacy_of_the_frost_witch, spiraling_winds(10)
1:21.201 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10)
1:22.438 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10)
1:23.676 single R flame_shock Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10)
1:24.915 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10)
1:26.152 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch
1:27.390 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike
1:28.627 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike
1:29.865 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch
1:31.102 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch
1:32.340 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds, ice_strike, legacy_of_the_frost_witch
1:33.579 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, ice_strike, legacy_of_the_frost_witch
1:34.816 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), doom_winds, ice_strike
1:36.054 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), maelstrom_weapon, doom_winds, ice_strike, legacy_of_the_frost_witch
1:37.257 single P ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch
1:38.459 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(6), doom_winds, ice_strike, legacy_of_the_frost_witch
1:39.660 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch
1:40.862 single S lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch
1:42.064 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch
1:43.268 single V sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch
1:44.470 single W frost_shock Fluffy_Pillow 48923.2/50000: 98% mana flurry, elemental_blast_haste, elemental_blast_mastery, forceful_winds, maelstrom_weapon(2), ice_strike
1:45.673 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(2)
1:46.913 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(2), stormbringer, maelstrom_weapon(5)
1:48.153 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6)
1:49.392 single K windstrike Fluffy_Pillow 49982.4/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), static_accumulation
1:50.632 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch
1:51.872 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch
1:53.110 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch
1:54.349 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch
1:55.588 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch
1:56.827 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch
1:58.065 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch
1:59.304 default G feral_spirit Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch
2:00.542 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(4), maelstrom_weapon(6), legacy_of_the_frost_witch
2:01.780 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(4), legacy_of_the_frost_witch, sophic_devotion
2:03.019 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion
2:04.259 single L stormstrike Fluffy_Pillow 49984.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion
2:05.497 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(9), legacy_of_the_frost_witch, sophic_devotion
2:06.733 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), sophic_devotion
2:07.972 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), sophic_devotion
2:09.211 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion
2:10.449 single R flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion
2:11.689 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion
2:12.927 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion
2:14.164 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion
2:15.402 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion
2:16.640 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch
2:17.878 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(4)
2:19.117 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon(4), forgestorm_ignited
2:20.357 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(9), forgestorm_ignited
2:21.595 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(10), forgestorm_ignited
2:22.834 single L stormstrike Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(10), forgestorm_ignited
2:24.071 single N elemental_blast Fluffy_Pillow 49961.6/50000: 100% mana flurry, forceful_winds(3), maelstrom_weapon(10), forgestorm_ignited
2:25.309 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(3), legacy_of_the_frost_witch, forgestorm_ignited
2:26.511 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited
2:27.714 single L stormstrike Fluffy_Pillow 44924.8/50000: 90% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, forgestorm_ignited
2:28.916 single O lightning_bolt Fluffy_Pillow 44848.0/50000: 90% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited
2:30.117 single L stormstrike Fluffy_Pillow 46269.6/50000: 93% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited
2:31.322 single T ice_strike Fluffy_Pillow 47197.6/50000: 94% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch
2:32.525 single L stormstrike Fluffy_Pillow 47472.4/50000: 95% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch
2:33.727 single L stormstrike Fluffy_Pillow 47395.6/50000: 95% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch
2:34.930 single K windstrike Fluffy_Pillow 48320.4/50000: 97% mana ascendance, flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike
2:36.167 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike
2:37.404 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion
2:38.642 single S lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion
2:39.882 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion
2:41.121 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion
2:42.358 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion
2:43.597 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion
2:44.799 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion
2:46.001 single L stormstrike Fluffy_Pillow 48923.2/50000: 98% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, sophic_devotion
2:47.204 single O lightning_bolt Fluffy_Pillow 49848.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion
2:48.407 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion
2:49.609 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion
2:50.811 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds, sophic_devotion
2:52.013 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds, sophic_devotion
2:53.216 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2)
2:54.455 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3)
2:55.693 single N elemental_blast Fluffy_Pillow 49980.8/50000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(7), ice_strike, spiraling_winds(3)
2:56.930 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited
2:58.133 default G feral_spirit Fluffy_Pillow 49924.8/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited
2:59.337 single V sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited
3:00.539 default E use_item_irideus_fragment Fluffy_Pillow 48923.2/50000: 98% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited
3:00.539 default F berserking Fluffy_Pillow 48923.2/50000: 98% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, crumbling_power(20), spiraling_winds(6), forgestorm_ignited
3:00.539 single O lightning_bolt Fluffy_Pillow 48923.2/50000: 98% mana berserking, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, crumbling_power(19), spiraling_winds(6), forgestorm_ignited
3:01.632 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(19), spiraling_winds(7), forgestorm_ignited
3:02.723 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(18), spiraling_winds(7), forgestorm_ignited
3:03.815 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(17), spiraling_winds(8), forgestorm_ignited
3:04.909 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), doom_winds, legacy_of_the_frost_witch, crumbling_power(16), spiraling_winds(8), forgestorm_ignited
3:06.003 single P ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), doom_winds, crumbling_power(15), spiraling_winds(9), forgestorm_ignited
3:07.129 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, ice_strike, crumbling_power(14), spiraling_winds(10), forgestorm_ignited
3:08.253 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), doom_winds, ice_strike, crumbling_power(13), spiraling_winds(10)
3:09.379 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), spiraling_winds(10)
3:10.504 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds(10)
3:11.629 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds(10)
3:12.755 single S lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(10)
3:13.994 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(3), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(10)
3:15.233 single O lightning_bolt Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(10)
3:16.472 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(10)
3:17.711 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(10)
3:18.948 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(10)
3:20.186 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power(3), spiraling_winds(10)
3:21.427 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
3:22.665 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
3:23.903 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
3:25.142 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), spiraling_winds(10), sophic_devotion
3:26.380 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, spiraling_winds(10), sophic_devotion
3:27.619 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), spiraling_winds(10), sophic_devotion
3:28.857 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(7), spiraling_winds(10), sophic_devotion
3:30.097 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), sophic_devotion
3:31.336 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), sophic_devotion
3:32.574 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(10), sophic_devotion
3:33.814 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), legacy_of_the_frost_witch, sophic_devotion
3:35.052 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion
3:36.291 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch
3:37.531 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch
3:38.771 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), ice_strike, legacy_of_the_frost_witch
3:40.010 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch
3:41.248 single V sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch
3:42.486 default G feral_spirit Fluffy_Pillow 48980.8/50000: 98% mana flurry(2), elemental_blast_mastery, forceful_winds, stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch
3:43.724 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike
3:44.963 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), ice_strike
3:46.200 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch
3:47.439 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch
3:48.679 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch
3:49.916 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch
3:51.156 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch
3:52.395 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch
3:53.630 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch
3:54.867 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch
3:56.107 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch
3:57.346 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch
3:58.583 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds, maelstrom_weapon(2), legacy_of_the_frost_witch
3:59.820 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch
4:01.059 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch
4:02.298 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch
4:03.536 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch
4:04.774 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch
4:06.012 single K windstrike Fluffy_Pillow 48980.8/50000: 98% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch
4:07.250 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch
4:08.489 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch
4:09.692 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch
4:10.895 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch
4:12.097 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch
4:13.301 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(4), stormbringer, maelstrom_weapon(10), ice_strike
4:14.504 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike
4:15.707 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch
4:16.908 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch
4:18.111 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch
4:19.350 single R flame_shock Fluffy_Pillow 49982.4/50000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch
4:20.589 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion
4:21.829 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion
4:23.066 single V sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, sophic_devotion
4:24.303 single L stormstrike Fluffy_Pillow 48979.2/50000: 98% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, sophic_devotion
4:25.540 single L stormstrike Fluffy_Pillow 47958.4/50000: 96% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion
4:26.778 single K windstrike Fluffy_Pillow 48939.2/50000: 98% mana ascendance, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, sophic_devotion
4:28.017 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), forceful_winds(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion
4:29.254 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), forceful_winds, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion
4:30.491 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion
4:31.728 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion
4:32.968 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, legacy_of_the_frost_witch, sophic_devotion
4:34.207 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, sophic_devotion
4:35.443 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch
4:36.646 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch
4:37.849 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), doom_winds, legacy_of_the_frost_witch
4:39.052 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, spiraling_winds
4:40.255 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds
4:41.458 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(2)
4:42.660 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, spiraling_winds(3)
4:43.863 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, spiraling_winds(3)
4:45.064 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, spiraling_winds(4)
4:46.301 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(4)
4:47.539 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(5)
4:48.740 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(6)
4:49.942 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, spiraling_winds(6)
4:51.147 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(7)
4:52.351 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(8)
4:53.552 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(8)
4:54.756 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited
4:55.958 single R flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited
4:57.161 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited
4:58.400 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited
4:59.640 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, forceful_winds(3), maelstrom_weapon(9), static_accumulation, ice_strike, spiraling_winds(10), forgestorm_ignited

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 21.55% 21.55% 3663
Versatility 7.57% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAoEhkQCKCk0SSaICQikCC

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_tepid_versatility_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=40
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1&(talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|(talent.elemental_assault.enabled&talent.stormflurry.enabled)|ti_lightning_bolt)
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|((talent.elemental_assault.enabled&talent.stormflurry.enabled)&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&(buff.feral_spirit.up|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up&raid_event.adds.in>=40
actions.single+=/crash_lightning,if=buff.doom_winds.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.single+=/primordial_wave,if=raid_event.adds.in>42|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/ice_strike
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Ele : 50626 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
50626.4 50626.4 51.1 / 0.101% 8918.0 / 17.6% 79.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
604.2 602.3 Mana 0.73% 50.8 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAQSSKRSCSSIIJUSIAAAAAAAAAAAAgSESCJoJQSLJpgIEESaI

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Ele 50626
Ascendance 0 (392) 0.0% (0.8%) 2.0 180.41s 57998 56694

Stats Details: Ascendance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0234 0.0000 0.00 0.00 0.00% 56694.09 56694.09

Action Details: Ascendance

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]

Action Priority List

    default
    [H]:2.00
  • if_expr:dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1))
    Ascendance (_damage) 392 0.8% 2.0 180.41s 57998 0 Direct 2.0 49270 98204 57995 17.8% 0.0%

Stats Details: Ascendance Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 115996.12 115996.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.16% 1.64 0 2 49269.72 39505 81037 47653.34 0 79498 80965 80965 0.00%
crit 17.84% 0.36 0 2 98204.11 79010 158996 31803.90 0 158996 35031 35031 0.00%

Action Details: Ascendance Damage

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Elemental Blast 7480 14.8% 22.4 13.18s 100210 82406 Direct 22.4 83309 166921 100247 20.3% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.37 22.36 0.00 0.00 0.00 1.2161 0.0000 2241771.27 2241771.27 0.00% 82405.94 82405.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.74% 17.83 8 28 83309.04 49877 184208 83354.79 68090 102584 1485593 1485593 0.00%
crit 20.26% 4.53 0 13 166921.47 99754 360730 165715.91 0 326866 756178 756178 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.97

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [M]:1.29
  • if_expr:buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
    single
    [P]:7.98
  • if_expr:buff.maelstrom_weapon.stack>=5&charges=max_charges
    single
    [R]:13.10
  • if_expr:buff.maelstrom_weapon.stack>=5&(buff.feral_spirit.up|!talent.elemental_spirits.enabled)
Flame Shock 5129 10.1% 73.7 4.08s 20882 191431 Direct 73.7 6917 13883 8350 20.6% 0.0%
Periodic 185.7 4120 8262 4971 20.5% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 73.68 73.68 185.72 185.72 72.65 0.1091 1.6052 1538532.52 1538532.52 0.00% 5025.39 191431.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.43% 58.52 32 91 6917.31 2595 18403 6915.91 5899 8159 404791 404791 0.00%
crit 20.57% 15.16 2 33 13882.74 5735 36010 13880.20 10394 18074 210435 210435 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.45% 147.56 106 191 4120.45 27 11116 4119.98 3541 4715 608007 608007 0.00%
crit 20.55% 38.16 18 65 8261.95 646 21816 8262.36 6675 10377 315299 315299 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:1.02
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Fire damage and knocking them into the air.]

Action Priority List

    single
    [L]:0.01
  • if_expr:!ticking&talent.lashing_flames.enabled
    single
    [c]:6.37
Flametongue Weapon 0 (989) 0.0% (2.0%) 1.0 0.00s 296413 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 989 2.0% 623.6 0.77s 475 0 Direct 623.6 408 817 475 16.5% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 623.58 623.58 0.00 0.00 0.00 0.0000 0.0000 296412.58 296412.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.47% 520.49 378 664 407.75 317 1096 407.83 362 476 212227 212227 0.00%
crit 16.53% 103.10 60 160 816.58 634 2107 816.78 704 955 84186 84186 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.23

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }
Forgestorm Ignited (_damage) 1184 2.3% 27.5 8.03s 12918 0 Direct 27.5 11080 22159 12919 16.6% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.48 27.48 0.00 0.00 0.00 0.0000 0.0000 355040.92 355040.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.40% 22.92 2 68 11079.61 11080 11080 11079.61 11080 11080 253967 253967 0.00%
crit 16.60% 4.56 0 17 22159.22 22159 22159 21597.77 0 22159 101074 101074 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8917.94
  • base_dd_max:8917.94
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 3981 7.9% 37.6 7.66s 31793 25861 Direct 37.6 27209 54740 31792 16.6% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.62 37.62 0.00 0.00 0.00 1.2294 0.0000 1196020.36 1196020.36 0.00% 25861.02 25861.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.35% 31.36 14 48 27208.63 8384 87718 27236.79 22004 34836 853153 853153 0.00%
crit 16.65% 6.26 0 17 54740.49 16769 158578 54717.28 0 118973 342868 342868 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [W]:34.33
  • if_expr:buff.hailstorm.up
    single
    [a]:3.29
Ice Strike 1699 3.4% 21.2 14.06s 23998 19705 Direct 21.2 20548 41232 23998 16.7% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.25 21.25 0.00 0.00 0.00 1.2179 0.0000 509958.34 509958.34 0.00% 19705.49 19705.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.32% 17.71 7 27 20547.91 16431 55367 20542.47 17532 24556 363813 363813 0.00%
crit 16.68% 3.54 0 12 41232.00 32863 93945 40316.74 0 82196 146146 146146 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [V]:21.25
Lava Lash 8716 17.3% 60.5 4.82s 43209 35533 Direct 60.5 (60.5) 37065 74351 43209 16.5% (16.5%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.53 60.53 0.00 0.00 0.00 1.2160 0.0000 2615580.05 2615580.05 0.00% 35532.94 35532.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.52% 50.56 24 86 37065.04 19381 130602 37087.47 31274 45591 1873992 1873992 0.00%
crit 16.48% 9.97 0 25 74350.62 38762 264433 74381.94 0 113569 741589 741589 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [O]:42.39
  • if_expr:buff.hot_hand.up
    single
    [U]:0.20
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [X]:17.95
Lightning Bolt 5848 11.6% 30.8 9.24s 56843 46730 Direct 30.8 47082 94425 56843 20.6% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.83 30.83 0.00 0.00 0.00 1.2164 0.0000 1752432.26 1752432.26 0.00% 46730.28 46730.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.38% 24.47 10 42 47081.72 37854 118946 47068.85 40060 57114 1152235 1152235 0.00%
crit 20.62% 6.36 0 16 94424.93 75708 234012 94301.44 0 142641 600197 600197 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [Q]:5.67
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [S]:25.16
  • if_expr:((buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
main_hand 1435 2.8% 161.7 2.17s 2666 1431 Direct 161.7 2659 5319 2666 16.6% 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 161.74 161.74 0.00 0.00 0.00 1.8629 0.0000 431164.47 615964.95 30.00% 1431.00 1431.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.07% 108.48 68 155 2658.75 2336 4308 2657.38 2435 2953 288432 412056 30.00%
crit 16.59% 26.83 8 51 5319.43 4671 8616 5317.22 4763 6137 142732 203909 30.00%
miss 16.34% 26.42 10 47 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 728 1.4% 164.1 2.13s 1332 714 Direct 164.1 1329 2658 1332 16.6% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 164.09 164.09 0.00 0.00 0.00 1.8649 0.0000 218583.08 312269.51 30.00% 714.29 714.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.06% 110.03 69 162 1329.37 1168 2154 1328.69 1216 1492 146274 208968 30.00%
crit 16.58% 27.20 9 52 2658.40 2336 4308 2657.12 2378 3094 72309 103301 30.00%
miss 16.37% 26.86 9 58 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 156 (1813) 0.3% (3.6%) 6.8 48.02s 80363 66717 Direct 6.8 (12.4) 5903 11815 6896 16.8% (18.6%) 0.0%

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.77 6.77 0.00 0.00 0.00 1.2046 0.0000 46648.93 46648.93 0.00% 66716.59 66716.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.22% 5.63 1 8 5903.45 4871 9081 5903.42 4871 7599 33236 33236 0.00%
crit 16.78% 1.14 0 6 11815.20 9743 17987 8409.42 0 17987 13413 13413 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=false}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:1.02
  • if_expr:!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>42|raid_event.adds.in<6)
    single
    [T]:5.75
  • if_expr:raid_event.adds.in>42|raid_event.adds.in<6
    Lightning Bolt (_pw) 1657 3.3% 5.7 50.84s 87697 0 Direct 5.7 72507 145698 87694 20.8% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.67 5.67 0.00 0.00 0.00 0.0000 0.0000 497158.00 497158.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.25% 4.49 0 8 72506.79 56781 166340 72296.06 0 111573 325735 325735 0.00%
crit 20.75% 1.18 0 6 145697.79 113562 320605 106055.73 0 320605 171423 171423 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
Stormstrike 0 (1038) 0.0% (2.1%) 26.2 10.56s 11889 9585

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.24 0.00 0.00 0.00 0.00 1.2404 0.0000 0.00 0.00 0.00% 9585.46 9585.46

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [Y]:26.24
    Stormstrike (_mh) 692 1.4% 26.2 10.56s 7927 0 Direct 26.2 6807 13622 7927 16.4% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.24 26.24 0.00 0.00 0.00 0.0000 0.0000 208020.15 297179.22 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.57% 21.93 8 42 6807.23 5983 11226 6802.67 6059 7765 149298 213289 30.00%
crit 16.43% 4.31 0 14 13622.35 11966 22452 13419.86 0 21597 58722 83891 29.57%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 346 0.7% 26.2 10.56s 3962 0 Direct 26.2 3404 6808 3962 16.4% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.24 26.24 0.00 0.00 0.00 0.0000 0.0000 103986.45 148555.86 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.59% 21.94 8 40 3403.93 2991 5613 3401.31 3026 4005 74673 106678 30.00%
crit 16.41% 4.31 0 14 6807.96 5983 11226 6738.63 0 9663 29314 41878 29.68%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Sundering 676 1.3% 4.9 57.85s 41102 33440 Direct 4.9 35326 71095 41101 16.2% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.94 4.94 0.00 0.00 0.00 1.2292 0.0000 203011.38 203011.38 0.00% 33439.53 33439.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.85% 4.14 0 8 35325.76 29211 70510 35257.35 0 53631 146298 146298 0.00%
crit 16.15% 0.80 0 4 71094.94 58423 135882 40920.79 0 135882 56713 56713 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [Z]:4.94
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (1061) 0.0% (2.1%) 1.0 0.00s 317819 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 1061 2.1% 138.3 4.47s 2298 0 Direct 138.3 1971 3946 2298 16.5% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 138.32 138.32 0.00 0.00 0.00 0.0000 0.0000 317819.42 454039.32 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.47% 115.46 60 183 1971.41 1669 3131 1971.40 1805 2202 227619 325178 30.00%
crit 16.53% 22.86 7 44 3946.31 3338 6262 3947.09 3459 4749 90200 128861 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}
Windlash 364 0.7% 19.5 12.62s 5509 3772 Direct 19.5 4572 9134 5509 20.5% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.53 19.53 0.00 0.00 0.00 1.4606 0.0000 107582.38 107582.38 0.00% 3772.17 3772.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.45% 15.51 5 26 4571.85 3614 6086 4570.84 4006 5610 70929 70929 0.00%
crit 20.55% 4.01 0 12 9133.92 7228 12171 9005.92 0 12032 36653 36653 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 216 0.4% 23.1 10.63s 2766 1953 Direct 23.1 2300 4596 2766 20.3% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.11 23.11 0.00 0.00 0.00 1.4166 0.0000 63931.32 63931.32 0.00% 1952.70 1952.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.69% 18.42 9 28 2299.71 1807 3043 2299.67 2081 2772 42354 42354 0.00%
crit 20.31% 4.69 0 13 4596.01 3614 6086 4567.90 0 5913 21577 21577 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (5598) 0.0% (10.9%) 15.4 13.35s 107368 104024

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.43 0.00 0.00 0.00 0.00 1.0322 0.0000 0.00 0.00 0.00% 104023.90 104023.90

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [N]:15.43
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1&(talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|(talent.elemental_assault.enabled&talent.stormflurry.enabled)|ti_lightning_bolt)
    Windstrike (_mh) 730 1.4% 15.4 13.35s 13990 0 Direct 15.4 11999 23958 13990 16.6% 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.43 15.43 0.00 0.00 0.00 0.0000 0.0000 215935.44 215935.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.35% 12.87 6 19 11999.09 9469 15854 12000.11 10863 14657 154371 154371 0.00%
crit 16.65% 2.57 0 9 23957.88 18939 31709 22520.28 0 31340 61564 61564 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
    Windstrike Off-Hand 364 0.7% 15.4 13.35s 6985 0 Direct 15.4 5998 11994 6985 16.5% 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.43 15.43 0.00 0.00 0.00 0.0000 0.0000 107808.24 107808.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.55% 12.90 6 20 5998.02 4735 7927 5999.03 5387 7452 77345 77345 0.00%
crit 16.45% 2.54 0 9 11994.16 9469 15854 11189.21 0 15854 30463 30463 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
    Lightning Bolt (_ti) 4504 8.8% 15.4 13.35s 86393 0 Direct 15.4 71668 143616 86390 20.5% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.43 15.43 0.00 0.00 0.00 0.0000 0.0000 1333461.02 1333461.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.54% 12.28 6 19 71668.38 27786 196972 71716.45 47704 112893 879874 879874 0.00%
crit 20.46% 3.16 0 10 143615.56 56479 372110 139281.14 0 280751 453587 453587 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 403 / 82
melee 403 0.2% 35.7 1.88s 680 410 Direct 35.7 584 1167 680 16.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.65 35.65 0.00 0.00 0.00 1.6606 0.0000 24254.29 34649.87 30.00% 409.70 409.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.45% 29.75 0 46 583.74 520 976 583.64 0 734 17368 24812 30.00%
crit 16.55% 5.90 0 16 1167.44 1040 1952 1164.40 0 1595 6887 9838 29.93%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2435 / 738
melee 2435 1.5% 90.4 3.41s 2435 2095 Direct 90.4 2086 4168 2435 16.8% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.45 90.45 0.00 0.00 0.00 1.1626 0.0000 220273.23 314684.07 30.00% 2094.75 2094.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.20% 75.26 5 167 2085.60 1738 3262 2083.58 1738 2574 156954 224226 30.00%
crit 16.80% 15.19 0 45 4167.80 3477 6523 4163.22 0 5433 63319 90458 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2428 / 732
melee 2428 1.4% 89.9 3.43s 2436 2096 Direct 89.9 2086 4169 2436 16.8% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.88 89.88 0.00 0.00 0.00 1.1625 0.0000 219002.56 312868.78 30.00% 2095.90 2095.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.17% 74.76 5 171 2086.00 1738 3262 2083.72 1738 2608 155952 222794 30.00%
crit 16.83% 15.12 0 42 4169.02 3477 6523 4163.65 0 5493 63050 90074 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2428 / 730
melee 2428 1.4% 89.7 3.42s 2433 2094 Direct 89.7 2084 4165 2433 16.8% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.69 89.69 0.00 0.00 0.00 1.1623 0.0000 218255.22 311801.12 30.00% 2093.66 2093.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.21% 74.63 7 171 2084.02 1738 3262 2081.69 1738 2570 155527 222188 30.00%
crit 16.79% 15.06 0 43 4165.07 3477 6523 4159.85 0 6411 62728 89613 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Ele
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00s

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [F]:2.00
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
Bloodlust 1.0 0.00s

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [B]:1.00
Earth Elemental 1.0 306.93s

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.03 0.00 0.00 0.00 0.00 1.1794 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [b]:1.03
Feral Spirit 11.2 29.36s

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.18 0.00 0.00 0.00 0.00 1.1766 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [G]:11.18
Phial of Tepid Versatility 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371172
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Ele
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 305.75s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.50
  • if_expr:(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 180.4s 180.4s 15.0s 10.14% 93.22% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 182.1s
  • trigger_min/max:180.0s / 182.1s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s
  • uptime_min/max:8.33% / 12.50%

Stack Uptimes

  • ascendance_1:10.14%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Ashen Catalyst 60.5 125.2 4.9s 1.6s 4.1s 82.57% 98.59% 5.3 (5.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 40.7s
  • trigger_min/max:0.0s / 4.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.0s
  • uptime_min/max:74.00% / 90.06%

Stack Uptimes

  • ashen_catalyst_1:29.49%
  • ashen_catalyst_2:16.31%
  • ashen_catalyst_3:11.79%
  • ashen_catalyst_4:9.69%
  • ashen_catalyst_5:6.36%
  • ashen_catalyst_6:3.61%
  • ashen_catalyst_7:1.97%
  • ashen_catalyst_8:3.37%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4s 0.0s 12.0s 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:6.67% / 10.00%

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crackling Surge 6.2 0.0 47.5s 46.3s 15.8s 30.29% 36.79% 0.0 (0.0) 5.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 278.3s
  • trigger_min/max:7.5s / 278.3s
  • trigger_pct:84.80%
  • duration_min/max:0.0s / 43.3s
  • uptime_min/max:4.36% / 58.99%

Stack Uptimes

  • crackling_surge_1:23.87%
  • crackling_surge_2:6.28%
  • crackling_surge_3:0.13%
  • crackling_surge_4:0.01%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4s 5.5s 18.7s 12.63% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.0s
  • trigger_pct:100.00%
  • duration_min/max:17.1s / 20.0s
  • uptime_min/max:10.32% / 15.63%

Stack Uptimes

  • crumbling_power_1:0.33%
  • crumbling_power_2:0.33%
  • crumbling_power_3:0.63%
  • crumbling_power_4:0.76%
  • crumbling_power_5:0.76%
  • crumbling_power_6:0.73%
  • crumbling_power_7:0.73%
  • crumbling_power_8:0.74%
  • crumbling_power_9:0.70%
  • crumbling_power_10:0.69%
  • crumbling_power_11:0.69%
  • crumbling_power_12:0.69%
  • crumbling_power_13:0.69%
  • crumbling_power_14:0.69%
  • crumbling_power_15:0.69%
  • crumbling_power_16:0.69%
  • crumbling_power_17:0.69%
  • crumbling_power_18:0.69%
  • crumbling_power_19:0.70%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Elemental Blast: Critical Strike 7.5 0.0 38.1s 38.1s 9.8s 24.62% 0.00% 0.0 (0.0) 7.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 241.7s
  • trigger_min/max:10.0s / 241.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.65% / 47.07%

Stack Uptimes

  • elemental_blast_critical_strike_1:24.62%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.4 0.0 38.7s 38.7s 9.8s 24.23% 0.00% 0.0 (0.0) 7.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 247.5s
  • trigger_min/max:10.0s / 247.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.35% / 46.97%

Stack Uptimes

  • elemental_blast_haste_1:24.23%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.5 0.0 38.2s 38.2s 9.8s 24.55% 0.00% 0.0 (0.0) 7.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 225.4s
  • trigger_min/max:10.0s / 225.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:3.46% / 46.85%

Stack Uptimes

  • elemental_blast_mastery_1:24.55%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 303.0s 305.6s 27.5s 13.44% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 327.3s
  • trigger_min/max:300.0s / 327.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.97% / 18.18%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.44%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 9.6 1.6 32.9s 29.4s 16.7s 53.65% 0.00% 45.0 (45.0) 9.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 72.9s
  • trigger_min/max:7.0s / 52.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.4s
  • uptime_min/max:45.36% / 64.41%

Stack Uptimes

  • feral_spirit_1:53.65%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 48.4 209.1 6.2s 1.2s 4.8s 77.66% 87.91% 209.1 (449.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 51.6s
  • trigger_min/max:0.0s / 22.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.1s
  • uptime_min/max:65.76% / 89.50%

Stack Uptimes

  • flurry_1:21.96%
  • flurry_2:32.92%
  • flurry_3:22.78%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.5s 46.4s 13.0s 19.48% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 211.2s
  • trigger_min/max:0.2s / 211.2s
  • trigger_pct:98.79%
  • duration_min/max:0.0s / 55.3s
  • uptime_min/max:3.68% / 47.36%

Stack Uptimes

  • forgestorm_ignited_1:19.48%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=6558} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 34.8 33.8 8.7s 4.3s 4.5s 52.80% 91.34% 33.7 (160.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hailstorm
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 57.5s
  • trigger_min/max:0.9s / 28.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.8s
  • uptime_min/max:38.66% / 70.49%

Stack Uptimes

  • hailstorm_1:0.14%
  • hailstorm_2:0.18%
  • hailstorm_3:0.12%
  • hailstorm_4:0.10%
  • hailstorm_5:52.27%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.4 5.4 28.3s 18.1s 9.9s 34.19% 87.96% 5.4 (5.4) 10.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 178.6s
  • trigger_min/max:0.0s / 178.6s
  • trigger_pct:5.00%
  • duration_min/max:0.0s / 46.2s
  • uptime_min/max:7.34% / 62.39%

Stack Uptimes

  • hot_hand_1:34.19%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 21.2 0.1 14.1s 14.1s 3.5s 25.02% 54.14% 0.1 (0.1) 0.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.8s / 52.1s
  • trigger_min/max:8.8s / 52.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 27.4s
  • uptime_min/max:12.39% / 44.22%

Stack Uptimes

  • ice_strike_1:25.02%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 6.2 0.0 47.8s 46.7s 15.7s 30.08% 100.00% 0.0 (0.0) 5.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.0s / 315.8s
  • trigger_min/max:7.0s / 315.8s
  • trigger_pct:84.98%
  • duration_min/max:0.0s / 44.3s
  • uptime_min/max:0.00% / 56.64%

Stack Uptimes

  • icy_edge_1:23.81%
  • icy_edge_2:6.13%
  • icy_edge_3:0.12%
  • icy_edge_4:0.02%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 32.3 249.4 9.3s 1.1s 8.5s 90.95% 100.00% 6.5 (9.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 91.0s
  • trigger_min/max:0.0s / 15.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 89.8s
  • uptime_min/max:83.64% / 96.36%

Stack Uptimes

  • maelstrom_weapon_1:13.11%
  • maelstrom_weapon_2:15.35%
  • maelstrom_weapon_3:16.86%
  • maelstrom_weapon_4:17.93%
  • maelstrom_weapon_5:13.51%
  • maelstrom_weapon_6:6.83%
  • maelstrom_weapon_7:3.37%
  • maelstrom_weapon_8:1.65%
  • maelstrom_weapon_9:0.84%
  • maelstrom_weapon_10:1.51%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 6.2 0.0 47.7s 46.5s 15.8s 30.10% 100.00% 0.0 (0.0) 5.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.0s / 315.7s
  • trigger_min/max:7.0s / 315.7s
  • trigger_pct:85.03%
  • duration_min/max:0.0s / 44.1s
  • uptime_min/max:0.00% / 58.91%

Stack Uptimes

  • molten_weapon_1:23.79%
  • molten_weapon_2:6.17%
  • molten_weapon_3:0.13%
  • molten_weapon_4:0.02%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Wave 6.8 0.0 48.0s 48.0s 6.7s 15.07% 18.57% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 79.6s
  • trigger_min/max:45.0s / 79.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:5.87% / 30.15%

Stack Uptimes

  • primordial_wave_1:15.07%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=false}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.1 60.6s 45.6s 16.5s 23.75% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 207.4s
  • trigger_min/max:0.0s / 207.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 77.6s
  • uptime_min/max:5.51% / 59.00%

Stack Uptimes

  • sophic_devotion_1:23.75%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.6s 45.7s 32.0s 38.04% 0.00% 25.4 (25.4) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 245.2s
  • trigger_min/max:0.0s / 216.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 233.2s
  • uptime_min/max:8.42% / 91.41%

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.57%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 2.0 0.0 180.4s 180.4s 15.0s 10.14% 100.00% 28.0 (28.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:180.0s / 182.1s
  • trigger_min/max:180.0s / 182.1s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s
  • uptime_min/max:8.33% / 12.50%

Stack Uptimes

  • static_accumulation_1:10.14%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411={$s2=10}% chance to refund Maelstrom Weapon stacks spent on Lightning Bolt or Chain Lightning. While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 23.9 10.0 12.3s 8.6s 5.0s 39.54% 52.38% 10.0 (10.0) 1.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 133.6s
  • trigger_min/max:0.0s / 133.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.6s
  • uptime_min/max:14.46% / 66.21%

Stack Uptimes

  • stormbringer_1:39.54%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Tepid Versatility

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_phial_of_tepid_versatility
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Phial of Tepid Versatility

Stat Details

  • stat:versatility_rating
  • amount:745.00

Spelldata

  • id:371172
  • name:Phial of Tepid Versatility
  • tooltip:Versatility increased by {$=}w1.
  • description:Increases your Versatility by {$s1=315}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 25.7 9.0 48.0 11.4s 1.3s 122.5s
windfury_totem_extra_attack_oh 26.6 10.0 48.0 11.0s 1.3s 126.7s
Elemental Blast: Critical Strike 7.5 1.0 15.0 38.1s 10.0s 241.7s
Elemental Blast: Haste 7.4 1.0 15.0 38.7s 10.0s 247.5s
Elemental Blast: Mastery 7.5 1.0 17.0 38.2s 10.0s 225.4s
Maelstrom Weapon: Feral Spirit 62.1 44.0 82.0 4.8s 0.0s 37.6s
Maelstrom Weapon: Swirling Maelstrom 55.6 33.0 79.0 5.3s 1.0s 49.6s
Maelstrom Weapon: Static Accumulation 60.0 60.0 60.0 6.7s 1.0s 168.1s
Maelstrom Weapon: Static Accumulation Refund 44.4 0.0 125.0 28.9s 0.9s 296.4s
Maelstrom Weapon Swing Reset 9.8 4.0 21.0 30.8s 0.9s 188.8s
Flametongue: Windfury Attack 138.3 70.0 210.0 4.5s 0.0s 56.2s
Stormbringer: Windfury Attack 15.2 1.0 34.0 19.9s 0.0s 208.5s
Flametongue: main_hand 135.3 89.0 189.0 2.7s 1.3s 32.9s
Hot Hand: main_hand 6.8 0.0 19.0 36.8s 1.3s 317.4s
Windfury: main_hand 42.1 17.0 72.0 7.3s 1.3s 90.3s
Flametongue: Windlash 19.5 11.0 29.0 12.6s 1.3s 174.2s
Hot Hand: Windlash 1.0 0.0 6.0 81.1s 1.3s 194.5s
Windfury: Windlash 6.1 0.0 15.0 37.0s 1.3s 192.1s
Flametongue: offhand 137.2 92.0 190.0 2.6s 1.4s 32.7s
Hot Hand: offhand 6.8 0.0 18.0 36.4s 1.4s 291.6s
Flametongue: Windlash Off-Hand 23.1 18.0 32.0 10.6s 1.3s 169.7s
Hot Hand: Windlash Off-Hand 1.2 0.0 8.0 78.6s 1.3s 195.5s
Flametongue: Lava Lash 60.5 33.0 97.0 4.8s 1.0s 40.6s
Stormbringer: Lava Lash 6.6 0.0 20.0 37.5s 1.0s 288.7s
Flametongue: Windstrike 15.4 12.0 21.0 13.4s 0.9s 169.8s
Stormbringer: Windstrike 1.7 0.0 8.0 69.1s 0.9s 194.3s
Windfury: Windstrike 4.8 0.0 13.0 43.1s 0.9s 194.0s
Flametongue: Windstrike Off-Hand 15.4 12.0 21.0 13.4s 0.9s 169.8s
Stormbringer: Windstrike Off-Hand 1.7 0.0 8.0 68.5s 0.9s 194.2s
Flametongue: Sundering 4.9 1.0 8.0 57.8s 40.0s 223.8s
Stormbringer: Sundering 0.5 0.0 4.0 113.7s 40.0s 297.6s
Windfury: Sundering 1.5 0.0 6.0 96.9s 40.0s 317.4s
Flametongue: Ice Strike 21.2 14.0 28.0 14.1s 8.8s 52.1s
Stormbringer: Ice Strike 2.4 0.0 10.0 73.3s 9.0s 337.1s
Windfury: Ice Strike 6.6 0.0 15.0 40.4s 8.8s 300.5s
Flametongue: Stormstrike 26.2 12.0 46.0 10.6s 1.0s 92.6s
Stormbringer: Stormstrike 2.9 0.0 13.0 58.9s 1.0s 332.2s
Windfury: Stormstrike 8.2 0.0 21.0 30.7s 1.0s 296.2s
Flametongue: Stormstrike Off-Hand 26.2 12.0 46.0 10.6s 1.0s 92.6s
Stormbringer: Stormstrike Off-Hand 2.9 0.0 11.0 59.7s 1.0s 319.4s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 30.24% 21.26% 36.29% 0.7s 0.0s 14.3s
Hot Hand 34.19% 7.34% 62.39% 9.9s 0.0s 46.2s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.6620.0001.5247.4172.00913.595
Ascendance1.1000.0002.1132.1991.7843.900
Lava Lash1.1340.00032.49769.00128.387120.250
Primordial Wave2.6900.00034.57918.2631.34046.603
Elemental Blast1.7590.00032.79839.8258.18189.608
Windstrike
Stormstrike
2.8650.00046.671121.98248.739201.285
Sundering22.4340.000218.102116.35643.883274.720
Ice Strike2.1820.00039.38846.55515.37089.249
Frost Shock3.0770.00050.208116.80466.049190.737
Flame Shock37.2430.000320.969268.253180.050348.437
Earth Elemental60.5940.000313.66063.25121.202314.720

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack27.20.58.04%5.29%
main_hand27.00.17.99%0.98%
Windlash3.40.41.01%4.99%
offhand27.40.18.12%1.14%
Windlash Off-Hand4.10.51.22%5.53%
Feral Spirit61.11.018.08%11.33%
Ascendance54.15.916.00%66.16%
Lightning Bolt30.70.09.08%0.00%
Lava Lash11.90.23.52%1.80%
Windstrike (_mh)2.90.10.87%1.38%
Windstrike Off-Hand3.00.10.88%1.40%
Sundering1.00.00.29%0.00%
Ice Strike25.50.07.55%0.00%
Frost Shock34.30.010.16%0.00%
Stormstrike (_mh)5.30.01.56%0.00%
Stormstrike Off-Hand5.20.01.55%0.00%
Lightning Bolt (_ti)13.70.04.06%0.00%
Overflow Stacks0.09.00.00%2.59%
Actual Stacks337.90.097.41%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt154.146.05%
Elemental Blast111.933.41%
Lightning Bolt (_ti)68.820.54%
Total Spent334.8100.00%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Ele
mana_regenMana613.41180689.20100.00%294.56298675.9762.31%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 602.30 604.18 298675.4 49435.8 47000.0 50000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement_Ele
BloodlustMana 1.001000.000.55%1000.001000.000.00
Elemental BlastMana 22.3730759.9716.97%1375.001375.0172.88
Flame ShockMana 6.384783.362.64%750.0064.92321.64
Frost ShockMana 37.6218809.4910.38%500.00500.0063.59
Ice StrikeMana 21.2535062.2319.34%1650.001649.9914.54
Lava LashMana 60.5324213.7813.36%400.00400.00108.02
Lightning BoltMana 30.8315414.618.50%500.00500.00113.69
Primordial WaveMana 6.7710150.455.60%1500.001500.0153.57
StormstrikeMana 26.2426241.9714.48%1000.00999.9611.89
SunderingMana 4.9414817.628.18%3000.003000.0113.70

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Ele Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Ele Damage Per Second
Count 7499
Mean 50626.37
Minimum 44192.84
Maximum 59131.17
Spread ( max - min ) 14938.33
Range [ ( max - min ) / 2 * 100% ] 14.75%
Standard Deviation 2257.9283
5th Percentile 47058.14
95th Percentile 54556.79
( 95th Percentile - 5th Percentile ) 7498.65
Mean Distribution
Standard Deviation 26.0740
95.00% Confidence Interval ( 50575.27 - 50677.47 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 77
0.1% Error 7642
0.1 Scale Factor Error with Delta=300 43522
0.05 Scale Factor Error with Delta=300 174087
0.01 Scale Factor Error with Delta=300 4352151
Priority Target DPS
PR_Shaman_Enhancement_Ele Priority Target Damage Per Second
Count 7499
Mean 50626.37
Minimum 44192.84
Maximum 59131.17
Spread ( max - min ) 14938.33
Range [ ( max - min ) / 2 * 100% ] 14.75%
Standard Deviation 2257.9283
5th Percentile 47058.14
95th Percentile 54556.79
( 95th Percentile - 5th Percentile ) 7498.65
Mean Distribution
Standard Deviation 26.0740
95.00% Confidence Interval ( 50575.27 - 50677.47 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 77
0.1% Error 7642
0.1 Scale Factor Error with Delta=300 43522
0.05 Scale Factor Error with Delta=300 174087
0.01 Scale Factor Error with Delta=300 4352151
DPS(e)
PR_Shaman_Enhancement_Ele Damage Per Second (Effective)
Count 7499
Mean 50626.37
Minimum 44192.84
Maximum 59131.17
Spread ( max - min ) 14938.33
Range [ ( max - min ) / 2 * 100% ] 14.75%
Damage
PR_Shaman_Enhancement_Ele Damage
Count 7499
Mean 14476854.72
Minimum 10724161.73
Maximum 18949606.15
Spread ( max - min ) 8225444.42
Range [ ( max - min ) / 2 * 100% ] 28.41%
DTPS
PR_Shaman_Enhancement_Ele Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Ele Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Ele Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Ele Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Ele Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Ele Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_EleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Ele Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
9 0.00 variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
A 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 bloodlust,line_cd=600
C 1.50 potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
D 1.00 auto_attack
0.00 use_item,name=elementium_pocket_anvil,use_off_gcd=1
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
E 2.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
0.00 use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
0.00 use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
0.00 use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
0.00 blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
F 2.00 berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
0.00 invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
G 11.18 feral_spirit
H 2.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1))
0.00 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
K 1.02 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>42|raid_event.adds.in<6)
L 0.01 flame_shock,if=!ticking&talent.lashing_flames.enabled
M 1.29 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=40
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
N 15.43 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1&(talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|(talent.elemental_assault.enabled&talent.stormflurry.enabled)|ti_lightning_bolt)
0.00 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|((talent.elemental_assault.enabled&talent.stormflurry.enabled)&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack)
O 42.39 lava_lash,if=buff.hot_hand.up
0.00 windfury_totem,if=!buff.windfury_totem.up
P 7.98 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
Q 5.67 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
R 13.10 elemental_blast,if=buff.maelstrom_weapon.stack>=5&(buff.feral_spirit.up|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
S 25.16 lightning_bolt,if=((buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 ice_strike,if=buff.doom_winds.up
0.00 sundering,if=buff.doom_winds.up&raid_event.adds.in>=40
0.00 crash_lightning,if=buff.doom_winds.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
T 5.75 primordial_wave,if=raid_event.adds.in>42|raid_event.adds.in<6
0.00 flame_shock,if=!ticking
U 0.20 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
V 21.25 ice_strike
W 34.33 frost_shock,if=buff.hailstorm.up
X 17.95 lava_lash
0.00 windstrike
Y 26.24 stormstrike
Z 4.94 sundering,if=raid_event.adds.in>=40
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
0.00 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
a 3.29 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
b 1.03 earth_elemental
c 6.37 flame_shock
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234789BCDEFGKHNPNVNQNONNOGMNNORVWSYXWYSSWVSGRWSXYWSSVWRXOWOSOTVQWXGRWYZXVRWSYbWOcOSOSSVWGRXWRYYWSTVQWXSSWYOYOSGOVPWYZRWXSYVWcOYOSOWYOTOVOYPWGQXWYRVOWOROOWOSOVOSOWOYEFSHGNNONONNONOGMORTVWQXYWZScWVXOSOWOYYXVOPOWGORWYSVWOROTOWOQVWYSXWZYcaVXYGPWcYRWVSSWRXYSWYVSGTQR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Ele 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Ele 50000.0/50000: 100% mana
Pre precombat 2 augmentation PR_Shaman_Enhancement_Ele 50000.0/50000: 100% mana
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Ele 50000.0/50000: 100% mana flurry(3)
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Ele 50000.0/50000: 100% mana flurry(3)
Pre precombat 9 min_talented_cd_remains PR_Shaman_Enhancement_Ele 50000.0/50000: 100% mana flurry(3)
0:00.000 default B bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3)
0:00.000 default C potion Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(3)
0:00.000 default D auto_attack Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(3), elemental_potion_of_ultimate_power
0:00.000 default E use_item_irideus_fragment Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(2), elemental_potion_of_ultimate_power
0:00.000 default F berserking Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(2), crumbling_power(20), elemental_potion_of_ultimate_power
0:00.000 default G feral_spirit Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, berserking, flurry(2), crumbling_power(19), elemental_potion_of_ultimate_power
0:00.894 single K primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon, crumbling_power(19), elemental_potion_of_ultimate_power
0:01.789 default H ascendance Fluffy_Pillow 49932.0/50000: 100% mana bloodlust, berserking, primordial_wave, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(2), crumbling_power(18), elemental_potion_of_ultimate_power
0:02.683 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(2), static_accumulation, crumbling_power(17), elemental_potion_of_ultimate_power
0:03.578 single P elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5), hailstorm(2), static_accumulation, crumbling_power(16), elemental_potion_of_ultimate_power
0:04.473 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(5), static_accumulation, crumbling_power(15), elemental_potion_of_ultimate_power
0:05.368 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), hailstorm(5), static_accumulation, crumbling_power(14), elemental_potion_of_ultimate_power
0:06.262 single N windstrike Fluffy_Pillow 49780.4/50000: 100% mana bloodlust, berserking, ascendance, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(8), hailstorm(5), static_accumulation, ice_strike, crumbling_power(13), elemental_potion_of_ultimate_power
0:07.157 single Q lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(10), hailstorm(5), static_accumulation, ice_strike, crumbling_power(12), elemental_potion_of_ultimate_power
0:08.051 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(7), hailstorm(5), static_accumulation, ice_strike, crumbling_power(11), elemental_potion_of_ultimate_power
0:08.947 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), hot_hand, maelstrom_weapon(5), hailstorm(5), static_accumulation, ice_strike, crumbling_power(10), elemental_potion_of_ultimate_power
0:09.840 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(8), hailstorm(5), static_accumulation, ice_strike, crumbling_power(9), elemental_potion_of_ultimate_power
0:10.735 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(5), static_accumulation, ice_strike, crumbling_power(8), elemental_potion_of_ultimate_power
0:11.627 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), hailstorm(5), static_accumulation, ice_strike, crumbling_power(7), elemental_potion_of_ultimate_power
0:12.523 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(5), static_accumulation, ice_strike, crumbling_power(6), elemental_potion_of_ultimate_power
0:13.507 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(8), hailstorm(5), static_accumulation, ice_strike, crumbling_power(5), elemental_potion_of_ultimate_power
0:14.492 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, crackling_surge(2), ashen_catalyst(3), hot_hand, maelstrom_weapon(5), hailstorm(5), static_accumulation, ice_strike, crumbling_power(4), elemental_potion_of_ultimate_power
0:15.476 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5), static_accumulation, ice_strike, crumbling_power(3), elemental_potion_of_ultimate_power
0:16.459 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), hot_hand, maelstrom_weapon(3), hailstorm(5), static_accumulation, ice_strike, crumbling_power(2), elemental_potion_of_ultimate_power
0:17.442 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(6), hailstorm(5), crumbling_power, elemental_potion_of_ultimate_power
0:18.425 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon, hailstorm(5), elemental_potion_of_ultimate_power
0:19.408 single W frost_shock Fluffy_Pillow 49922.8/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), hailstorm(5), ice_strike, elemental_potion_of_ultimate_power
0:20.393 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(5), elemental_potion_of_ultimate_power
0:21.377 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), hailstorm(5), elemental_potion_of_ultimate_power
0:22.361 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon, hailstorm(5), elemental_potion_of_ultimate_power
0:23.345 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(5), elemental_potion_of_ultimate_power
0:24.329 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(3), elemental_potion_of_ultimate_power
0:25.312 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), elemental_potion_of_ultimate_power
0:26.295 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(6), hailstorm(5), elemental_potion_of_ultimate_power
0:27.280 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon, hailstorm(5), elemental_potion_of_ultimate_power
0:28.264 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), ashen_catalyst(4), maelstrom_weapon(3), elemental_potion_of_ultimate_power
0:29.247 single S lightning_bolt Fluffy_Pillow 49922.8/50000: 100% mana bloodlust, flurry(2), ashen_catalyst(5), maelstrom_weapon(5), ice_strike, elemental_potion_of_ultimate_power
0:30.231 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, ashen_catalyst(6), maelstrom_weapon(6), hailstorm(5), ice_strike
0:31.214 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(7), maelstrom_weapon(7), hailstorm(5), ice_strike
0:32.196 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(7), stormbringer, maelstrom_weapon(3), hailstorm(5), ice_strike
0:33.150 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(8), stormbringer, maelstrom_weapon(5)
0:34.104 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(8), stormbringer, maelstrom_weapon, hailstorm(5)
0:35.058 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, maelstrom_weapon, hailstorm(5)
0:36.013 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(2), hailstorm(5)
0:36.967 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(5)
0:37.920 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(5), hailstorm(5)
0:38.873 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), stormbringer, hailstorm(5)
0:39.827 single W frost_shock Fluffy_Pillow 49876.4/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), stormbringer, maelstrom_weapon(4), hailstorm(5), ice_strike
0:40.783 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), stormbringer, maelstrom_weapon(5)
0:42.022 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(6), stormbringer, maelstrom_weapon, hailstorm(5)
0:43.299 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5)
0:44.577 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5)
0:46.098 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(5)
0:47.375 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), sophic_devotion
0:48.652 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(5), sophic_devotion
0:49.929 single T primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(5), sophic_devotion
0:51.207 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst, stormbringer, maelstrom_weapon(3), hailstorm(5), sophic_devotion
0:52.484 single Q lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, ashen_catalyst(2), maelstrom_weapon(6), hailstorm(5), ice_strike, sophic_devotion
0:53.759 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon, hailstorm(5), ice_strike, sophic_devotion
0:55.035 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(3), sophic_devotion
0:56.312 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(4), sophic_devotion
0:57.591 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(5), sophic_devotion
0:58.868 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hailstorm(5), sophic_devotion
1:00.146 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(2), sophic_devotion
1:01.421 single Z sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon(3)
1:02.698 single X lava_lash Fluffy_Pillow 49043.2/50000: 98% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_weapon(4)
1:03.994 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(4)
1:05.270 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(7), ice_strike
1:06.546 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(3), hailstorm(5), ice_strike
1:07.785 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(5)
1:09.026 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon, hailstorm(5)
1:10.268 single b earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon, hailstorm(5)
1:11.508 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(5), maelstrom_weapon(2), hailstorm(5)
1:12.748 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(6), hot_hand, maelstrom_weapon(3)
1:13.990 single c flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(3)
1:15.231 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(5)
1:16.470 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7)
1:17.746 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(5)
1:19.024 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(5)
1:20.302 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, stormbringer, maelstrom_weapon(8), hailstorm(5)
1:21.579 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), stormbringer, maelstrom_weapon(3), hailstorm(5)
1:22.857 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), stormbringer, maelstrom_weapon(4), hailstorm(5), ice_strike
1:24.135 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), stormbringer, maelstrom_weapon(5)
1:25.590 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(6)
1:26.866 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon, hailstorm(5)
1:28.142 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(4), hailstorm(5)
1:29.419 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5)
1:30.694 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(5)
1:31.933 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(3), hailstorm(5), forgestorm_ignited
1:33.175 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(3), hailstorm(5), forgestorm_ignited
1:34.414 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(5), forgestorm_ignited
1:35.652 single T primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), stormbringer, hailstorm(5), forgestorm_ignited
1:36.892 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), stormbringer, maelstrom_weapon(3), hailstorm(5), forgestorm_ignited
1:38.132 single Q lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), stormbringer, maelstrom_weapon(5), hailstorm(5), ice_strike, forgestorm_ignited
1:39.371 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(8), stormbringer, maelstrom_weapon, hailstorm(5), ice_strike, forgestorm_ignited
1:40.609 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(8), stormbringer, maelstrom_weapon(4), forgestorm_ignited
1:41.884 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), stormbringer, maelstrom_weapon(5), forgestorm_ignited
1:43.160 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, stormbringer, maelstrom_weapon(6), hailstorm(5)
1:44.436 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon, hailstorm(5), forgestorm_ignited
1:45.736 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(2), spiraling_winds, forgestorm_ignited
1:47.014 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(4), spiraling_winds(2), forgestorm_ignited
1:48.292 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), spiraling_winds(2), forgestorm_ignited
1:49.568 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), hot_hand, maelstrom_weapon(5), spiraling_winds(3), forgestorm_ignited
1:50.846 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(6), spiraling_winds(4), forgestorm_ignited
1:52.123 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(5), spiraling_winds(4), forgestorm_ignited
1:53.590 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(5), spiraling_winds(5), forgestorm_ignited
1:54.866 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(5), spiraling_winds(6), forgestorm_ignited
1:56.145 single P elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(6), hailstorm(5), ice_strike, spiraling_winds(6)
1:57.422 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(2), hailstorm(5), ice_strike, spiraling_winds(7)
1:58.661 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), spiraling_winds(8)
1:59.899 single Z sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), spiraling_winds(8)
2:01.138 single R elemental_blast Fluffy_Pillow 48982.4/50000: 98% mana elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(5), spiraling_winds(9)
2:02.376 single W frost_shock Fluffy_Pillow 49588.2/50000: 99% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(3), hailstorm(5), spiraling_winds(9)
2:03.614 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), maelstrom_weapon(4), spiraling_winds(10)
2:04.853 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(5), spiraling_winds(10)
2:06.092 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hailstorm(5), spiraling_winds(10)
2:07.332 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon, hailstorm(5), spiraling_winds(10)
2:08.608 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(3), hailstorm(5), ice_strike, spiraling_winds(10)
2:09.885 single c flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(4), maelstrom_weapon(4)
2:11.160 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), hot_hand, maelstrom_weapon(4)
2:12.436 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, hot_hand, maelstrom_weapon(4)
2:13.730 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, maelstrom_weapon(5)
2:15.006 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(6)
2:16.282 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(5)
2:17.559 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(5)
2:18.833 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(2)
2:20.109 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3)
2:21.386 single T primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3)
2:22.663 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3)
2:23.939 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, hot_hand, stormbringer, maelstrom_weapon(3)
2:25.214 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), ice_strike
2:26.491 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), ice_strike
2:27.767 single P elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, ashen_catalyst(2), maelstrom_weapon(7), ice_strike
2:29.043 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, primordial_wave, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(5), ice_strike
2:30.319 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, primordial_wave, ashen_catalyst(3), maelstrom_weapon(3)
2:31.598 single Q lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(5)
2:32.876 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(5), stormbringer, hailstorm(5)
2:34.153 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), stormbringer, maelstrom_weapon, hailstorm(5), forgestorm_ignited
2:35.429 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon(3), forgestorm_ignited
2:36.705 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(5), forgestorm_ignited
2:37.981 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon, hailstorm(5), forgestorm_ignited
2:39.259 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5), ice_strike, forgestorm_ignited
2:40.536 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(5), ice_strike, forgestorm_ignited
2:41.812 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), forgestorm_ignited
2:43.088 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), forgestorm_ignited
2:44.365 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5), forgestorm_ignited
2:45.604 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(5), spiraling_winds
2:46.843 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(5), spiraling_winds(2)
2:48.082 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon(6), spiraling_winds(2)
2:49.322 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, hot_hand, maelstrom_weapon(8), spiraling_winds(3)
2:50.562 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(5), spiraling_winds(4)
2:51.801 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(5), spiraling_winds(4)
2:53.041 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon(7), hailstorm(5), ice_strike, spiraling_winds(5), sophic_devotion
2:54.280 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), hot_hand, maelstrom_weapon(7), hailstorm(5), ice_strike, spiraling_winds(5), sophic_devotion
2:55.555 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(5), ice_strike, spiraling_winds(6), sophic_devotion
2:56.832 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(5), ice_strike, spiraling_winds(7), sophic_devotion
2:58.109 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(2), hot_hand, maelstrom_weapon(3), spiraling_winds(7), sophic_devotion
2:59.384 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(3), spiraling_winds(8), sophic_devotion
3:00.661 default E use_item_irideus_fragment Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, stormbringer, maelstrom_weapon(6), spiraling_winds(9), sophic_devotion
3:00.661 default F berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, stormbringer, maelstrom_weapon(6), crumbling_power(20), spiraling_winds(9), sophic_devotion
3:00.661 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), ashen_catalyst, stormbringer, maelstrom_weapon(6), crumbling_power(19), spiraling_winds(9), sophic_devotion
3:01.822 default H ascendance Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), ashen_catalyst(2), stormbringer, maelstrom_weapon, hailstorm(5), crumbling_power(19), spiraling_winds(9), sophic_devotion
3:02.984 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(5), static_accumulation, crumbling_power(18), spiraling_winds(10), sophic_devotion
3:04.143 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(5), static_accumulation, crumbling_power(17), spiraling_winds(10), sophic_devotion
3:05.305 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(5), static_accumulation, crumbling_power(16), spiraling_winds(10), sophic_devotion
3:06.466 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), hot_hand, maelstrom_weapon(9), hailstorm(5), static_accumulation, crumbling_power(15), spiraling_winds(10), sophic_devotion
3:07.627 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(5), static_accumulation, crumbling_power(14), spiraling_winds(10), sophic_devotion
3:08.787 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), hailstorm(5), static_accumulation, crumbling_power(13), spiraling_winds(10)
3:09.948 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(5), static_accumulation, crumbling_power(12)
3:11.109 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), hailstorm(5), static_accumulation, crumbling_power(11)
3:12.271 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hot_hand, maelstrom_weapon(6), hailstorm(5), static_accumulation, crumbling_power(10)
3:13.432 single N windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, icy_edge, crackling_surge, hot_hand, maelstrom_weapon(9), hailstorm(5), static_accumulation, crumbling_power(9)
3:14.775 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), hailstorm(5), static_accumulation, crumbling_power(8)
3:16.051 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(5), static_accumulation, crumbling_power(7)
3:17.327 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge(3), crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(5), crumbling_power(6)
3:18.604 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(5), crumbling_power(5)
3:19.880 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon(6), hailstorm(5), crumbling_power(4)
3:21.157 single T primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon, hailstorm(5)
3:22.395 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(2), hailstorm(5)
3:23.634 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(4), hailstorm(5), ice_strike
3:24.875 single Q lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(5)
3:26.113 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(5), stormbringer, maelstrom_weapon, hailstorm(5)
3:27.352 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon, hailstorm(5)
3:28.590 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(2), hailstorm(5)
3:29.830 single Z sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(4)
3:31.069 single S lightning_bolt Fluffy_Pillow 48982.4/50000: 98% mana flurry, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(5)
3:32.345 single c flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(4), hailstorm(5)
3:33.622 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(4), maelstrom_weapon, hailstorm(5)
3:34.918 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(5), maelstrom_weapon(2)
3:36.195 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(6), maelstrom_weapon(3), ice_strike
3:37.472 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(4), ice_strike
3:38.749 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), hot_hand, stormbringer, maelstrom_weapon(5), ice_strike
3:40.025 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, stormbringer, hailstorm(5), ice_strike
3:41.302 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, stormbringer, hailstorm(5), ice_strike
3:42.578 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon
3:43.855 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, hot_hand, stormbringer, maelstrom_weapon
3:45.131 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, stormbringer, maelstrom_weapon(3)
3:46.407 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(2), maelstrom_weapon(3)
3:47.684 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(4)
3:48.959 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(5), ice_strike
3:50.236 single P elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, maelstrom_weapon(6), ice_strike
3:51.513 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(5), ice_strike
3:52.790 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(5), ice_strike
3:54.067 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3)
3:55.343 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4)
3:56.619 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon(5)
3:57.896 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon, hailstorm(5)
3:59.134 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(3)
4:00.374 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(5)
4:01.614 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(4), hailstorm(5)
4:02.854 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon, hailstorm(5), ice_strike
4:04.092 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(5), hot_hand, maelstrom_weapon(5)
4:05.332 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(5)
4:06.573 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(2), hailstorm(5)
4:07.814 single T primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(5)
4:09.091 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, primordial_wave, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), hailstorm(5)
4:10.367 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, primordial_wave, hot_hand, maelstrom_weapon(4), hailstorm(5)
4:11.644 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, primordial_wave, ashen_catalyst, hot_hand, maelstrom_weapon(5)
4:12.921 single Q lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, primordial_wave, ashen_catalyst, maelstrom_weapon(6)
4:14.197 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon, hailstorm(5)
4:15.473 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(2), hailstorm(5), ice_strike
4:16.748 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(3), stormbringer, maelstrom_weapon(4)
4:18.024 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), maelstrom_weapon(5)
4:19.299 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), hailstorm(5)
4:20.575 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon, hailstorm(5)
4:21.850 single Z sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(2)
4:23.125 single Y stormstrike Fluffy_Pillow 49040.0/50000: 98% mana ashen_catalyst(2), maelstrom_weapon(2)
4:24.401 single c flame_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), maelstrom_weapon(2)
4:25.678 single a frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), maelstrom_weapon(2)
4:26.955 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(2)
4:28.231 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), stormbringer, maelstrom_weapon(4), ice_strike
4:29.506 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, stormbringer, maelstrom_weapon(4), ice_strike
4:30.785 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(5), ice_strike
4:32.060 single P elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), ice_strike
4:33.338 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(5), ice_strike
4:34.615 single c flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4)
4:35.891 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4)
4:37.168 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(7)
4:38.443 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(2), hailstorm(5)
4:39.720 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), stormbringer, maelstrom_weapon(4)
4:40.996 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), stormbringer, maelstrom_weapon(6), ice_strike
4:42.273 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(8), stormbringer, maelstrom_weapon(8), hailstorm(5), ice_strike
4:43.549 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(8), stormbringer, maelstrom_weapon(4), hailstorm(5), ice_strike
4:44.825 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(8), stormbringer, maelstrom_weapon(5)
4:46.103 single X lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst(8), stormbringer, maelstrom_weapon, hailstorm(5)
4:47.382 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst, stormbringer, maelstrom_weapon(4), hailstorm(5), forgestorm_ignited
4:48.659 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), hailstorm(5), forgestorm_ignited
4:49.934 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(3), stormbringer, maelstrom_weapon, hailstorm(5), forgestorm_ignited
4:51.213 single Y stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(3), stormbringer, maelstrom_weapon(3), forgestorm_ignited
4:52.489 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(4), maelstrom_weapon(4), forgestorm_ignited
4:53.765 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(5), stormbringer, maelstrom_weapon(6), ice_strike, forgestorm_ignited
4:55.042 default G feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(6), stormbringer, maelstrom_weapon(3), hailstorm(5), ice_strike, forgestorm_ignited
4:56.320 single T primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), stormbringer, maelstrom_weapon(4), hailstorm(5), ice_strike, forgestorm_ignited
4:57.597 single Q lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(7), stormbringer, maelstrom_weapon(5), hailstorm(5), ice_strike, forgestorm_ignited
4:58.873 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(8), stormbringer, maelstrom_weapon(6), hailstorm(5), ice_strike, forgestorm_ignited

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.82% 15.82% 1047
Haste 17.84% 17.84% 3032
Versatility 7.57% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 58.69% 58.69% 3842
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +519 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Ele"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAQSSKRSCSSIIJUSIAAAAAAAAAAAAgSESCJoJQSLJpgIEESaI

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_tepid_versatility_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.algethar_puzzle_box|trinket.1.is.manic_grieftorch|trinket.1.is.elementium_pocket_anvil|trinket.1.is.beacon_to_the_beyond
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.algethar_puzzle_box|trinket.2.is.manic_grieftorch|trinket.2.is.elementium_pocket_anvil|trinket.2.is.beacon_to_the_beyond
actions.precombat+=/variable,name=min_talented_cd_remains,value=((cooldown.feral_spirit.remains%(1+1.5*talent.witch_doctors_ancestry.rank))+1000*!talent.feral_spirit.enabled)<?(cooldown.doom_winds.remains+1000*!talent.doom_winds.enabled)<?(cooldown.ascendance.remains+1000*!talent.ascendance.enabled)
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%300<=30)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/auto_attack
actions+=/use_item,name=elementium_pocket_anvil,use_off_gcd=1
actions+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(talent.ascendance.enabled&(cooldown.ascendance.remains<2*action.stormstrike.gcd))|(fight_remains%%180<=30)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&trinket.1.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.1.cooldown.duration<=trinket.1.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.1.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&trinket.2.has_use_buff&(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%trinket.2.cooldown.duration<=trinket.2.buff.any.duration)|(variable.min_talented_cd_remains>=trinket.2.cooldown.duration)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/use_item,name=beacon_to_the_beyond,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%150<=5)
actions+=/use_item,name=manic_grieftorch,use_off_gcd=1,if=(!buff.ascendance.up&!buff.feral_spirit.up&!buff.doom_winds.up)|(fight_remains%%120<=5)
actions+=/use_item,slot=trinket1,if=!variable.trinket1_is_weird&!trinket.1.has_use_buff
actions+=/use_item,slot=trinket2,if=!variable.trinket2_is_weird&!trinket.2.has_use_buff
actions+=/blood_fury,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.blood_fury.cooldown<=action.blood_fury.duration)|(variable.min_talented_cd_remains>=action.blood_fury.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/berserking,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.berserking.cooldown<=action.berserking.duration)|(variable.min_talented_cd_remains>=action.berserking.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/fireblood,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.fireblood.cooldown<=action.fireblood.duration)|(variable.min_talented_cd_remains>=action.fireblood.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/ancestral_call,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%action.ancestral_call.cooldown<=action.ancestral_call.duration)|(variable.min_talented_cd_remains>=action.ancestral_call.cooldown)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/invoke_external_buff,name=power_infusion,if=(buff.ascendance.up|buff.feral_spirit.up|buff.doom_winds.up|(fight_remains%%120<=20)|(variable.min_talented_cd_remains>=120)|(!talent.ascendance.enabled&!talent.feral_spirit.enabled&!talent.doom_winds.enabled))
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=talent.crashing_storms.enabled&((talent.unruly_winds.enabled&active_enemies>=10)|active_enemies>=15)
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=40
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1&(talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|(talent.elemental_assault.enabled&talent.stormflurry.enabled)|ti_lightning_bolt)
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|((talent.elemental_assault.enabled&talent.stormflurry.enabled)&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&(buff.feral_spirit.up|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up&raid_event.adds.in>=40
actions.single+=/crash_lightning,if=buff.doom_winds.up|(talent.alpha_wolf.enabled&feral_spirit.active&alpha_wolf_min_remains=0)
actions.single+=/primordial_wave,if=raid_event.adds.in>42|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/ice_strike
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1047
# gear_haste_rating=3032
# gear_mastery_rating=3842
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 226685959
Max Event Queue: 273
Sim Seconds: 2250296
CPU Seconds: 204.7224
Physical Seconds: 102.8122
Speed Up: 10992

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.51sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 159010 530 7.65 3157 6332 38.2 38.2 31.5% 0.0% 0.0% 0.0% 6.91sec 159010 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost antimagic_shell 48707 49514 165 0.62 16014 0 7.4 3.1 0.0% 0.0% 0.0% 0.0% 43.47sec 49514 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 145.66sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 792829 2643 38.27 3598 7200 191.4 191.4 31.4% 16.3% 0.0% 0.0% 1.83sec 1132642 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 386572 1289 37.43 1799 3599 187.2 187.2 31.5% 16.7% 0.0% 0.0% 1.83sec 552259 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost blood_draw 374606 28994 97 0.40 11061 22151 2.0 2.0 31.0% 0.0% 0.0% 0.0% 179.75sec 28994 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.51sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_tick 155166 3010258 10034 26.63 17227 34331 133.1 133.1 31.5% 0.0% 0.0% 0.0% 2.01sec 3010258 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 205883 686 0.53 58983 118252 2.8 2.7 30.8% 0.0% 0.0% 0.0% 119.21sec 205883 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay 43265 3526 12 1.29 417 835 0.6 6.4 31.1% 0.0% 0.0% 0.0% 80.36sec 3526 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 324802 1083 1.50 33171 66341 7.5 7.5 30.8% 0.0% 0.0% 0.0% 48.06sec 464015 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 82.90sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 751654 2506 19.74 5802 11565 60.4 98.7 31.5% 0.0% 0.0% 0.0% 4.94sec 751654 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 49143 733634 2445 8.67 12903 25687 43.4 43.4 31.4% 0.0% 0.0% 0.0% 5.02sec 733634 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 366934 1223 8.67 6445 12873 43.4 43.4 31.4% 0.0% 0.0% 0.0% 5.02sec 366934 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 76.34sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 1972439 6575 12.08 24879 49598 60.4 60.4 31.4% 0.0% 0.0% 0.0% 4.94sec 1972439 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 390179 1301 12.08 4919 9812 60.4 60.4 31.5% 0.0% 0.0% 0.0% 4.94sec 390179 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 385109 1284 9.82 5975 11961 49.1 49.1 31.2% 0.0% 0.0% 0.0% 5.98sec 550169 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 192579 642 9.82 2988 5977 49.1 49.1 31.2% 0.0% 0.0% 0.0% 5.98sec 275120 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1672846 5576 11.39 0 29366 57.0 57.0 100.0% 0.0% 0.0% 0.0% 5.21sec 1672846 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 836423 2788 11.39 0 14683 57.0 57.0 100.0% 0.0% 0.0% 0.0% 5.21sec 836423 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost overwhelming_rage ticks -374037 265300 884 3.93 13495 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.80sec 325123 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 36.04sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 304.43sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.69sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 20.39sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1713068 5710 47.92 5442 10875 239.6 239.6 31.4% 0.0% 0.0% 0.0% 1.25sec 1713068 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 60956 203 4.04 2296 4593 20.2 20.2 31.3% 0.0% 0.0% 0.0% 14.40sec 87082 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 60913 203 4.04 2296 4593 20.2 20.2 31.4% 0.0% 0.0% 0.0% 14.48sec 87021 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.1 0.0 0.0% 0.0% 0.0% 0.0% 14.50sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul auto_attack 0 223405 1364 34.89 1784 3568 95.2 95.2 31.5% 0.0% 0.0% 0.0% 2.91sec 319158 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 109877 671 19.31 1586 3173 52.7 52.7 31.4% 0.0% 0.0% 0.0% 5.34sec 156971 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 200 1 1.07 52 104 2.9 2.9 31.7% 0.0% 0.0% 0.0% 120.69sec 286 163.79sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy algethar_puzzle_box_channel 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy antimagic_shell 48707 50491 168 0.64 15824 0 7.1 3.2 0.0% 0.0% 0.0% 0.0% 44.54sec 50491 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 64955 217 1.37 7874 15747 6.9 6.9 20.4% 0.0% 0.0% 0.0% 46.11sec 64955 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 859983 2867 30.88 4628 9250 154.4 154.4 20.4% 0.0% 0.0% 0.0% 2.34sec 1228578 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.45sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy blood_draw 374606 27342 91 0.40 11258 22345 2.0 2.0 21.8% 0.0% 0.0% 0.0% 0.00sec 27342 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy clawing_shadows 207311 1759337 5864 14.66 19961 39956 73.3 73.3 20.2% 0.0% 0.0% 0.0% 3.95sec 1759337 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 60857 203 1.39 7278 14567 6.9 6.9 20.3% 0.0% 0.0% 0.0% 46.13sec 60857 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_and_decay 43265 69751 233 18.13 639 1278 8.4 90.7 20.4% 0.0% 0.0% 0.0% 37.48sec 69751 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 1685472 5618 19.96 14036 28050 99.9 99.8 20.3% 0.0% 0.0% 0.0% 2.97sec 1685472 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 496763 1656 27.20 3652 0 0.0 136.0 0.0% 0.0% 0.0% 0.0% 0.00sec 496763 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 219379 731 1.09 33373 66746 5.5 5.5 20.3% 0.0% 0.0% 0.0% 46.67sec 313407 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 169.53sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 331131 1104 5.00 11002 22006 25.0 25.0 20.5% 0.0% 0.0% 0.0% 11.98sec 473056 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 563572 1879 20.14 4650 9299 100.7 100.7 20.4% 0.0% 0.0% 0.0% 3.66sec 563572 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 23641 79 2.32 1690 3381 11.6 11.6 20.3% 0.0% 0.0% 0.0% 27.05sec 23641 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak_aoe 196780 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 27.05sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy overwhelming_rage ticks -374037 261988 873 3.95 13268 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.38sec 323796 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 172566 575 3.13 9191 18389 15.6 15.6 20.1% 0.0% 0.0% 0.0% 6.86sec 172566 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 835331 2784 3.12 44366 88764 15.6 15.6 20.5% 0.0% 0.0% 0.0% 6.86sec 835331 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.43sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 59381 198 0.73 13572 27121 3.6 3.6 20.4% 0.0% 0.0% 0.0% 91.71sec 59381 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 21.9 0.0 0.0% 0.0% 0.0% 0.0% 13.38sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 252268 841 19.90 2105 4211 11.6 99.5 20.4% 0.0% 0.0% 0.0% 27.05sec 252268 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul auto_attack 0 1350353 4501 39.08 5747 11476 195.4 195.4 20.3% 0.0% 0.0% 0.0% 1.53sec 1929125 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 101036 337 7.60 2210 4420 38.0 38.0 20.3% 0.0% 0.0% 0.0% 8.04sec 144341 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 353 1 0.75 78 157 3.7 3.7 20.6% 0.0% 0.0% 0.0% 90.15sec 504 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 431535 1438 13.86 5170 10333 69.3 69.3 20.4% 0.0% 0.0% 0.0% 4.22sec 431535 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 1366682 27334 38.40 35522 70960 32.0 32.0 20.3% 0.0% 0.0% 0.0% 6.62sec 1366682 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul auto_attack 0 1428522 24272 373.94 3237 6468 366.8 366.8 20.3% 0.0% 0.0% 0.0% 0.66sec 2040798 58.85sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 278213 4727 224.18 1051 2101 219.9 219.9 20.4% 0.0% 0.0% 0.0% 1.21sec 397457 58.85sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead frostbolt 317792 224830 2368 17.62 6711 13396 27.9 27.9 20.2% 0.0% 0.0% 0.0% 10.79sec 224830 94.96sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead shadow_bolt 317791 905175 9532 70.94 6700 13395 112.3 112.3 20.3% 0.0% 0.0% 0.0% 2.60sec 905175 94.96sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul auto_attack 0 1054816 7960 131.67 3015 6030 290.8 290.8 20.3% 0.0% 0.0% 0.0% 3.84sec 1506918 132.51sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 236237 1783 89.80 990 1980 198.3 198.3 20.3% 0.0% 0.0% 0.0% 5.69sec 337490 132.51sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow desperate_prayer 19236 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 1964504 6548 47.00 7379 14790 235.0 235.0 13.2% 0.0% 0.0% 0.0% 1.27sec 1964504 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 197236 657 1.27 27134 54713 6.4 6.4 14.0% 0.0% 0.0% 0.0% 10.10sec 197236 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage ticks -32409 214423 715 1.25 29885 60840 6.4 6.3 14.1% 0.0% 0.0% 0.0% 10.10sec 221314 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 310450 1035 16.02 3876 0 7.1 80.1 0.0% 0.0% 0.0% 0.0% 37.69sec 310450 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 543702 1812 25.57 3751 7519 13.5 127.8 13.3% 0.0% 0.0% 0.0% 21.05sec 543702 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 127.8 0.0 0.0% 0.0% 0.0% 0.0% 2.33sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ascendance_dre 114051 0 0 0.00 0 0 8.2 0.0 0.0% 0.0% 0.0% 0.0% 34.44sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ascendance_damage_dre 344548 318007 1060 1.64 32627 65123 8.2 8.2 18.7% 0.0% 0.0% 0.0% 34.44sec 318007 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement doom_winds 384352 26264 88 0.75 7037 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.41sec 37521 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 308.55sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement elemental_blast 117014 2308906 7696 5.16 74652 149267 25.8 25.8 19.9% 0.0% 0.0% 0.0% 11.67sec 2308906 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 19.38sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 85251 284 4.85 2919 5843 24.2 24.2 20.5% 0.0% 0.0% 0.0% 11.95sec 435016 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 349764 1166 33.87 1715 3430 24.2 169.3 20.4% 0.0% 0.0% 0.0% 11.95sec 435016 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 466618 1555 220.52 363 726 1102.6 1102.6 16.5% 0.0% 0.0% 0.0% 0.69sec 466618 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 371172 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 374584 1249 5.81 11080 22159 29.0 29.0 16.4% 0.0% 0.0% 0.0% 7.58sec 374584 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 240434 801 2.46 16766 33535 12.3 12.3 16.5% 0.0% 0.0% 0.0% 21.79sec 240434 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 354571 1182 3.25 18693 37306 16.3 16.3 16.7% 0.0% 0.0% 0.0% 18.37sec 354571 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 307650 1026 2.72 19417 38837 13.6 13.6 16.6% 0.0% 0.0% 0.0% 21.31sec 307650 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 1668593 5562 5.28 52451 104831 26.4 26.4 20.6% 0.0% 0.0% 0.0% 10.96sec 1668593 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 1 443986 1480 32.55 2724 5445 162.8 162.8 16.5% 16.4% 0.0% 0.0% 2.15sec 634281 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 2 222049 740 32.53 1364 2729 162.6 162.6 16.5% 16.4% 0.0% 0.0% 2.14sec 317221 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 301.59sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 97.9 0.0 0.0% 0.0% 0.0% 0.0% 3.06sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 1442214 4807 26.08 9489 19002 130.4 130.4 16.5% 0.0% 0.0% 0.0% 3.06sec 2060358 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_mh 390287 319846 1066 12.35 5179 0 61.8 61.8 0.0% 0.0% 0.0% 0.0% 5.45sec 319846 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 720960 2403 26.08 4745 9493 130.4 130.4 16.5% 0.0% 0.0% 0.0% 3.06sec 1029970 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_stormstrike_offhand 390287 159861 533 12.35 2589 0 61.8 61.8 0.0% 0.0% 0.0% 0.0% 5.45sec 159861 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 278000 927 1.12 42570 85097 5.6 5.6 16.7% 0.0% 0.0% 0.0% 55.04sec 278000 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 2284052 7614 81.39 4819 9639 406.9 406.9 16.5% 0.0% 0.0% 0.0% 2.47sec 3263015 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windlash 114089 136941 456 5.90 3857 7724 29.5 29.5 20.3% 0.0% 0.0% 0.0% 10.63sec 136941 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windlash_offhand 114093 75876 253 6.53 1930 3858 32.7 32.7 20.4% 0.0% 0.0% 0.0% 9.58sec 75876 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windstrike 115356 0 0 0.00 0 0 24.4 0.0 0.0% 0.0% 0.0% 0.0% 10.67sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windstrike_mh 115357 517776 1726 6.51 13644 27329 32.6 32.6 16.5% 0.0% 0.0% 0.0% 10.67sec 517776 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_windstrike_mh 390287 88783 296 2.13 8328 0 10.7 10.7 0.0% 0.0% 0.0% 0.0% 23.56sec 88783 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windstrike_offhand 115360 258345 861 6.51 6825 13641 32.6 32.6 16.2% 0.0% 0.0% 0.0% 10.67sec 258345 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormblast_windstrike_offhand 390287 44251 148 2.13 4150 0 10.7 10.7 0.0% 0.0% 0.0% 0.0% 23.56sec 44251 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt_ti 188196 1202757 4009 4.89 40921 81731 24.4 24.4 20.3% 0.0% 0.0% 0.0% 10.67sec 1202757 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 26739 437 38.23 589 1178 39.0 39.0 16.4% 0.0% 0.0% 0.0% 2.09sec 38199 61.20sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_spirit_wolf melee 0 949162 14370 361.15 2050 4099 397.6 397.6 16.5% 0.0% 0.0% 0.0% 1.50sec 1355980 66.05sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.41sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele ascendance_damage 344548 115996 387 0.40 49270 98204 2.0 2.0 17.8% 0.0% 0.0% 0.0% 180.41sec 115996 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele earth_elemental 198103 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 306.93sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele elemental_blast 117014 2241771 7473 4.47 83309 166921 22.4 22.4 20.3% 0.0% 0.0% 0.0% 13.18sec 2241771 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele feral_spirit 51533 0 0 0.00 0 0 11.2 0.0 0.0% 0.0% 0.0% 0.0% 29.36sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock 188389 615227 2051 14.74 6917 13883 73.7 73.7 20.6% 0.0% 0.0% 0.0% 4.08sec 1538533 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flame_shock ticks -188389 923306 3078 37.14 4120 8262 73.7 185.7 20.5% 0.0% 0.0% 0.0% 4.08sec 1538533 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flametongue_attack 10444 296413 988 124.72 408 817 623.6 623.6 16.5% 0.0% 0.0% 0.0% 0.77sec 296413 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele flask 371172 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele forgestorm_ignited_damage 381700 355041 1183 5.50 11080 22159 27.5 27.5 16.6% 0.0% 0.0% 0.0% 8.03sec 355041 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele frost_shock 196840 1196020 3987 7.52 27209 54740 37.6 37.6 16.6% 0.0% 0.0% 0.0% 7.66sec 1196020 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele ice_strike 342240 509958 1700 4.25 20548 41232 21.2 21.2 16.7% 0.0% 0.0% 0.0% 14.06sec 509958 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lava_lash 60103 2615580 8719 12.11 37065 74351 60.5 60.5 16.5% 0.0% 0.0% 0.0% 4.82sec 2615580 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt 188196 1752432 5841 6.17 47082 94425 30.8 30.8 20.6% 0.0% 0.0% 0.0% 9.24sec 1752432 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele main_hand 1 431164 1437 32.35 2659 5319 161.7 161.7 16.6% 16.3% 0.0% 0.0% 2.17sec 615965 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele offhand 2 218583 729 32.82 1329 2658 164.1 164.1 16.6% 16.4% 0.0% 0.0% 2.13sec 312270 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 305.75sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele primordial_wave 375982 46649 155 1.35 5903 11815 6.8 6.8 16.8% 0.0% 0.0% 0.0% 48.02sec 46649 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt_pw 188196 497158 1657 1.13 72507 145698 5.7 5.7 20.8% 0.0% 0.0% 0.0% 50.84sec 497158 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike 17364 0 0 0.00 0 0 26.2 0.0 0.0% 0.0% 0.0% 0.0% 10.56sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_mh 32175 208020 693 5.25 6807 13622 26.2 26.2 16.4% 0.0% 0.0% 0.0% 10.56sec 297179 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele stormstrike_offhand 32176 103986 347 5.25 3404 6808 26.2 26.2 16.4% 0.0% 0.0% 0.0% 10.56sec 148556 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele sundering 197214 203011 677 0.99 35326 71095 4.9 4.9 16.2% 0.0% 0.0% 0.0% 57.85sec 203011 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windfury_attack 25504 317819 1059 27.66 1971 3946 138.3 138.3 16.5% 0.0% 0.0% 0.0% 4.47sec 454039 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windlash 114089 107582 359 3.91 4572 9134 19.5 19.5 20.5% 0.0% 0.0% 0.0% 12.62sec 107582 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windlash_offhand 114093 63931 213 4.62 2300 4596 23.1 23.1 20.3% 0.0% 0.0% 0.0% 10.63sec 63931 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windstrike 115356 0 0 0.00 0 0 15.4 0.0 0.0% 0.0% 0.0% 0.0% 13.35sec 0 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windstrike_mh 115357 215935 720 3.09 11999 23958 15.4 15.4 16.6% 0.0% 0.0% 0.0% 13.35sec 215935 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele windstrike_offhand 115360 107808 359 3.09 5998 11994 15.4 15.4 16.5% 0.0% 0.0% 0.0% 13.35sec 107808 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele lightning_bolt_ti 188196 1333461 4445 3.09 71668 143616 15.4 15.4 20.5% 0.0% 0.0% 0.0% 13.35sec 1333461 300.00sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_greater_earth_elemental melee 0 24254 403 35.55 584 1167 35.7 35.7 16.5% 0.0% 0.0% 0.0% 1.88sec 34650 60.17sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_lightning_wolf melee 0 220273 7909 194.86 2086 4168 90.4 90.4 16.8% 0.0% 0.0% 0.0% 3.41sec 314684 27.85sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_fiery_wolf melee 0 219003 8013 197.33 2086 4169 89.9 89.9 16.8% 0.0% 0.0% 0.0% 3.43sec 312869 27.33sec
PR_Shaman_Enhancement_Ele PR_Shaman_Enhancement_Ele_frost_wolf melee 0 218255 8252 203.47 2084 4165 89.7 89.7 16.8% 0.0% 0.0% 0.0% 3.42sec 311801 26.45sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
208135.1 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.6 2.2 22.2s 18.7s 5.5s 23.07% 0.00% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 243.0s
  • trigger_min/max:3.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s
  • uptime_min/max:5.51% / 44.85%

Stack Uptimes

  • brittle_1:23.07%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.2s 18.7s 5.5s 23.28% 0.00% 2.2 (2.2) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 237.0s
  • trigger_min/max:3.0s / 237.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s
  • uptime_min/max:6.04% / 44.02%

Stack Uptimes

  • brittle_1:23.28%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 120.0 156.9s 2.4s 293.1s 98.53% 0.00% 110.9 (110.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.4s / 321.7s
  • trigger_min/max:0.0s / 15.9s
  • trigger_pct:100.00%
  • duration_min/max:23.9s / 355.6s
  • uptime_min/max:96.65% / 98.80%

Stack Uptimes

  • death_rot_1:0.29%
  • death_rot_2:0.29%
  • death_rot_3:0.89%
  • death_rot_4:0.28%
  • death_rot_5:0.66%
  • death_rot_6:0.52%
  • death_rot_7:0.48%
  • death_rot_8:0.46%
  • death_rot_9:0.49%
  • death_rot_10:94.18%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% from you for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 6.3 233.2 50.5s 1.2s 46.4s 97.97% 0.00% 177.4 (177.4) 5.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 230.0s
  • trigger_min/max:0.0s / 15.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 292.0s
  • uptime_min/max:93.20% / 99.65%

Stack Uptimes

  • everfrost_1:2.11%
  • everfrost_2:2.10%
  • everfrost_3:2.09%
  • everfrost_4:2.08%
  • everfrost_5:2.08%
  • everfrost_6:2.07%
  • everfrost_7:2.06%
  • everfrost_8:2.05%
  • everfrost_9:2.04%
  • everfrost_10:79.28%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 21.0 39.9 14.3s 4.9s 12.2s 85.64% 0.00% 5.1 (6.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 121.2s
  • trigger_min/max:0.0s / 29.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 119.1s
  • uptime_min/max:71.00% / 94.45%

Stack Uptimes

  • festering_wound_1:19.91%
  • festering_wound_2:25.66%
  • festering_wound_3:19.19%
  • festering_wound_4:9.26%
  • festering_wound_5:5.36%
  • festering_wound_6:6.26%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.4 59.2 190.7s 4.8s 212.5s 96.18% 95.97% 59.2 (59.2) 0.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Ele
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.4s / 333.5s
  • trigger_min/max:1.0s / 40.6s
  • trigger_pct:100.00%
  • duration_min/max:1.9s / 356.4s
  • uptime_min/max:86.21% / 99.01%

Stack Uptimes

  • lashing_flames_1:96.18%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.1 59.4 181.4s 4.9s 281.9s 99.12% 0.00% 55.2 (55.2) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 343.2s
  • trigger_min/max:0.9s / 43.6s
  • trigger_pct:100.00%
  • duration_min/max:0.9s / 357.9s
  • uptime_min/max:91.95% / 99.42%

Stack Uptimes

  • razorice_1:1.07%
  • razorice_2:0.88%
  • razorice_3:0.96%
  • razorice_4:0.88%
  • razorice_5:95.33%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Rotten Touch 11.7 9.5 25.7s 13.8s 13.8s 53.76% 59.49% 9.5 (9.5) 11.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rotten_touch
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.4s / 105.0s
  • trigger_min/max:0.8s / 57.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 88.6s
  • uptime_min/max:32.70% / 77.18%

Stack Uptimes

  • rotten_touch_1:53.76%

Spelldata

  • id:390276
  • name:Rotten Touch
  • tooltip:Scourge Strike damage taken from {$@=}auracaster is increased by {$s1=50}%.
  • description:{$@spelldesc390275=Sudden Doom causes your next Death Coil to also increase your {$?s207311=true}[Clawing Shadows][Scourge Strike] damage against the target by {$390276s1=50}% for {$390276d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 210699.88
Minimum 192518.12
Maximum 232501.37
Spread ( max - min ) 39983.25
Range [ ( max - min ) / 2 * 100% ] 9.49%
Standard Deviation 5523.5044
5th Percentile 201806.50
95th Percentile 219863.80
( 95th Percentile - 5th Percentile ) 18057.30
Mean Distribution
Standard Deviation 63.7842
95.00% Confidence Interval ( 210574.87 - 210824.90 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2640
0.1 Scale Factor Error with Delta=300 260444
0.05 Scale Factor Error with Delta=300 1041773
0.01 Scale Factor Error with Delta=300 26044324
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3752
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 50222938 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.