SimulationCraft 1007-01

for World of Warcraft 10.1.0.49444 Live (hotfix 2023-05-06/49444, git build bb4fdf6f1a)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2022-11-14 Ebonbolt is slower than spell data suggests.
Ebonbolt prj_speed 20.00 30.00
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 43011 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
43010.6 43010.6 45.4 / 0.106% 7948.6 / 18.5% 3434.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.2 12.5 Runic Power 2.74% 53.6 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 43011
Abomination Limb 0 (521) 0.0% (1.2%) 3.0 120.52sec 51754 41703

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.00 1.2410 0.0000 0.00 0.00 0.00% 41702.52 41702.52

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [e]:0.10
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<12
    cooldowns
    [f]:2.89
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
    Abomination Limb (_damage) 521 1.2% 38.2 6.91sec 4048 0 Direct 38.2 3205 6435 4048 26.1% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.24 38.24 0.00 0.00 0.00 0.0000 0.0000 154799.75 154799.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.90% 28.26 13 38 3205.18 2287 5270 3205.70 2700 3821 90567 90567 0.00%
crit 26.10% 9.98 1 20 6434.78 4573 10413 6439.74 4666 8713 64232 64232 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 2588 6.0% 191.5 1.83sec 4050 2229 Direct 191.5 3678 7361 4050 26.4% 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 191.55 191.55 0.00 0.00 0.00 1.8168 0.0000 775830.04 1108356.89 30.00% 2229.35 2229.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.22% 109.60 67 153 3677.63 2518 6826 3677.37 3423 3963 403071 575831 30.00%
crit 26.44% 50.64 25 85 7360.64 5036 12925 7358.06 6544 8236 372759 532526 30.00%
miss 16.34% 31.30 14 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1259 2.9% 187.1 1.83sec 2018 1111 Direct 187.1 1839 3680 2018 26.4% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 187.09 187.09 0.00 0.00 0.00 1.8166 0.0000 377563.92 539390.78 30.00% 1110.92 1110.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.90% 106.46 65 148 1838.97 1259 3413 1838.91 1694 1986 195772 279681 30.00%
crit 26.40% 49.40 24 79 3680.24 2518 6518 3678.78 3317 4111 181792 259709 30.00%
miss 16.70% 31.24 14 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 96 0.2% 2.0 0.00sec 14222 0 Direct 2.0 11341 22769 14224 25.2% 0.0%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 28446.47 28446.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.78% 1.50 0 3 11341.01 9662 19596 10623.62 0 18891 16964 16964 0.00%
crit 25.22% 0.50 0 2 22768.66 19323 38240 10061.52 0 35494 11482 11482 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}
Breath of Sindragosa 0 (9334) 0.0% (21.6%) 2.9 120.53sec 946582 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [i]:2.95
  • if_expr:!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
    Breath of Sindragosa (_tick) 9334 21.6% 129.9 2.06sec 21470 0 Direct 129.9 17002 33935 21470 26.4% 0.0%

Stats Details: Breath Of Sindragosa Tick

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.86 129.86 0.00 0.00 0.00 0.0000 0.0000 2787993.58 2787993.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.61% 95.59 32 142 17001.94 8881 33211 17018.20 15048 18972 1625246 1625246 0.00%
crit 26.39% 34.26 12 61 33934.85 17762 66422 33969.69 29477 40409 1162748 1162748 0.00%

Action Details: Breath Of Sindragosa Tick

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}
Burnout Wave 684 1.6% 2.8 119.28sec 72812 0 Direct 2.7 61040 122596 77375 26.5% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.83 2.66 0.00 0.00 0.00 0.0000 0.0000 206045.78 206045.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.47% 1.96 0 3 61040.30 22767 68301 58603.42 0 68301 119417 119417 0.00%
crit 26.53% 0.71 0 3 122596.33 45534 136602 67364.81 0 136602 86629 86629 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 11 0.0% 0.6 84.69sec 5711 4396 Direct 6.5 417 833 527 26.5% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.60 6.54 0.00 0.00 0.00 1.2996 0.0000 3446.24 3446.24 0.00% 4395.72 4395.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.54% 4.81 0 46 416.94 305 744 189.09 0 645 2005 2005 0.00%
crit 26.46% 1.73 0 17 833.41 610 1453 367.41 0 1332 1441 1441 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    breath
    [W]:0.60
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
Dragon Games Equipment 874 2.0% 6.0 48.06sec 43166 0 Direct 6.0 34304 68609 43196 25.9% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 0.00 0.0000 0.0000 258730.20 369624.00 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.08% 4.44 0 6 34304.32 34304 34304 34295.17 0 34304 152217 217459 29.99%
crit 25.92% 1.55 0 6 68608.63 68609 68609 57117.44 0 68609 106513 152165 24.98%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 2115 4.9% 60.8 4.92sec 10448 0 Periodic 98.7 5092 10164 6431 26.4% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.76 0.00 98.72 98.72 59.75 0.0000 2.9998 634850.93 634850.93 0.00% 2143.82 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 73.60% 72.65 47 98 5091.72 17 10688 5090.64 4706 5563 369919 369919 0.00%
crit 26.40% 26.06 8 48 10164.40 753 21375 10162.49 8923 12285 264932 264932 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.11
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 2202 (3302) 5.2% (7.7%) 44.2 4.96sec 22530 16804 Direct 44.2 (88.4) 11891 23750 15023 26.4% (26.4%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.20 44.20 0.00 0.00 0.00 1.3408 0.0000 664021.45 664021.45 0.00% 16804.25 16804.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.59% 32.53 15 61 11891.47 7459 24034 11869.07 10335 13375 386815 386815 0.00%
crit 26.41% 11.67 1 27 23750.03 14917 49168 23671.46 18848 30294 277206 277206 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [H]:2.86
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [l]:28.48
  • if_expr:buff.killing_machine.stack<2&runic_power.deficit<20&!variable.2h_check
    single_target
    [o]:4.30
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [s]:8.57
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 1100 2.6% 44.2 4.96sec 7507 0 Direct 44.2 5948 11862 7507 26.4% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.20 44.20 0.00 0.00 0.00 0.0000 0.0000 331831.80 331831.80 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.63% 32.55 13 57 5948.06 3729 12292 5936.94 5181 6616 193587 193587 0.00%
crit 26.37% 11.65 1 30 11862.01 7459 24554 11822.06 9550 15641 138245 138245 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Howling Blast 5919 (7160) 13.8% (16.6%) 60.8 4.92sec 35272 29055 Direct 60.8 (121.5) 23078 46070 29157 26.4% (26.5%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.76 60.76 0.00 0.00 0.00 1.2140 0.0000 1771677.98 1771677.98 0.00% 29055.21 29055.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.56% 44.70 23 65 23078.31 4829 47317 23076.10 20881 25750 1031541 1031541 0.00%
crit 26.44% 16.07 1 34 46070.30 9451 92962 46057.67 36803 56976 740137 740137 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [S]:36.34
  • if_expr:variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
    breath
    [X]:0.23
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
    breath
    [Z]:0.58
  • if_expr:buff.rime.react
    single_target
    [n]:23.62
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 1241 2.9% 60.8 4.92sec 6115 0 Direct 60.8 4837 9662 6115 26.5% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.76 60.76 0.00 0.00 0.00 0.0000 0.0000 371550.32 371550.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.51% 44.66 22 67 4836.70 2629 9966 4836.32 4325 5362 216027 216027 0.00%
crit 26.49% 16.10 4 32 9662.24 5257 19602 9658.23 7983 12053 155523 155523 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Obliterate 1328 (8648) 3.1% (20.1%) 55.9 5.29sec 46357 20292 Direct 55.9 (208.6) 5628 11273 7113 26.3% (60.5%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.91 55.91 0.00 0.00 0.00 2.2845 0.0000 397732.55 568203.85 30.00% 20292.43 20292.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.69% 41.20 20 66 5628.17 3670 9949 5631.48 5136 6384 231903 331299 30.00%
crit 26.31% 14.71 2 31 11272.64 7339 19921 11272.21 9121 13883 165829 236905 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    breath
    [U]:19.23
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [V]:33.14
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Y]:6.88
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [m]:23.34
  • if_expr:buff.killing_machine.react
    single_target
    [p]:21.69
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 664 1.5% 55.9 5.29sec 3556 0 Direct 55.9 2813 5640 3556 26.3% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.91 55.91 0.00 0.00 0.00 0.0000 0.0000 198816.54 284030.87 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.74% 41.23 15 64 2813.45 1835 4980 2814.86 2525 3183 116001 165720 30.00%
crit 26.26% 14.68 4 30 5639.94 3670 9949 5638.26 4501 7010 82815 118311 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 4437 10.3% 48.4 6.09sec 27503 0 Direct 48.4 0 27503 27503 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 48.37 48.37 0.00 0.00 0.00 0.0000 0.0000 1330322.97 1330322.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 48.37 24 74 27503.35 15233 57279 27474.22 24272 30331 1330323 1330323 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 2219 5.2% 48.4 6.09sec 13752 0 Direct 48.4 0 13752 13752 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 48.37 48.37 0.00 0.00 0.00 0.0000 0.0000 665161.49 665161.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 48.37 24 74 13751.68 7617 28640 13737.11 12136 15166 665161 665161 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Remorseless Winter 0 (4945) 0.0% (11.5%) 15.2 20.39sec 97713 77469

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.16 0.00 0.00 0.00 0.00 1.2614 0.0000 0.00 0.00 0.00% 77468.94 77468.94

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    breath
    [R]:5.77
  • if_expr:variable.rw_buffs|variable.adds_remain
    single_target
    [k]:9.40
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 4945 11.5% 238.0 1.26sec 6225 0 Direct 238.0 4924 9839 6225 26.5% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 238.05 238.05 0.00 0.00 0.00 0.0000 0.0000 1481748.49 1481748.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.53% 175.04 119 229 4923.60 1074 12921 4924.19 4244 5577 861808 861808 0.00%
crit 26.47% 63.01 33 100 9838.93 2148 25701 9841.84 7830 11972 619941 619941 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}
Strike Twice 202 0.5% 20.2 14.50sec 3002 0 Direct 20.2 2375 4750 3002 26.4% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.16 20.16 0.00 0.00 0.00 0.0000 0.0000 60513.60 86450.20 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.57% 14.83 4 30 2374.79 2375 2375 2374.79 2375 2375 35215 50308 30.00%
crit 26.43% 5.33 0 18 4749.58 4750 4750 4731.21 0 4750 25299 36142 29.89%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 202 0.5% 20.2 14.50sec 3004 0 Direct 20.2 2375 4750 3004 26.5% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.16 20.16 0.00 0.00 0.00 0.0000 0.0000 60557.62 86513.08 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.51% 14.82 4 30 2374.79 2375 2375 2374.79 2375 2375 35197 50282 30.00%
crit 26.49% 5.34 0 15 4749.58 4750 4750 4726.15 0 4750 25361 36231 29.85%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 1961 / 1070
auto_attack 1312 1.7% 95.3 2.91sec 2251 1455 Direct 95.3 1781 3561 2251 26.4% 0.0%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.28 95.28 0.00 0.00 0.00 1.5465 0.0000 214474.14 306399.44 30.00% 1455.45 1455.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.59% 70.12 40 91 1780.66 1154 2947 1782.40 1628 1964 124857 178372 30.00%
crit 26.41% 25.17 8 45 3560.95 2269 5894 3564.12 2997 4169 89617 128027 30.00%

Action Details: Auto Attack

  • id:0
  • school:none
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:2.94
Claw 648 0.8% 52.8 5.33sec 2007 2007 Direct 52.8 1586 3176 2007 26.5% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.76 52.76 0.00 0.00 0.00 1.0000 0.0000 105869.88 151246.54 30.00% 2006.82 2006.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.53% 38.79 17 53 1585.81 1004 2726 1587.30 1427 1778 61517 87884 30.00%
crit 26.47% 13.96 2 28 3176.39 2009 5289 3178.83 2593 3854 44353 63363 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.76
  • if_expr:energy>70
Gnaw 1 0.0% 2.9 120.70sec 68 68 Direct 2.9 54 107 68 26.3% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 0.00 1.0000 0.0000 198.75 283.93 30.00% 67.95 67.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.71% 2.16 0 3 53.83 36 72 52.78 0 71 116 166 29.41%
crit 26.29% 0.77 0 3 107.49 75 146 63.56 0 146 83 118 17.74%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.93
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Anti-Magic Shell 7.4 43.21sec

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 7.44 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    default
    [G]:7.44
  • if_expr:runic_power.deficit>40
Arcane Torrent 2.0 143.36sec

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 0.00 0.00 0.00 1.2702 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [a]:0.96
  • if_expr:runic_power<60
    single_target
    [r]:1.08
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 3.9 82.84sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [c]:0.28
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [d]:3.67
  • if_expr:buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
Phial of Tepid Versatility 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371172
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 4.1 75.05sec

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.06 0.00 0.00 0.00 0.00 1.1880 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [T]:3.09
  • if_expr:rune<2&runic_power.deficit>25
    single_target
    [q]:0.98
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
Pillar of Frost 8.2 38.19sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.21 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [g]:0.33
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [h]:7.88
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
Elemental Potion of Ultimate Power 1.4 304.06sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [b]:1.45
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.69sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [j]:2.98
Unholy Strength 20.2 14.46sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.15 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.5sec 120.5sec 11.8sec 11.88% 0.00% 32.4 (32.4) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 122.4s
  • trigger_min/max:120.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.88%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Anti-Magic Shell 7.4 0.0 43.1sec 43.2sec 6.9sec 17.16% 0.00% 0.0 (0.0) 7.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 95.5s
  • trigger_min/max:40.0s / 95.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s

Stack Uptimes

  • antimagic_shell_1:17.16%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 10.9 31.6 28.0sec 6.9sec 18.7sec 67.96% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 81.3s
  • trigger_min/max:0.9s / 54.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.5s

Stack Uptimes

  • bonegrinder_crit_1:20.12%
  • bonegrinder_crit_2:15.99%
  • bonegrinder_crit_3:12.77%
  • bonegrinder_crit_4:10.45%
  • bonegrinder_crit_5:8.62%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 4.4 0.0 62.8sec 62.8sec 9.8sec 14.46% 11.90% 0.0 (0.0) 4.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:18.6s / 311.9s
  • trigger_min/max:18.6s / 311.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • bonegrinder_frost_1:14.46%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.8 13.9 120.2sec 14.9sec 19.4sec 18.29% 0.00% 1.9 (1.9) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 149.8s
  • trigger_min/max:0.0s / 136.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.92%
  • bound_by_fire_and_blaze_2:4.13%
  • bound_by_fire_and_blaze_3:4.01%
  • bound_by_fire_and_blaze_4:3.50%
  • bound_by_fire_and_blaze_5:2.57%
  • bound_by_fire_and_blaze_6:3.16%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.5sec 120.5sec 44.0sec 43.40% 0.00% 129.5 (129.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 127.6s
  • trigger_min/max:120.0s / 127.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 101.0s

Stack Uptimes

  • breath_of_sindragosa_1:43.40%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Dragon Games Equipment 3.0 0.0 120.0sec 120.0sec 0.6sec 0.64% 0.00% 6.0 (6.0) 3.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.68
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.0s
  • trigger_min/max:120.0s / 120.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.7s

Stack Uptimes

  • dragon_games_equipment_1:0.64%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 304.1sec 304.1sec 27.1sec 12.87% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 327.6s
  • trigger_min/max:300.0s / 327.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.87%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 83.0sec 82.8sec 19.6sec 25.88% 0.00% 11.6 (11.6) 3.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 289.1s
  • trigger_min/max:0.0s / 289.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.1s

Stack Uptimes

  • empower_rune_weapon_1:25.88%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 7.9 0.0 38.2sec 38.2sec 12.0sec 31.65% 0.00% 0.0 (0.0) 7.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:27.7s / 55.8s
  • trigger_min/max:27.7s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • enduring_strength_1:31.65%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 8.1 17.2 38.8sec 11.5sec 9.6sec 25.72% 98.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.5s / 128.1s
  • trigger_min/max:0.9s / 120.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:10.34%
  • enduring_strength_builder_2:8.02%
  • enduring_strength_builder_3:4.54%
  • enduring_strength_builder_4:1.91%
  • enduring_strength_builder_5:0.68%
  • enduring_strength_builder_6:0.19%
  • enduring_strength_builder_7:0.04%
  • enduring_strength_builder_8:0.01%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storm 12.9 120.4 24.1sec 2.2sec 15.4sec 66.19% 86.48% 68.2 (108.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.2s / 105.6s
  • trigger_min/max:0.9s / 37.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 100.0s

Stack Uptimes

  • gathering_storm_1:2.47%
  • gathering_storm_2:5.70%
  • gathering_storm_3:5.05%
  • gathering_storm_4:3.86%
  • gathering_storm_5:5.27%
  • gathering_storm_6:3.78%
  • gathering_storm_7:3.57%
  • gathering_storm_8:2.90%
  • gathering_storm_9:2.23%
  • gathering_storm_10:31.37%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 1.0 172.7 158.1sec 1.7sec 289.7sec 97.76% 0.00% 170.7 (170.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:117.4s / 246.5s
  • trigger_min/max:1.0s / 13.6s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 354.0s

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.08%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 40.3 17.8 7.4sec 6.0sec 2.2sec 29.39% 46.38% 1.0 (1.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 53.2s
  • trigger_min/max:0.0s / 53.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.7s

Stack Uptimes

  • killing_machine_1:25.75%
  • killing_machine_2:3.64%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 8.2 0.0 38.2sec 38.2sec 11.8sec 32.25% 34.16% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:27.7s / 55.8s
  • trigger_min/max:27.7s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:32.25%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 8.2 54.5 38.3sec 4.6sec 11.5sec 31.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.9s / 55.8s
  • trigger_min/max:0.9s / 44.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:2.18%
  • pillar_of_frost_bonus_2:2.92%
  • pillar_of_frost_bonus_3:3.32%
  • pillar_of_frost_bonus_4:2.78%
  • pillar_of_frost_bonus_5:3.07%
  • pillar_of_frost_bonus_6:3.08%
  • pillar_of_frost_bonus_7:2.73%
  • pillar_of_frost_bonus_8:2.46%
  • pillar_of_frost_bonus_9:1.82%
  • pillar_of_frost_bonus_10:1.33%
  • pillar_of_frost_bonus_11:1.16%
  • pillar_of_frost_bonus_12:1.06%
  • pillar_of_frost_bonus_13:0.93%
  • pillar_of_frost_bonus_14:0.80%
  • pillar_of_frost_bonus_15:0.56%
  • pillar_of_frost_bonus_16:0.36%
  • pillar_of_frost_bonus_17:0.26%
  • pillar_of_frost_bonus_18:0.20%
  • pillar_of_frost_bonus_19:0.17%
  • pillar_of_frost_bonus_20:0.12%
  • pillar_of_frost_bonus_21:0.05%
  • pillar_of_frost_bonus_22:0.01%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 13.0 2.2 24.0sec 20.4sec 17.1sec 74.34% 0.00% 218.2 (218.2) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 102.6s
  • trigger_min/max:20.0s / 27.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 101.0s

Stack Uptimes

  • remorseless_winter_1:74.34%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 61.2 10.4 4.9sec 4.2sec 1.9sec 39.50% 100.00% 10.4 (10.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 51.0s
  • trigger_min/max:0.0s / 51.0s
  • trigger_pct:63.28%
  • duration_min/max:0.0s / 25.3s

Stack Uptimes

  • rime_1:39.50%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.4 13.6 22.3sec 10.8sec 11.6sec 52.10% 0.00% 13.6 (13.6) 13.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 139.4s
  • trigger_min/max:0.9s / 139.4s
  • trigger_pct:14.98%
  • duration_min/max:0.0s / 72.7s

Stack Uptimes

  • rune_mastery_1:52.10%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.7 7.4 23.4sec 14.4sec 10.2sec 43.27% 42.35% 7.4 (7.4) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 87.0s
  • trigger_min/max:0.0s / 61.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.4s

Stack Uptimes

  • rune_of_hysteria_1:43.27%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Ground 0.5 0.1 129.0sec 78.9sec 10.1sec 1.82% 0.00% 0.1 (0.1) 0.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.9s / 249.0s
  • trigger_min/max:1.2s / 249.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 139.1s

Stack Uptimes

  • unholy_ground_1:1.82%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 11.7 35.9sec 14.4sec 23.5sec 66.18% 0.00% 11.7 (11.7) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 165.2s
  • trigger_min/max:0.0s / 61.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 144.8s

Stack Uptimes

  • unholy_strength_1:66.18%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 1.0 172.7 158.1sec 1.7sec 289.7sec 97.76% 0.00% 170.7 (170.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:117.4s / 246.5s
  • trigger_min/max:1.0s / 13.6s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 354.0s

Stack Uptimes

  • unleashed_frenzy_1:0.34%
  • unleashed_frenzy_2:0.34%
  • unleashed_frenzy_3:97.08%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=10 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Tepid Versatility

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_phial_of_tepid_versatility
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Phial of Tepid Versatility

Stat Details

  • stat:versatility_rating
  • amount:745.00

Spelldata

  • id:371172
  • name:Phial of Tepid Versatility
  • tooltip:Versatility increased by {$=}w1.
  • description:Increases your Versatility by {$s1=315}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.8 6.0 50.0 10.9s 1.3s 131.7s
windfury_totem_extra_attack_oh 22.4 7.0 44.0 13.0s 1.3s 162.8s
Killing Machine spent on Obliterate 48.4 24.0 74.0 6.1s 0.9s 54.1s
Killing Machine: Critical auto attacks 48.7 24.0 74.0 6.4s 1.3s 53.2s
Killing Machine wasted: Critical auto attacks 1.0 0.0 8.0 67.9s 1.3s 313.2s
Rune ready 220.6 152.0 280.0 1.5s 0.0s 13.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.83% 0.00% 8.79% 0.7s 0.0s 8.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Remorseless Winter0.4330.0007.6276.5732.20417.785
Horn of Winter27.0530.000221.473128.57860.360293.496
Death and Decay122.1930.000320.418282.845150.008359.952
Empower Rune Weapon1.4690.00093.1255.8024.13898.303
Abomination Limb0.3320.0002.4280.9960.0003.321
Pillar of Frost2.1060.00015.61817.3086.49735.922
Breath of Sindragosa2.2580.0007.5826.6524.14214.791
Raise Dead0.8080.0002.8252.4111.3435.685

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=432603)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0741.397 / 1.0953.83522.757
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
15.20743.35780.573 / 78.526124.775197.749

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Breath of SindragosaRune11.1410.774.88%0.970.373.36%
Empower Rune WeaponRunic Power19.1989.022.38%4.646.957.24%
Empower Rune WeaponRune19.1919.068.64%0.990.130.68%
Frost FeverRunic Power32.23153.514.10%4.767.634.73%
Horn of WinterRunic Power4.06101.562.71%25.000.000.00%
Horn of WinterRune8.128.123.68%1.000.000.00%
Murderous EfficiencyRune24.1424.1410.94%1.000.000.00%
Rage of the Frozen ChampionRunic Power60.76478.4412.78%7.877.641.57%
Rune RegenerationRune85.7685.7638.88%1.000.000.00%
Rune of HysteriaRunic Power156.42321.428.58%2.0527.527.89%
Runic AttenuationRunic Power71.24343.589.18%4.8212.633.54%
Runic EmpowermentRune73.2872.7132.97%0.990.570.78%
Arcane TorrentRunic Power2.0440.801.09%20.000.000.00%
Death and DecayRunic Power0.606.030.16%10.000.000.00%
Howling BlastRunic Power60.760.030.00%0.000.000.00%
ObliterateRunic Power104.292064.1355.13%19.7921.581.03%
Remorseless WinterRunic Power15.16145.593.89%9.606.053.99%
pet - ghoul
energy_regenEnergy1110.801928.92100.00%1.74169.888.09%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_tick)Runic Power 129.542331.7063.75%18.0017.961195.69
Death and DecayRune 0.600.600.27%1.001.005711.51
Frost StrikeRunic Power 44.201325.9936.25%30.0030.00751.03
Howling BlastRune 60.760.000.00%0.000.00803817776.03
ObliterateRune 104.29208.5792.97%2.003.7312427.61
Remorseless WinterRune 15.1615.166.76%1.001.0097713.31
pet - ghoul
ClawEnergy 52.762110.27100.00%40.0040.0050.17
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 12.48 12.19 90.0 86.4 0.0 124.0
Rune 6.0 0.74 0.75 0.0 2.2 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 43010.63
Minimum 36287.06
Maximum 49593.12
Spread ( max - min ) 13306.06
Range [ ( max - min ) / 2 * 100% ] 15.47%
Standard Deviation 2006.8841
5th Percentile 39774.89
95th Percentile 46376.95
( 95th Percentile - 5th Percentile ) 6602.06
Mean Distribution
Standard Deviation 23.1750
95.00% Confidence Interval ( 42965.21 - 43056.06 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 84
0.1% Error 8364
0.1 Scale Factor Error with Delta=300 34382
0.05 Scale Factor Error with Delta=300 137528
0.01 Scale Factor Error with Delta=300 3438178
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 43010.63
Minimum 36287.06
Maximum 49593.12
Spread ( max - min ) 13306.06
Range [ ( max - min ) / 2 * 100% ] 15.47%
Standard Deviation 2006.8841
5th Percentile 39774.89
95th Percentile 46376.95
( 95th Percentile - 5th Percentile ) 6602.06
Mean Distribution
Standard Deviation 23.1750
95.00% Confidence Interval ( 42965.21 - 43056.06 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 84
0.1% Error 8364
0.1 Scale Factor Error with Delta=300 34382
0.05 Scale Factor Error with Delta=300 137528
0.01 Scale Factor Error with Delta=300 3438178
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 43010.63
Minimum 36287.06
Maximum 49593.12
Spread ( max - min ) 13306.06
Range [ ( max - min ) / 2 * 100% ] 15.47%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 12561641.74
Minimum 8724500.69
Maximum 16023416.77
Spread ( max - min ) 7298916.08
Range [ ( max - min ) / 2 * 100% ] 29.05%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
B 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
C 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
D 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
E 0.00 variable,name=2h_check,value=main_hand.2h
Default action list Executed every time the actor is available.
# count action,conditions
F 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=3,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
G 7.44 antimagic_shell,if=runic_power.deficit>40
0.00 antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up&cooldown.empower_rune_weapon.charges<2|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up)
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
H 2.86 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
I 0.00 call_action_list,name=trinkets
Choose Action list to run
J 0.00 call_action_list,name=cooldowns
K 0.00 call_action_list,name=racials
L 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
M 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
N 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
O 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
P 0.00 call_action_list,name=aoe,if=active_enemies>=2
Q 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
R 5.77 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Breath Active Rotation
S 36.34 howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
T 3.09 horn_of_winter,if=rune<2&runic_power.deficit>25
U 19.23 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&runic_power>45
V 33.14 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
W 0.60 death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
0.00 remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
X 0.23 howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
Y 6.88 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
Z 0.58 howling_blast,if=buff.rime.react
a 0.96 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
b 1.45 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
c 0.28 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
d 3.67 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
e 0.10 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<12
f 2.89 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
g 0.33 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
h 7.88 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
i 2.95 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
j 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.single_target
# count action,conditions
k 9.40 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
l 28.48 frost_strike,if=buff.killing_machine.stack<2&runic_power.deficit<20&!variable.2h_check
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
m 23.34 obliterate,if=buff.killing_machine.react
n 23.62 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
o 4.30 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
p 21.69 obliterate,if=!variable.pooling_runes
q 0.98 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
r 1.08 arcane_torrent,if=runic_power.deficit>20
s 8.57 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
t 2.83 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
u 3.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
0.00 use_item,use_off_gcd=1,slot=main_hand,if=(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGufjknmpidhbSVSVTUSUSVUSVYYtSRUSYSYSUSUYYdUSYSYShRUSGUSVSaVSUSUSTURSVVZUVVpmnsmshpknsGspnsssmmnsmnksmnommlmhlnopufjnkliUSYGSUSVSVdVSVtSURSVVSUSVSVhSVVVTUSRUWmGnrmnHmlmnlmklnplplhnplmlmlnokpopplnoGpnopmlplnkhlmlmlnplmmufjlnliURSVVSSVGSVSVtSUSphnkmnHpopnopcnmlmlnmkmlmlnlmlnp

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 4 trinket_1_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 5 trinket_2_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 6 trinket_1_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 7 trinket_2_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat A trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat B trinket_1_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat C trinket_2_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat D rw_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat E 2h_check PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
0:00.000 default F auto_attack Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
0:00.000 default G antimagic_shell PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust
0:00.000 trinkets u use_item_dragon_games_equipment Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell
0:00.000 cooldowns f abomination_limb Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, dragon_games_equipment
0:01.036 cooldowns j raise_dead Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, abomination_limb, rime
0:01.036 single_target k remorseless_winter Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, abomination_limb, rime
0:02.071 single_target n howling_blast Fluffy_Pillow 15.0/124: 12% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, abomination_limb, killing_machine, remorseless_winter, rime
0:03.107 single_target m obliterate Fluffy_Pillow 23.0/124: 19% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, abomination_limb, gathering_storm, killing_machine, remorseless_winter
0:04.142 single_target p obliterate Fluffy_Pillow 48.0/124: 39% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, unholy_strength, abomination_limb, gathering_storm(3), remorseless_winter, bonegrinder_crit
0:05.176 cooldowns i breath_of_sindragosa Fluffy_Pillow 73.0/124: 59% runic_power
2.0/6: 33% rune
bloodlust, antimagic_shell, unholy_strength, abomination_limb, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit
0:05.176 cooldowns d empower_rune_weapon Fluffy_Pillow 73.0/124: 59% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit
0:05.176 cooldowns h pillar_of_frost Fluffy_Pillow 78.0/124: 63% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit
0:05.176 cooldowns b potion Fluffy_Pillow 78.0/124: 63% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit
0:05.176 breath S howling_blast Fluffy_Pillow 78.0/124: 63% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, elemental_potion_of_ultimate_power
0:06.075 breath V obliterate Fluffy_Pillow 91.0/124: 73% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, rime, bonegrinder_crit, elemental_potion_of_ultimate_power
0:06.974 breath S howling_blast Fluffy_Pillow 93.0/124: 75% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons, breath_of_sindragosa, gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy, rune_of_hysteria, elemental_potion_of_ultimate_power
0:07.874 breath V obliterate Fluffy_Pillow 84.9/124: 68% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(2), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, unleashed_frenzy(2), rune_of_hysteria, elemental_potion_of_ultimate_power
0:08.775 Waiting     0.411 sec 104.1/124: 84% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:09.186 breath T horn_of_winter Fluffy_Pillow 86.1/124: 69% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:10.085 breath U obliterate Fluffy_Pillow 117.1/124: 94% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:10.987 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:11.886 breath U obliterate Fluffy_Pillow 97.9/124: 79% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:12.785 breath S howling_blast Fluffy_Pillow 104.7/124: 84% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:13.687 breath V obliterate Fluffy_Pillow 96.6/124: 78% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:14.589 Waiting     0.601 sec 106.0/124: 85% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:15.190 breath U obliterate Fluffy_Pillow 100.4/124: 81% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:16.091 breath S howling_blast Fluffy_Pillow 124.0/124: 100% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:16.992 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(17), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:17.893 Waiting     0.295 sec 106.0/124: 85% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:18.188 breath Y obliterate Fluffy_Pillow 88.0/124: 71% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:19.089 Waiting     0.092 sec 112.8/124: 91% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:19.181 breath Y obliterate Fluffy_Pillow 94.8/124: 76% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:20.007 trinkets t use_item_blazebinders_hoof Fluffy_Pillow 119.6/124: 96% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_potion_of_ultimate_power
0:20.083 breath S howling_blast Fluffy_Pillow 119.6/124: 96% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_potion_of_ultimate_power
0:20.984 breath R remorseless_winter Fluffy_Pillow 106.0/124: 85% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_potion_of_ultimate_power
0:21.937 breath U obliterate Fluffy_Pillow 106.6/124: 86% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_potion_of_ultimate_power
0:22.837 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_potion_of_ultimate_power
0:23.738 breath Y obliterate Fluffy_Pillow 97.9/124: 79% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_potion_of_ultimate_power
0:24.637 breath S howling_blast Fluffy_Pillow 104.7/124: 84% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_potion_of_ultimate_power
0:25.538 Waiting     0.709 sec 106.6/124: 86% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:26.247 breath Y obliterate Fluffy_Pillow 93.6/124: 76% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:27.284 breath S howling_blast Fluffy_Pillow 100.6/124: 81% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:28.321 breath U obliterate Fluffy_Pillow 90.6/124: 73% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:29.355 breath S howling_blast Fluffy_Pillow 97.6/124: 79% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:30.392 breath U obliterate Fluffy_Pillow 87.6/124: 71% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:31.428 breath Y obliterate Fluffy_Pillow 89.6/124: 72% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:32.464 breath Y obliterate Fluffy_Pillow 96.6/124: 78% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:33.498 Waiting     1.757 sec 98.6/124: 80% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_potion_of_ultimate_power
0:35.255 cooldowns d empower_rune_weapon Fluffy_Pillow 67.6/124: 55% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria
0:35.255 breath U obliterate Fluffy_Pillow 73.8/124: 60% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria
0:36.157 breath S howling_blast Fluffy_Pillow 98.6/124: 80% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria
0:37.056 breath Y obliterate Fluffy_Pillow 90.6/124: 73% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria
0:37.957 breath S howling_blast Fluffy_Pillow 103.6/124: 84% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria
0:38.857 Waiting     0.398 sec 107.9/124: 87% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria
0:39.255 breath Y obliterate Fluffy_Pillow 89.9/124: 72% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria
0:40.155 breath S howling_blast Fluffy_Pillow 114.7/124: 92% runic_power
1.0/6: 17% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria
0:41.324 cooldowns h pillar_of_frost Fluffy_Pillow 94.2/124: 76% runic_power
2.0/6: 33% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria
0:41.324 breath R remorseless_winter Fluffy_Pillow 94.2/124: 76% runic_power
2.0/6: 33% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria
0:42.494 Waiting     0.409 sec 88.6/124: 71% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3)
0:42.903 breath U obliterate Fluffy_Pillow 88.6/124: 71% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3)
0:44.074 breath S howling_blast Fluffy_Pillow 90.6/124: 73% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3)
0:45.245 default G antimagic_shell PR_Death_Knight_Frost 67.6/124: 55% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3)
0:45.245 breath U obliterate Fluffy_Pillow 67.6/124: 55% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3)
0:46.415 breath S howling_blast Fluffy_Pillow 74.6/124: 60% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3)
0:47.586 breath V obliterate Fluffy_Pillow 64.6/124: 52% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3)
0:48.756 breath S howling_blast Fluffy_Pillow 66.6/124: 54% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria
0:49.926 breath a arcane_torrent Fluffy_Pillow 58.5/124: 47% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria
0:51.098 breath V obliterate Fluffy_Pillow 77.7/124: 63% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria
0:52.270 breath S howling_blast Fluffy_Pillow 66.5/124: 54% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria
0:53.439 breath U obliterate Fluffy_Pillow 58.4/124: 47% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
0:54.609 breath S howling_blast Fluffy_Pillow 65.2/124: 53% runic_power
0.0/6: 0% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
0:55.778 breath U obliterate Fluffy_Pillow 63.4/124: 51% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
0:57.122 breath S howling_blast Fluffy_Pillow 76.4/124: 62% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3)
0:58.468 breath T horn_of_winter Fluffy_Pillow 53.4/124: 43% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3)
0:59.813 breath U obliterate Fluffy_Pillow 65.4/124: 53% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3)
1:01.156 breath R remorseless_winter Fluffy_Pillow 67.4/124: 54% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
1:02.670 breath S howling_blast Fluffy_Pillow 41.4/124: 33% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
1:04.014 breath V obliterate Fluffy_Pillow 31.4/124: 25% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
1:05.358 breath V obliterate Fluffy_Pillow 26.4/124: 21% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria
1:06.701 breath Z howling_blast Fluffy_Pillow 33.2/124: 27% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria
1:08.044 breath U obliterate Fluffy_Pillow 25.1/124: 20% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria
1:09.389 breath V obliterate Fluffy_Pillow 20.1/124: 16% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria
1:10.734 breath V obliterate Fluffy_Pillow 26.9/124: 22% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria
1:12.079 Waiting     0.200 sec 33.7/124: 27% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, unleashed_frenzy(3)
1:12.279 single_target p obliterate Fluffy_Pillow 15.7/124: 13% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(10), remorseless_winter, unleashed_frenzy(3)
1:13.625 single_target m obliterate Fluffy_Pillow 35.7/124: 29% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, unleashed_frenzy(3)
1:14.970 single_target n howling_blast Fluffy_Pillow 60.7/124: 49% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3)
1:16.316 single_target s frost_strike Fluffy_Pillow 68.7/124: 55% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3)
1:17.661 single_target m obliterate Fluffy_Pillow 43.7/124: 35% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3)
1:19.007 single_target s frost_strike Fluffy_Pillow 69.9/124: 56% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
1:20.350 cooldowns h pillar_of_frost Fluffy_Pillow 39.9/124: 32% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
1:20.350 single_target p obliterate Fluffy_Pillow 39.9/124: 32% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), pillar_of_frost, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
1:21.693 single_target k remorseless_winter Fluffy_Pillow 64.7/124: 52% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
1:23.039 single_target n howling_blast Fluffy_Pillow 83.3/124: 67% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
1:24.384 single_target s frost_strike Fluffy_Pillow 93.2/124: 75% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), gathering_storm, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
1:25.730 default G antimagic_shell PR_Death_Knight_Frost 69.4/124: 56% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), gathering_storm, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
1:25.730 single_target s frost_strike Fluffy_Pillow 69.4/124: 56% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), gathering_storm, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
1:27.075 single_target p obliterate Fluffy_Pillow 39.4/124: 32% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), gathering_storm, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
1:28.420 single_target n howling_blast Fluffy_Pillow 64.2/124: 52% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria
1:29.765 single_target s frost_strike Fluffy_Pillow 74.1/124: 60% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria
1:31.111 single_target s frost_strike Fluffy_Pillow 50.3/124: 41% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria
1:32.456 Waiting     0.191 sec 26.5/124: 21% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3)
1:32.647 single_target s frost_strike Fluffy_Pillow 31.5/124: 25% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), killing_machine(2), enduring_strength, unleashed_frenzy(3)
1:33.990 single_target m obliterate Fluffy_Pillow 1.5/124: 1% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine(2), enduring_strength, unleashed_frenzy(3)
1:35.334 Waiting     0.497 sec 21.5/124: 17% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine(2), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
1:35.831 single_target m obliterate Fluffy_Pillow 21.5/124: 17% runic_power
2.0/6: 33% rune
icy_talons(3), killing_machine(2), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
1:37.175 single_target n howling_blast Fluffy_Pillow 52.5/124: 42% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine(2), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
1:38.520 single_target s frost_strike Fluffy_Pillow 68.6/124: 55% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine(2), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
1:39.867 single_target m obliterate Fluffy_Pillow 44.8/124: 36% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), killing_machine(2), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
1:41.213 single_target n howling_blast Fluffy_Pillow 69.6/124: 56% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria
1:42.558 single_target k remorseless_winter Fluffy_Pillow 85.8/124: 69% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria
1:43.902 single_target s frost_strike Fluffy_Pillow 98.2/124: 79% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3)
1:45.247 single_target m obliterate Fluffy_Pillow 73.2/124: 59% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3)
1:46.591 single_target n howling_blast Fluffy_Pillow 93.2/124: 75% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3)
1:47.936 single_target o frost_strike Fluffy_Pillow 101.2/124: 82% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3)
1:49.281 single_target m obliterate Fluffy_Pillow 76.2/124: 61% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3)
1:50.627 single_target m obliterate Fluffy_Pillow 101.2/124: 82% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm(5), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3)
1:51.972 single_target l frost_strike Fluffy_Pillow 121.2/124: 98% runic_power
1.0/6: 17% rune
icy_talons(3), gathering_storm(7), killing_machine, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3)
1:53.316 single_target m obliterate Fluffy_Pillow 91.2/124: 74% runic_power
3.0/6: 50% rune
icy_talons(3), gathering_storm(7), killing_machine, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3)
1:54.662 cooldowns h pillar_of_frost Fluffy_Pillow 116.2/124: 94% runic_power
3.0/6: 50% rune
icy_talons(3), gathering_storm(9), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3)
1:54.662 single_target l frost_strike Fluffy_Pillow 116.2/124: 94% runic_power
3.0/6: 50% rune
icy_talons(3), gathering_storm(9), pillar_of_frost, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3)
1:56.008 single_target n howling_blast Fluffy_Pillow 86.2/124: 69% runic_power
3.0/6: 50% rune
icy_talons(3), pillar_of_frost, rime, bonegrinder_frost, unleashed_frenzy(3)
1:57.353 single_target o frost_strike Fluffy_Pillow 99.2/124: 80% runic_power
3.0/6: 50% rune
icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, bonegrinder_frost, unleashed_frenzy(3)
1:58.696 single_target p obliterate Fluffy_Pillow 69.2/124: 56% runic_power
4.0/6: 67% rune
icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, bonegrinder_frost, unleashed_frenzy(3)
2:00.000 trinkets u use_item_dragon_games_equipment Fluffy_Pillow 89.2/124: 72% runic_power
2.0/6: 33% rune
icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), rime, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
2:00.040 cooldowns f abomination_limb Fluffy_Pillow 89.2/124: 72% runic_power
2.0/6: 33% rune
icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), rime, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), dragon_games_equipment, rune_of_hysteria
2:01.385 cooldowns j raise_dead Fluffy_Pillow 89.2/124: 72% runic_power
2.0/6: 33% rune
abomination_limb, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), rime, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
2:01.385 single_target n howling_blast Fluffy_Pillow 89.2/124: 72% runic_power
2.0/6: 33% rune
abomination_limb, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), rime, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
2:02.730 single_target k remorseless_winter Fluffy_Pillow 105.3/124: 85% runic_power
4.0/6: 67% rune
abomination_limb, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
2:04.074 single_target l frost_strike Fluffy_Pillow 117.7/124: 95% runic_power
3.0/6: 50% rune
abomination_limb, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
2:05.420 cooldowns i breath_of_sindragosa Fluffy_Pillow 87.7/124: 71% runic_power
4.0/6: 67% rune
abomination_limb, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
2:05.420 breath U obliterate Fluffy_Pillow 87.7/124: 71% runic_power
6.0/6: 100% rune
abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
2:06.765 breath S howling_blast Fluffy_Pillow 100.7/124: 81% runic_power
6.0/6: 100% rune
abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
2:08.109 breath Y obliterate Fluffy_Pillow 92.6/124: 75% runic_power
6.0/6: 100% rune
abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
2:09.453 default G antimagic_shell PR_Death_Knight_Frost 81.4/124: 66% runic_power
5.0/6: 83% rune
abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
2:09.453 breath S howling_blast Fluffy_Pillow 81.4/124: 66% runic_power
5.0/6: 83% rune
antimagic_shell, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
2:10.798 breath U obliterate Fluffy_Pillow 73.3/124: 59% runic_power
6.0/6: 100% rune
antimagic_shell, rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
2:12.143 breath S howling_blast Fluffy_Pillow 80.1/124: 65% runic_power
5.0/6: 83% rune
antimagic_shell, rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
2:13.485 breath V obliterate Fluffy_Pillow 54.0/124: 44% runic_power
5.0/6: 83% rune
antimagic_shell, rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
2:14.828 breath S howling_blast Fluffy_Pillow 62.2/124: 50% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
2:16.173 breath V obliterate Fluffy_Pillow 60.4/124: 49% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
2:16.486 cooldowns d empower_rune_weapon Fluffy_Pillow 67.2/124: 54% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
2:17.517 breath V obliterate Fluffy_Pillow 55.4/124: 45% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
2:18.688 breath S howling_blast Fluffy_Pillow 62.2/124: 50% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
2:19.859 breath V obliterate Fluffy_Pillow 54.1/124: 44% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
2:20.034 trinkets t use_item_blazebinders_hoof Fluffy_Pillow 78.9/124: 64% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
2:21.028 breath S howling_blast Fluffy_Pillow 60.9/124: 49% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, rime, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria
2:22.198 breath U obliterate Fluffy_Pillow 59.0/124: 48% runic_power
3.0/6: 50% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria
2:23.369 breath R remorseless_winter Fluffy_Pillow 65.8/124: 53% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria
2:24.539 breath S howling_blast Fluffy_Pillow 42.2/124: 34% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4)
2:25.709 breath V obliterate Fluffy_Pillow 37.2/124: 30% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4)
2:26.879 breath V obliterate Fluffy_Pillow 51.6/124: 42% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria
2:28.049 breath S howling_blast Fluffy_Pillow 58.4/124: 47% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria
2:29.220 breath U obliterate Fluffy_Pillow 50.3/124: 41% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria
2:30.390 breath S howling_blast Fluffy_Pillow 57.1/124: 46% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria
2:31.561 breath V obliterate Fluffy_Pillow 37.2/124: 30% runic_power
4.0/6: 67% rune
empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria
2:32.733 breath S howling_blast Fluffy_Pillow 50.2/124: 41% runic_power
3.0/6: 50% rune
empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria
2:33.902 breath V obliterate Fluffy_Pillow 42.2/124: 34% runic_power
4.0/6: 67% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(5)
2:35.072 cooldowns h pillar_of_frost Fluffy_Pillow 55.4/124: 45% runic_power
3.0/6: 50% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria
2:35.072 breath S howling_blast Fluffy_Pillow 55.4/124: 45% runic_power
3.0/6: 50% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria
2:36.241 breath V obliterate Fluffy_Pillow 47.3/124: 38% runic_power
4.0/6: 67% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria
2:37.411 breath V obliterate Fluffy_Pillow 60.3/124: 49% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria
2:38.754 breath V obliterate Fluffy_Pillow 49.1/124: 40% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria
2:40.100 breath T horn_of_winter Fluffy_Pillow 55.9/124: 45% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria
2:41.445 breath U obliterate Fluffy_Pillow 57.1/124: 46% runic_power
2.0/6: 33% rune
icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria
2:42.790 breath S howling_blast Fluffy_Pillow 63.9/124: 52% runic_power
0.0/6: 0% rune
icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria
2:44.134 breath R remorseless_winter Fluffy_Pillow 60.8/124: 49% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(10), bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3)
2:45.477 breath U obliterate Fluffy_Pillow 34.8/124: 28% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3)
2:46.823 Waiting     0.597 sec 36.8/124: 30% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(4), unleashed_frenzy(3)
2:47.420 breath W death_and_decay Fluffy_Pillow 18.8/124: 15% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(2), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3)
2:48.765 single_target m obliterate Fluffy_Pillow 10.8/124: 9% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3)
2:50.048 default G antimagic_shell PR_Death_Knight_Frost 30.8/124: 25% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(5), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
2:50.048 single_target n howling_blast Fluffy_Pillow 30.8/124: 25% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), gathering_storm(5), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
2:51.331 single_target r arcane_torrent Fluffy_Pillow 48.8/124: 39% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(6), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
2:52.612 single_target m obliterate Fluffy_Pillow 68.8/124: 55% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
2:53.893 single_target n howling_blast Fluffy_Pillow 93.8/124: 76% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(8), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
2:55.175 default H frost_strike Fluffy_Pillow 101.8/124: 82% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(9), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
2:56.458 single_target m obliterate Fluffy_Pillow 81.8/124: 66% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(9), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
2:57.739 single_target l frost_strike Fluffy_Pillow 106.8/124: 86% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
2:59.021 single_target m obliterate Fluffy_Pillow 76.8/124: 62% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, rime, enduring_strength, unleashed_frenzy(3)
3:00.302 single_target n howling_blast Fluffy_Pillow 101.8/124: 82% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3)
3:01.583 single_target l frost_strike Fluffy_Pillow 109.8/124: 89% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3)
3:02.863 single_target m obliterate Fluffy_Pillow 84.8/124: 68% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3)
3:04.143 single_target k remorseless_winter Fluffy_Pillow 104.8/124: 85% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3)
3:05.423 single_target l frost_strike Fluffy_Pillow 114.8/124: 93% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3)
3:06.703 single_target n howling_blast Fluffy_Pillow 84.8/124: 68% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3)
3:07.984 single_target p obliterate Fluffy_Pillow 97.8/124: 79% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), gathering_storm, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3)
3:09.266 single_target l frost_strike Fluffy_Pillow 117.8/124: 95% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
3:10.547 single_target p obliterate Fluffy_Pillow 87.8/124: 71% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
3:11.830 single_target l frost_strike Fluffy_Pillow 118.8/124: 96% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
3:13.113 cooldowns h pillar_of_frost Fluffy_Pillow 88.8/124: 72% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), gathering_storm(5), remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria
3:13.113 single_target n howling_blast Fluffy_Pillow 88.8/124: 72% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), gathering_storm(5), pillar_of_frost, remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria
3:14.395 single_target p obliterate Fluffy_Pillow 98.7/124: 80% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria
3:15.677 single_target l frost_strike Fluffy_Pillow 123.5/124: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
3:16.959 single_target m obliterate Fluffy_Pillow 98.5/124: 79% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), enduring_strength_builder, unleashed_frenzy(3)
3:18.241 single_target l frost_strike Fluffy_Pillow 118.5/124: 96% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3)
3:19.522 single_target m obliterate Fluffy_Pillow 93.5/124: 75% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3)
3:20.804 single_target l frost_strike Fluffy_Pillow 123.5/124: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3)
3:22.085 single_target n howling_blast Fluffy_Pillow 93.5/124: 75% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3)
3:23.367 single_target o frost_strike Fluffy_Pillow 101.5/124: 82% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3)
3:24.647 single_target k remorseless_winter Fluffy_Pillow 71.5/124: 58% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3)
3:25.930 single_target p obliterate Fluffy_Pillow 81.5/124: 66% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3)
3:27.211 single_target o frost_strike Fluffy_Pillow 101.5/124: 82% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(2), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
3:28.494 single_target p obliterate Fluffy_Pillow 71.5/124: 58% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(2), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
3:29.777 single_target p obliterate Fluffy_Pillow 96.5/124: 78% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(4), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3)
3:31.056 single_target l frost_strike Fluffy_Pillow 116.5/124: 94% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(6), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
3:32.339 single_target n howling_blast Fluffy_Pillow 91.5/124: 74% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(6), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
3:33.620 single_target o frost_strike Fluffy_Pillow 99.5/124: 80% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
3:34.901 default G antimagic_shell PR_Death_Knight_Frost 69.5/124: 56% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
3:34.901 single_target p obliterate Fluffy_Pillow 69.5/124: 56% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
3:36.183 single_target n howling_blast Fluffy_Pillow 94.5/124: 76% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(9), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3)
3:37.465 single_target o frost_strike Fluffy_Pillow 102.5/124: 83% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3)
3:38.748 single_target p obliterate Fluffy_Pillow 77.5/124: 63% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3)
3:40.030 single_target m obliterate Fluffy_Pillow 97.5/124: 79% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), killing_machine, unleashed_frenzy(3)
3:41.310 single_target l frost_strike Fluffy_Pillow 117.5/124: 95% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3)
3:42.589 single_target p obliterate Fluffy_Pillow 87.5/124: 71% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3)
3:43.871 single_target l frost_strike Fluffy_Pillow 113.7/124: 92% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria
3:45.152 single_target n howling_blast Fluffy_Pillow 96.1/124: 78% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria
3:46.433 single_target k remorseless_winter Fluffy_Pillow 106.0/124: 86% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria
3:47.715 cooldowns h pillar_of_frost Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria
3:47.715 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria
3:48.998 single_target m obliterate Fluffy_Pillow 100.2/124: 81% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria
3:50.280 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria
3:51.563 single_target m obliterate Fluffy_Pillow 94.0/124: 76% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3)
3:52.845 single_target l frost_strike Fluffy_Pillow 114.0/124: 92% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3)
3:54.126 single_target n howling_blast Fluffy_Pillow 84.0/124: 68% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3)
3:55.409 single_target p obliterate Fluffy_Pillow 92.0/124: 74% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3)
3:56.691 single_target l frost_strike Fluffy_Pillow 112.0/124: 90% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(7), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3)
3:57.975 single_target m obliterate Fluffy_Pillow 82.0/124: 66% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3)
3:59.258 single_target m obliterate Fluffy_Pillow 102.0/124: 82% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3)
4:00.000 trinkets u use_item_dragon_games_equipment Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3)
4:00.539 cooldowns f abomination_limb Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), dragon_games_equipment
4:01.821 cooldowns j raise_dead Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3)
4:01.821 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3)
4:03.104 single_target n howling_blast Fluffy_Pillow 99.0/124: 80% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3)
4:04.387 single_target l frost_strike Fluffy_Pillow 107.0/124: 86% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3)
4:05.668 cooldowns i breath_of_sindragosa Fluffy_Pillow 87.0/124: 70% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3)
4:05.668 breath U obliterate Fluffy_Pillow 87.0/124: 70% runic_power
6.0/6: 100% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3)
4:06.951 breath R remorseless_winter Fluffy_Pillow 89.0/124: 72% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
4:08.234 breath S howling_blast Fluffy_Pillow 86.0/124: 69% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
4:09.515 breath V obliterate Fluffy_Pillow 81.0/124: 65% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3)
4:10.796 breath V obliterate Fluffy_Pillow 65.0/124: 52% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
4:12.078 breath S howling_blast Fluffy_Pillow 84.2/124: 68% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
4:13.361 breath S howling_blast Fluffy_Pillow 82.3/124: 66% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(6), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
4:14.643 breath V obliterate Fluffy_Pillow 74.2/124: 60% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(7), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria
4:15.925 default G antimagic_shell PR_Death_Knight_Frost 63.0/124: 51% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria
4:15.925 breath S howling_blast Fluffy_Pillow 63.0/124: 51% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria
4:17.205 breath V obliterate Fluffy_Pillow 55.0/124: 44% runic_power
5.0/6: 83% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria
4:18.483 breath S howling_blast Fluffy_Pillow 66.8/124: 54% runic_power
5.0/6: 83% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, unleashed_frenzy(3)
4:19.765 breath V obliterate Fluffy_Pillow 38.8/124: 31% runic_power
6.0/6: 100% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, unleashed_frenzy(3)
4:20.061 trinkets t use_item_blazebinders_hoof Fluffy_Pillow 58.8/124: 47% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, unleashed_frenzy(3)
4:21.048 breath S howling_blast Fluffy_Pillow 45.8/124: 37% runic_power
5.0/6: 83% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, unleashed_frenzy(3), bound_by_fire_and_blaze
4:22.329 breath U obliterate Fluffy_Pillow 35.8/124: 29% runic_power
5.0/6: 83% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze
4:23.609 breath S howling_blast Fluffy_Pillow 37.8/124: 30% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze
4:24.889 single_target p obliterate Fluffy_Pillow 14.8/124: 12% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze
4:26.170 cooldowns h pillar_of_frost Fluffy_Pillow 34.8/124: 28% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria
4:26.170 single_target n howling_blast Fluffy_Pillow 34.8/124: 28% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), pillar_of_frost, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria
4:27.450 single_target k remorseless_winter Fluffy_Pillow 44.7/124: 36% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria
4:28.733 single_target m obliterate Fluffy_Pillow 57.1/124: 46% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria
4:30.015 single_target n howling_blast Fluffy_Pillow 81.9/124: 66% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria
4:31.297 default H frost_strike Fluffy_Pillow 91.8/124: 74% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria
4:32.579 single_target p obliterate Fluffy_Pillow 68.0/124: 55% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria
4:33.861 single_target o frost_strike Fluffy_Pillow 99.0/124: 80% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(5)
4:35.141 single_target p obliterate Fluffy_Pillow 74.0/124: 60% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(5)
4:36.422 single_target n howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(7), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:37.703 single_target o frost_strike Fluffy_Pillow 102.0/124: 82% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:38.984 single_target p obliterate Fluffy_Pillow 77.0/124: 62% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(8), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6)
4:40.266 cooldowns c empower_rune_weapon Fluffy_Pillow 97.0/124: 78% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(10), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3)
4:40.266 single_target n howling_blast Fluffy_Pillow 102.0/124: 82% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(10), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3)
4:41.382 single_target m obliterate Fluffy_Pillow 116.2/124: 94% runic_power
2.0/6: 33% rune
unholy_ground, empower_rune_weapon, icy_talons(3), killing_machine(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
4:42.496 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
3.0/6: 50% rune
unholy_ground, empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
4:43.613 single_target m obliterate Fluffy_Pillow 94.0/124: 76% runic_power
3.0/6: 50% rune
unholy_ground, empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria
4:44.727 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
3.0/6: 50% rune
unholy_ground, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
4:45.842 single_target n howling_blast Fluffy_Pillow 106.4/124: 86% runic_power
4.0/6: 67% rune
unholy_ground, empower_rune_weapon, icy_talons(3), killing_machine(2), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria
4:46.957 single_target m obliterate Fluffy_Pillow 116.3/124: 94% runic_power
4.0/6: 67% rune
unholy_ground, empower_rune_weapon, icy_talons(3), killing_machine(2), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria
4:48.073 single_target k remorseless_winter Fluffy_Pillow 124.0/124: 100% runic_power
3.0/6: 50% rune
unholy_ground, empower_rune_weapon, icy_talons(3), killing_machine(2), bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria
4:49.189 single_target m obliterate Fluffy_Pillow 124.0/124: 100% runic_power
3.0/6: 50% rune
unholy_ground, empower_rune_weapon, icy_talons(3), killing_machine(2), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria
4:50.303 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria
4:51.417 single_target m obliterate Fluffy_Pillow 99.0/124: 80% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3)
4:52.532 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3)
4:53.647 single_target n howling_blast Fluffy_Pillow 99.0/124: 80% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3)
4:54.761 single_target l frost_strike Fluffy_Pillow 112.0/124: 90% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3)
4:55.876 single_target m obliterate Fluffy_Pillow 92.0/124: 74% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3)
4:56.991 single_target l frost_strike Fluffy_Pillow 112.0/124: 90% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(7), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3)
4:58.105 single_target n howling_blast Fluffy_Pillow 87.0/124: 70% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(7), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3)
4:59.218 single_target p obliterate Fluffy_Pillow 95.0/124: 77% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), gathering_storm(8), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5770 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3848 0 16538 15751 9278
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 330760 315020 0
Runic Power 124 124 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 24.64% 24.64% 2995
Haste 11.86% 11.86% 2016
Versatility 9.98% 3.34% 685
Attack Power 6058 5598 0
Mastery 45.29% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +923 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +111 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +519 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +462 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_tepid_versatility_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=3,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
actions+=/invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
actions+=/antimagic_shell,if=runic_power.deficit>40
actions+=/antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up&cooldown.empower_rune_weapon.charges<2|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up)
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/howling_blast,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&buff.rime.react
actions.obliteration+=/frost_strike,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd
actions.obliteration+=/glacial_advance,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!death_knight.runeforge.razorice&!buff.killing_machine.react&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(rune<2|variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&!buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frost_strike,if=buff.killing_machine.stack<2&runic_power.deficit<20&!variable.2h_check
actions.single_target+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

actions.trinkets=use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=9278
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 50331 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
50330.9 50330.9 45.6 / 0.091% 7435.9 / 14.8% 3204.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.8 7.9 Runic Power 1.83% 54.6 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 50331
Apocalypse 217 0.4% 6.9 46.09sec 9508 7816 Direct 6.9 8237 16491 9508 15.4%

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.85 6.85 0.00 0.00 0.00 1.2166 0.0000 65145.99 65145.99 0.00% 7815.96 7815.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.60% 5.80 1 8 8236.81 6285 10953 8238.37 7263 9677 47742 47742 0.00%
crit 15.40% 1.06 0 5 16490.59 13826 21907 11194.23 0 21907 17404 17404 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for each burst Festering Wound. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [T]:5.85
  • if_expr:variable.st_planning&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [X]:1.00
  • if_expr:debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<21|!talent.commander_of_the_dead)
auto_attack_mh 2844 5.7% 154.5 2.34sec 5522 2377 Direct 154.5 4786 9572 5521 15.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 154.46 154.46 0.00 0.00 0.00 2.3230 0.0000 852842.28 1218377.18 30.00% 2376.88 2376.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.63% 130.72 92 176 4786.05 3852 6687 4785.42 4563 5023 625629 893779 30.00%
crit 15.37% 23.74 6 49 9571.57 7704 13373 9570.66 8585 10514 227213 324598 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 91 0.2% 2.0 0.00sec 13472 0 Direct 2.0 11621 23205 13472 16.0%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 26945.47 26945.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.02% 1.68 0 2 11620.82 10455 14909 11355.33 0 14909 19529 19529 0.00%
crit 15.98% 0.32 0 2 23204.87 20911 29817 6865.76 0 29817 7417 7417 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}
Clawing Shadows 5904 11.8% 73.5 3.94sec 24090 21233 Direct 73.5 20880 41762 24090 15.4%

Stats Details: Clawing Shadows

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 73.46 73.46 0.00 0.00 0.00 1.1346 0.0000 1769622.65 1769622.65 0.00% 21233.01 21233.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.63% 62.16 39 87 20880.03 10996 37421 20895.42 18047 23655 1297992 1297992 0.00%
crit 15.37% 11.29 2 26 41762.50 22596 74841 41776.18 26644 57953 471630 471630 0.00%

Action Details: Clawing Shadows

  • id:207311
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207311
  • name:Clawing Shadows
  • school:shadow
  • tooltip:
  • description:Deals {$s2=0} Shadow damage and causes 1 Festering Wound to burst.

Action Priority List

    generic
    [g]:73.46
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
Dark Transformation 203 0.4% 7.0 46.11sec 8776 6919 Direct 7.0 7608 15219 8776 15.3%

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.95 6.95 0.00 0.00 0.00 1.2686 0.0000 61002.49 61002.49 0.00% 6918.74 6918.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.66% 5.88 1 8 7608.27 5895 9898 7605.84 6485 8649 44770 44770 0.00%
crit 15.34% 1.07 0 6 15219.45 12262 19797 10443.27 0 19797 16232 16232 0.00%

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [S]:5.95
  • if_expr:cooldown.apocalypse.remains<5
    garg_setup
    [b]:1.00
  • if_expr:talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
Death and Decay 235 0.5% 8.4 37.28sec 8392 7535 Direct 91.1 672 1345 775 15.3%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.42 91.11 0.00 0.00 0.00 1.1138 0.0000 70624.14 70624.14 0.00% 7534.85 7534.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.71% 77.18 47 109 672.34 462 1003 672.85 610 728 51893 51893 0.00%
crit 15.29% 13.93 3 30 1344.59 951 2005 1345.71 1125 1612 18732 18732 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    garg_setup
    [c]:1.00
  • if_expr:!death_and_decay.ticking&debuff.festering_wound.stack>0
    generic
    [f]:7.42
  • if_expr:!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=10|pet.gargoyle.active&pet.gargoyle.remains>5|pet.army_ghoul.active&pet.army_ghoul.remains>5))&death_knight.fwounded_targets=active_enemies
Death Coil 5622 (7280) 11.2% (14.5%) 99.4 2.99sec 21930 18987 Direct 99.4 (235.3) 14688 29369 16945 15.4% (15.4%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 99.43 99.38 0.00 0.00 0.00 1.1550 0.0000 1683976.68 1683976.68 0.00% 18986.84 18986.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.62% 84.10 56 112 14687.90 9299 23237 14697.33 13892 15647 1235204 1235204 0.00%
crit 15.38% 15.28 3 30 29368.74 19802 45820 29387.66 24172 36578 448773 448773 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Priority List

    generic
    [e]:92.34
  • if_expr:!variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
    high_prio_actions
    [k]:7.08
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
    Coil of Devastation 1658 3.3% 0.0 0.00sec 0 0 Periodic 135.9 3653 0 3653 0.0% 90.6%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 135.89 135.89 84.32 0.0000 2.0000 496415.42 496415.42 0.00% 1826.53 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 135.89 103 169 3653.03 1395 14773 3659.56 3126 4257 496415 496415 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 940 1.9% 7.1 29.36sec 39899 0 Direct 7.1 34507 69013 39926 15.7%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.06 7.05 0.00 0.00 0.00 0.0000 0.0000 281506.33 402162.15 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.29% 5.94 1 9 34506.69 34507 34507 34506.69 34507 34507 205075 292972 30.00%
crit 15.71% 1.11 0 7 69013.39 69013 69013 47837.26 0 69013 76431 109190 20.80%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1094 2.2% 25.0 11.95sec 13130 10955 Direct 25.0 11378 22757 13130 15.4%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.99 24.99 0.00 0.00 0.00 1.1986 0.0000 328157.69 468808.65 30.00% 10955.02 10955.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.60% 21.14 11 32 11378.14 8490 18664 11366.89 10318 12688 240581 343696 30.00%
crit 15.40% 3.85 0 12 22757.15 16979 37327 22338.88 0 34430 87577 125113 29.49%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [d]:1.60
  • if_expr:debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40
    generic
    [h]:23.40
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
Festering Wound 1888 3.8% 100.9 3.65sec 5611 0 Direct 100.9 4863 9729 5611 15.4%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 100.86 100.86 0.00 0.00 0.00 0.0000 0.0000 565960.45 565960.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.63% 85.36 56 116 4863.26 3434 7923 4864.35 4623 5118 415127 415127 0.00%
crit 15.37% 15.50 3 31 9728.60 6938 15631 9731.19 8347 11331 150833 150833 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}
Outbreak 79 0.2% 11.6 27.05sec 2035 1722 Direct 11.6 1765 3530 2035 15.3%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.1822 0.0000 23660.58 23660.58 0.00% 1721.77 1721.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.69% 9.84 4 14 1765.11 1303 2679 1765.53 1515 2012 17376 17376 0.00%
crit 15.31% 1.78 0 8 3530.25 2614 5329 2988.12 0 5329 6284 6284 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    high_prio_actions
    [l]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
Soul Reaper 575 (3347) 1.1% (6.7%) 15.6 6.86sec 64299 52800 Direct 15.6 (31.3) 9575 19158 11049 15.4% (15.4%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.64 15.64 0.00 0.00 0.00 1.2178 0.0000 172789.65 172789.65 0.00% 52800.33 52800.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.61% 13.23 5 19 9574.86 5947 13509 9581.41 8678 10588 126696 126696 0.00%
crit 15.39% 2.41 0 8 19157.78 11893 26639 17636.78 0 25881 46094 46094 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [W]:15.64
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
    Soul Reaper (_execute) 2772 5.5% 15.6 6.86sec 53270 0 Direct 15.6 46166 92320 53270 15.4%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.63 15.63 0.00 0.00 0.00 0.0000 0.0000 832739.81 832739.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.61% 13.23 4 20 46165.71 34961 62414 46205.98 42558 50596 610588 610588 0.00%
crit 15.39% 2.41 0 9 92320.34 74673 123107 85280.91 0 121376 222152 222152 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}
Unholy Assault 196 0.4% 3.6 91.68sec 16173 13857 Direct 3.6 14035 28078 16173 15.2%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.64 3.64 0.00 0.00 0.00 1.1673 0.0000 58808.13 58808.13 0.00% 13856.77 13856.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.78% 3.08 0 4 14035.33 11703 17025 14010.92 0 17025 43266 43266 0.00%
crit 15.22% 0.55 0 4 28078.06 23405 34050 12649.01 0 34050 15542 15542 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [V]:3.53
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [a]:0.10
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=21
Virulent Plague 840 1.7% 11.6 27.05sec 21675 0 Periodic 99.5 2196 4393 2532 15.3% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.50 99.50 10.62 0.0000 3.0000 251958.93 251958.93 0.00% 844.11 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 84.69% 84.27 59 114 2196.01 1571 3575 2196.10 2094 2299 185051 185051 0.00%
crit 15.31% 15.23 3 34 4393.21 3205 7249 4393.95 3898 5094 66908 66908 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.125000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.
pet - ghoul 6325 / 6325
auto_attack 4537 9.0% 195.4 1.53sec 6949 4539 Direct 195.4 6027 12035 6949 15.4%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 195.40 195.40 0.00 0.00 0.00 1.5311 0.0000 1357874.13 1939869.65 30.00% 4538.70 4538.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.65% 165.40 124 213 6026.75 2090 13152 6036.56 5501 6710 996812 1424054 30.00%
crit 15.35% 30.00 11 54 12034.99 4181 25949 12058.65 7701 16706 361062 515816 30.00%

Action Details: Auto Attack

  • id:0
  • school:none
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:1.00
Claw 334 0.7% 38.1 8.02sec 2641 2629 Direct 38.1 2290 4581 2641 15.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.09 38.09 0.00 0.00 0.00 1.0045 0.0000 100598.16 143715.33 30.00% 2629.12 2629.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.67% 32.25 18 46 2289.75 1881 8262 2287.36 2080 2525 73854 105508 30.00%
crit 15.33% 5.84 0 18 4580.97 3763 6391 4569.05 0 5837 26745 38208 29.96%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:38.09
  • if_expr:energy>70
Gnaw 1 0.0% 3.7 90.14sec 95 94 Direct 3.7 82 164 95 15.2%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0045 0.0000 352.65 503.80 30.00% 94.14 94.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.79% 3.16 0 4 82.06 67 106 82.01 0 103 260 371 29.97%
crit 15.21% 0.57 0 4 164.18 133 206 75.90 0 206 93 133 13.87%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:3.73
Sweeping Claws 1453 2.9% 69.2 4.23sec 6275 6247 Direct 69.2 5438 10880 6275 15.4%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 69.24 69.24 0.00 0.00 0.00 1.0045 0.0000 434481.10 434481.10 0.00% 6246.76 6246.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.62% 58.59 40 79 5437.90 4032 8455 5441.45 5094 5822 318629 318629 0.00%
crit 15.38% 10.65 1 25 10880.41 8063 16682 10888.56 8723 14539 115852 115852 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:69.24
pet - gargoyle 27984 / 4724
Gargoyle Strike 27984 9.3% 32.0 6.62sec 43728 32770 Direct 32.0 37922 75894 43727 15.3%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.00 32.00 0.00 0.00 0.00 1.3344 0.0000 1399220.55 1399220.55 0.00% 32770.17 32770.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.71% 27.11 18 32 37922.19 10643 84425 37924.72 31914 45286 1027950 1027950 0.00%
crit 15.29% 4.89 0 14 75894.47 24434 159292 75440.48 0 149062 371271 371271 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.
pet - army_ghoul 26791 / 5924
auto_attack 22428 9.8% 367.4 0.66sec 3998 3641 Direct 367.4 3466 6933 3998 15.4%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 367.40 367.40 0.00 0.00 0.00 1.0983 0.0000 1468998.24 2098622.42 30.00% 3640.60 3640.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.64% 310.97 256 338 3465.83 1641 4710 3465.20 2943 3683 1077758 1539694 30.00%
crit 15.36% 56.43 30 85 6933.18 3283 9420 6932.31 5779 7727 391240 558928 30.00%

Action Details: Auto Attack

  • id:0
  • school:none
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:2.00
Claw 4363 1.9% 220.1 1.21sec 1298 1298 Direct 220.1 1126 2252 1298 15.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 220.09 220.09 0.00 0.00 0.00 1.0000 0.0000 285756.33 408233.74 30.00% 1298.35 1298.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.68% 186.38 158 205 1125.84 548 1553 1125.68 973 1204 209830 299765 30.00%
crit 15.32% 33.72 15 56 2251.99 1097 3106 2251.76 1795 2530 75927 108469 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:28.14
    default
    [ ]:27.54
    default
    [ ]:27.27
    default
    [ ]:29.34
    default
    [ ]:27.01
    default
    [ ]:26.93
    default
    [ ]:26.93
    default
    [ ]:26.93
pet - magus_of_the_dead 7598 / 3848
Frostbolt 1507 1.5% 27.9 10.79sec 8169 5634 Direct 27.9 7074 14168 8172 15.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.91 27.90 0.00 0.00 0.00 1.4499 0.0000 227956.14 227956.14 0.00% 5634.11 5634.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.53% 23.58 13 32 7074.40 3822 10526 7076.77 6349 7789 166823 166823 0.00%
crit 15.47% 4.31 0 14 14168.46 7645 20760 14017.38 0 19884 61134 61134 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:14.00
    default
    [ ]:14.01
Shadow Bolt 6091 6.1% 112.3 2.60sec 8189 6477 Direct 112.2 7104 14222 8192 15.3%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.28 112.25 0.00 0.00 0.00 1.2643 0.0000 919536.47 919536.47 0.00% 6477.30 6477.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.71% 95.09 73 119 7103.93 3595 10173 7107.16 6585 7591 675512 675512 0.00%
crit 15.29% 17.16 4 33 14222.08 7190 20347 14226.23 12044 16613 244024 244024 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:60.49
    default
    [ ]:60.55
pet - apoc_ghoul 9853 / 4352
auto_attack 8050 7.1% 290.9 3.84sec 3659 2700 Direct 290.9 3172 6345 3659 15.4%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 290.89 290.89 0.00 0.00 0.00 1.3554 0.0000 1064378.45 1520579.41 30.00% 2699.73 2699.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.65% 246.22 178 313 3171.91 1801 4647 3175.40 2915 3423 780998 1115739 30.00%
crit 15.35% 44.66 19 73 6344.66 3655 9294 6351.22 5610 7109 283381 404840 30.00%

Action Details: Auto Attack

  • id:0
  • school:none
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:6.77
Claw 1802 1.6% 198.4 5.68sec 1201 1201 Direct 198.4 1041 2082 1201 15.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 198.41 198.41 0.00 0.00 0.00 1.0000 0.0000 238314.91 340458.55 30.00% 1201.11 1201.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.64% 167.94 120 218 1041.25 620 1553 1042.41 956 1125 174866 249815 30.00%
crit 15.36% 30.47 10 55 2082.00 1239 3106 2084.50 1793 2371 63449 90643 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:49.60
    default
    [ ]:49.60
    default
    [ ]:49.60
    default
    [ ]:49.60
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Algeth'ar Puzzle (_box_channel) 2.0 0.00sec

Stats Details: Algethar Puzzle Box Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 2.00 0.00 0.00 1.5585 1.5585 0.00 0.00 0.00% 0.00 0.00

Action Details: Algethar Puzzle Box Channel

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
Anti-Magic Shell 7.1 44.52sec

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 7.09 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    default
    [G]:7.09
  • if_expr:runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
Army of the Dead 2.0 175.57sec

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6616 0.4688 0.00 0.00 0.00% 0.00 0.00

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    high_prio_actions
    [j]:1.00
  • if_expr:talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 184.38sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [m]:2.00
  • if_expr:(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
Empower Rune Weapon 2.4 169.31sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.38 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [U]:2.27
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=21|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
    garg_setup
    [Z]:0.10
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=21
Phial of Tepid Versatility 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371172
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Outbreak (_aoe) 11.6 27.05sec

Stats Details: Outbreak Aoe

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Outbreak Aoe

  • id:196780
  • school:shadow
  • range:200.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196780
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:{$@spelldesc77575=Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}}
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    high_prio_actions
    [i]:1.50
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Raise Dead 1.0 0.00sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
Summon Gargoyle 2.0 185.37sec

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [R]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead
    garg_setup
    [Y]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
Unholy Strength 21.9 13.36sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 21.89 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 181.8sec 181.8sec 30.0sec 20.27% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2015.79
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2015.79

Trigger Details

  • interval_min/max:181.8s / 182.3s
  • trigger_min/max:181.8s / 182.3s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • algethar_puzzle_1:20.27%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Anti-Magic Shell 7.1 0.0 44.5sec 44.5sec 6.9sec 16.41% 0.00% 0.0 (0.0) 7.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 105.5s
  • trigger_min/max:40.0s / 105.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s

Stack Uptimes

  • antimagic_shell_1:16.41%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Berserking 2.0 0.0 184.4sec 184.4sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 189.3s
  • trigger_min/max:180.0s / 189.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Commander of the Dead 7.0 0.0 46.1sec 46.1sec 28.6sec 66.19% 90.19% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 56.3s
  • trigger_min/max:45.0s / 56.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:66.19%

Spelldata

  • id:390260
  • name:Commander of the Dead
  • tooltip:Your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead ghouls deal {$390264s1=35}% increased damage.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dark Transformation 7.0 0.0 46.1sec 46.1sec 22.5sec 52.27% 58.45% 0.0 (0.0) 6.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 56.3s
  • trigger_min/max:45.0s / 56.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.0s

Stack Uptimes

  • dark_transformation_1:52.27%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Dragon Games Equipment 2.8 0.0 120.0sec 120.0sec 0.8sec 0.76% 0.00% 7.1 (7.1) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.91
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.0s
  • trigger_min/max:120.0s / 120.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.9s

Stack Uptimes

  • dragon_games_equipment_1:0.76%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 300.3sec 0.0sec 27.5sec 13.46% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.9s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.46%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 169.4sec 169.4sec 19.3sec 15.22% 0.00% 6.9 (6.9) 2.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 189.5s
  • trigger_min/max:120.0s / 189.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:15.22%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Festermight 13.1 67.2 23.2sec 3.7sec 19.3sec 84.30% 0.00% 0.0 (0.0) 12.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 41.8s
  • trigger_min/max:0.8s / 31.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • festermight_1:7.71%
  • festermight_2:8.12%
  • festermight_3:8.69%
  • festermight_4:15.92%
  • festermight_5:10.84%
  • festermight_6:9.92%
  • festermight_7:7.85%
  • festermight_8:5.50%
  • festermight_9:4.21%
  • festermight_10:2.55%
  • festermight_11:1.28%
  • festermight_12:0.78%
  • festermight_13:0.50%
  • festermight_14:0.34%
  • festermight_15:0.08%
  • festermight_16:0.00%
  • festermight_17:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 98.4 165.8sec 3.0sec 292.5sec 98.53% 0.00% 96.4 (96.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.4s / 328.8s
  • trigger_min/max:0.8s / 16.3s
  • trigger_pct:100.00%
  • duration_min/max:6.5s / 355.7s

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.85%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 12.1 8.3 24.6sec 14.2sec 10.7sec 43.08% 0.00% 8.3 (8.3) 11.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 175.4s
  • trigger_min/max:0.8s / 175.4s
  • trigger_pct:15.02%
  • duration_min/max:0.0s / 60.1s

Stack Uptimes

  • rune_mastery_1:43.08%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 41.7 6.0 7.1sec 6.2sec 2.6sec 36.10% 0.00% 6.0 (6.0) 41.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 71.2s
  • trigger_min/max:0.8s / 71.2s
  • trigger_pct:47.93%
  • duration_min/max:0.0s / 20.9s

Stack Uptimes

  • runic_corruption_1:36.10%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 21.1 0.2 13.9sec 13.8sec 1.0sec 7.10% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.3s / 55.9s
  • trigger_min/max:1.3s / 55.9s
  • trigger_pct:14.17%
  • duration_min/max:0.0s / 9.1s

Stack Uptimes

  • sudden_doom_1:7.10%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.6 0.0 91.7sec 91.7sec 19.5sec 23.66% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.3s
  • trigger_min/max:90.0s / 97.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • unholy_assault_1:23.66%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Ground 8.4 0.0 37.3sec 37.3sec 9.8sec 27.58% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 94.5s
  • trigger_min/max:10.0s / 94.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.9s

Stack Uptimes

  • unholy_ground_1:27.58%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 13.4 36.0sec 13.4sec 24.6sec 69.58% 0.00% 13.4 (13.4) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 176.5s
  • trigger_min/max:0.0s / 62.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 171.9s

Stack Uptimes

  • unholy_strength_1:69.58%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 184.4sec 184.4sec 24.5sec 98.05% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.4s / 188.1s
  • trigger_min/max:181.4s / 188.1s
  • trigger_pct:100.00%
  • duration_min/max:22.6s / 25.0s

Stack Uptimes

  • dark_empowerment_1:98.05%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Tepid Versatility

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_phial_of_tepid_versatility
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Phial of Tepid Versatility

Stat Details

  • stat:versatility_rating
  • amount:745.00

Spelldata

  • id:371172
  • name:Phial of Tepid Versatility
  • tooltip:Versatility increased by {$=}w1.
  • description:Increases your Versatility by {$s1=315}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 25.8 9.0 52.0 11.4s 1.3s 120.7s
Rune ready 158.2 118.0 202.0 2.0s 0.0s 13.1s
Runic Corruption from Runic Power Spent 47.7 24.0 73.0 6.2s 0.8s 71.2s
Festering Wound from Festering Strike 62.5 39.0 87.0 12.0s 1.2s 69.3s
Festering Wound from Infected Claws 32.2 13.0 55.0 9.2s 1.0s 97.3s
Festering Wound from Unholy Assault 14.5 12.0 16.0 91.7s 90.0s 97.3s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.96% 0.00% 16.95% 2.0s 0.0s 18.8s
ghoul - Energy Cap 0.53% 0.04% 1.46% 0.2s 0.0s 1.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Raise Dead0.0000.0000.000300.000240.008359.984
Army of the Dead4.0160.000139.0838.0350.000139.083
Summon Gargoyle4.3652.3339.0848.7305.73312.475
Apocalypse2.1450.00017.75614.7558.75229.803
Unholy Assault3.7240.0009.24613.5428.59618.500
Dark Transformation1.4370.00011.26810.0024.77420.872
Empower Rune Weapon32.4380.00069.49777.14771.078100.069
Death and Decay6.9330.00064.54260.39435.771124.082
Soul Reaper13.0390.000233.246206.254158.864255.088

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=315542)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1111.865 / 1.1076.32223.729
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
36.70255.17278.447 / 77.261105.668150.663

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
ApocalypseRune13.7012.597.96%0.921.118.12%
Empower Rune WeaponRunic Power11.4056.632.38%4.970.350.61%
Empower Rune WeaponRune11.4010.126.39%0.891.2811.20%
Festering WoundRunic Power100.86294.9612.41%2.927.632.52%
Rune RegenerationRune135.53135.5385.65%1.000.000.00%
Runic AttenuationRunic Power75.37366.4215.41%4.8610.412.76%
Army of the DeadRunic Power2.0019.780.83%9.890.221.11%
Clawing ShadowsRunic Power73.46718.3530.22%9.7816.232.21%
Death and DecayRunic Power8.4282.823.48%9.841.341.59%
Festering StrikeRunic Power24.99483.3820.34%19.3416.473.30%
OutbreakRunic Power11.62113.084.76%9.733.172.72%
Soul ReaperRunic Power15.64149.686.30%9.576.704.29%
Summon GargoyleRunic Power2.0091.953.87%45.978.058.05%
pet - ghoul
Dark TransformationEnergy6.95337.067.98%48.49358.0351.51%
energy_regenEnergy1334.473888.5592.02%2.9129.010.74%
pet - army_ghoul
energy_regenEnergy918.257537.78100.00%8.21757.029.13%
pet - apoc_ghoul
energy_regenEnergy729.945816.97100.00%7.971758.0923.21%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.24%1.001.000.00
Clawing ShadowsRune 73.4673.4645.59%1.001.0024090.46
Death and DecayRune 8.428.425.22%1.001.008392.37
Death CoilRunic Power 99.432351.68100.00%23.6523.65927.16
Festering StrikeRune 24.9949.9931.02%2.002.006565.08
OutbreakRune 11.6211.627.21%1.001.002035.39
Soul ReaperRune 15.6415.649.71%1.001.0064299.09
pet - ghoul
ClawEnergy 38.091523.6835.49%40.0040.0066.02
Sweeping ClawsEnergy 69.242769.6864.51%40.0040.00156.87
pet - army_ghoul
ClawEnergy 220.098803.67100.00%40.0040.0032.46
pet - apoc_ghoul
ClawEnergy 198.427936.61100.00%40.0040.0030.03
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 8.0 7.92 7.85 70.6 23.4 0.0 67.0
Rune 5.0 0.53 0.54 0.0 3.1 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 50330.92
Minimum 45131.41
Maximum 56588.63
Spread ( max - min ) 11457.21
Range [ ( max - min ) / 2 * 100% ] 11.38%
Standard Deviation 2014.4536
5th Percentile 47370.80
95th Percentile 53924.16
( 95th Percentile - 5th Percentile ) 6553.36
Mean Distribution
Standard Deviation 23.2625
95.00% Confidence Interval ( 50285.33 - 50376.51 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6154
0.1 Scale Factor Error with Delta=300 34642
0.05 Scale Factor Error with Delta=300 138567
0.01 Scale Factor Error with Delta=300 3464163
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 50330.92
Minimum 45131.41
Maximum 56588.63
Spread ( max - min ) 11457.21
Range [ ( max - min ) / 2 * 100% ] 11.38%
Standard Deviation 2014.4536
5th Percentile 47370.80
95th Percentile 53924.16
( 95th Percentile - 5th Percentile ) 6553.36
Mean Distribution
Standard Deviation 23.2625
95.00% Confidence Interval ( 50285.33 - 50376.51 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6154
0.1 Scale Factor Error with Delta=300 34642
0.05 Scale Factor Error with Delta=300 138567
0.01 Scale Factor Error with Delta=300 3464163
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 50330.92
Minimum 45131.41
Maximum 56588.63
Spread ( max - min ) 11457.21
Range [ ( max - min ) / 2 * 100% ] 11.38%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 7542156.68
Minimum 5695066.41
Maximum 9559256.48
Spread ( max - min ) 3864190.06
Range [ ( max - min ) / 2 * 100% ] 25.62%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2
6 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
7 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
A 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
B 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
E 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Default action list Executed every time the actor is available.
# count action,conditions
F 1.00 auto_attack
0.00 mind_freeze,if=target.debuff.casting.react
G 7.09 antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
0.00 antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle)
0.00 variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
Variables
0.00 variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle|time>20
0.00 variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
0.00 variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
0.00 variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4)|fight_remains<5&debuff.festering_wound.stack>=1
0.00 variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
0.00 variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
0.00 variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
0.00 invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=20|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))|fight_remains<=21
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
H 0.00 call_action_list,name=high_prio_actions
Call Action Lists
I 0.00 call_action_list,name=trinkets
J 0.00 run_action_list,name=garg_setup,if=variable.garg_setup=0
K 0.00 call_action_list,name=cooldowns,if=variable.st_planning
L 0.00 call_action_list,name=aoe_cooldowns,if=variable.adds_remain
M 0.00 call_action_list,name=racials
N 0.00 call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
O 0.00 call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
P 0.00 call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
Q 0.00 call_action_list,name=generic,if=active_enemies<=3
actions.cooldowns
# count action,conditions
R 1.00 summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
ST/Cleave Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
S 5.95 dark_transformation,if=cooldown.apocalypse.remains<5
T 5.85 apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
U 2.27 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=21|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 abomination_limb,if=rune<3&variable.st_planning
V 3.53 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
W 15.64 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.garg_setup
# count action,conditions
X 1.00 apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<21|!talent.commander_of_the_dead)
Garg Setup
0.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
0.00 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
Y 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
Z 0.10 empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=21
a 0.10 unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=21
0.00 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
b 1.00 dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
c 1.00 any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>0
d 1.60 festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40
0.00 death_coil,if=rune<=1
actions.generic
# count action,conditions
e 92.34 death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
Generic
0.00 epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
f 7.42 any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=10|pet.gargoyle.active&pet.gargoyle.remains>5|pet.army_ghoul.active&pet.army_ghoul.remains>5))&death_knight.fwounded_targets=active_enemies
g 73.46 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
h 23.40 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 death_coil
actions.high_prio_actions
# count action,conditions
i 1.50 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Priority Actions
j 1.00 army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
k 7.08 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
l 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
m 2.00 berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.trinkets
# count action,conditions
n 2.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,use_off_gcd=1,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain
Trinkets
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
o 2.82 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
0.00 use_item,use_off_gcd=1,slot=main_hand,if=(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFilncdbYkkGkdXUVeefggegegmgeglegogeegehgegeggheegggeheggehgGelSheTfeggeehgegegheleggeegeggGeehegeSgehVlTefggeehgeegggeeheghegGleggeghoeSeheTfegglehegegehgeggegegelnjefgSRkkGkVTUWeefgemhWegeegglWeeggegWheegWeggeWehGehlSWeTfeWegegWegehWeeoglWeegeWegegWheeSVWTfglkWeeGegeee

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 4 raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 5 army_of_the_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 6 trinket_1_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
Pre precombat 7 trinket_2_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
Pre precombat A trinket_1_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
Pre precombat B trinket_2_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
Pre precombat C trinket_1_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
Pre precombat D trinket_2_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
Pre precombat E trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
0:00.000 default F auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
0:00.000 high_prio_actions i potion Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust
0:00.000 high_prio_actions l outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, elemental_potion_of_ultimate_power
0:00.000 trinkets n use_item_algethar_puzzle_box Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, elemental_potion_of_ultimate_power
0:01.361 garg_setup c death_and_decay Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, algethar_puzzle, elemental_potion_of_ultimate_power
0:02.381 garg_setup d festering_strike Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_ground, algethar_puzzle, elemental_potion_of_ultimate_power
0:03.354 garg_setup b dark_transformation Fluffy_Pillow 53.0/100: 53% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, algethar_puzzle, elemental_potion_of_ultimate_power
0:03.354 garg_setup Y summon_gargoyle Fluffy_Pillow 53.0/100: 53% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:04.326 high_prio_actions k death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:05.298 high_prio_actions k death_coil Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons, dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:06.271 default G antimagic_shell PR_Death_Knight_Unholy 45.0/100: 45% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons(2), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:06.271 high_prio_actions k death_coil Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(2), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:07.243 garg_setup d festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:08.215 garg_setup X apocalypse Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:09.189 cooldowns U empower_rune_weapon Fluffy_Pillow 57.0/100: 57% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:09.189 cooldowns V unholy_assault Fluffy_Pillow 62.0/100: 62% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:10.034 generic e death_coil Fluffy_Pillow 62.0/100: 62% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:10.790 generic e death_coil Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:11.544 generic f death_and_decay Fluffy_Pillow 2.0/100: 2% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:12.300 generic g clawing_shadows Fluffy_Pillow 12.0/100: 12% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:13.055 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:13.810 generic e death_coil Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:14.567 generic g clawing_shadows Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:15.323 generic e death_coil Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:16.077 generic g clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:16.832 racials m berserking Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:16.832 generic g clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:17.585 generic e death_coil Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:18.340 generic g clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:19.094 high_prio_actions l outbreak Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:19.849 generic e death_coil Fluffy_Pillow 35.0/100: 35% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:20.604 generic g clawing_shadows Fluffy_Pillow 5.0/100: 5% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:21.358 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:21.358 generic g clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, dragon_games_equipment, elemental_potion_of_ultimate_power
0:22.113 generic e death_coil Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, dragon_games_equipment, elemental_potion_of_ultimate_power
0:22.868 generic e death_coil Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:23.623 generic g clawing_shadows Fluffy_Pillow 11.0/100: 11% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:24.377 generic e death_coil Fluffy_Pillow 34.0/100: 34% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:25.131 generic h festering_strike Fluffy_Pillow 4.0/100: 4% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:25.885 generic g clawing_shadows Fluffy_Pillow 29.0/100: 29% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:26.640 generic e death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:27.395 generic g clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:28.151 generic e death_coil Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(15), commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:28.902 generic g clawing_shadows Fluffy_Pillow 5.0/100: 5% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:29.657 generic g clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, algethar_puzzle, elemental_potion_of_ultimate_power
0:30.678 generic h festering_strike Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(2), commander_of_the_dead, algethar_puzzle
0:31.698 generic e death_coil Fluffy_Pillow 61.0/100: 61% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(2), commander_of_the_dead
0:32.718 generic e death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(2), commander_of_the_dead
0:33.738 generic g clawing_shadows Fluffy_Pillow 1.0/100: 1% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(2)
0:34.758 generic g clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), festermight(3)
0:35.779 generic g clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), festermight(4)
0:36.800 generic e death_coil Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, icy_talons(3), festermight(5)
0:37.821 generic h festering_strike Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), runic_corruption, festermight(5)
0:38.841 generic e death_coil Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, icy_talons(3), festermight(5)
0:39.861 generic g clawing_shadows Fluffy_Pillow 0.0/100: 0% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), festermight(5)
0:40.882 generic g clawing_shadows Fluffy_Pillow 18.0/100: 18% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(6)
0:42.208 generic e death_coil Fluffy_Pillow 31.0/100: 31% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(7)
0:43.534 Waiting     0.325 sec 6.0/100: 6% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(7)
0:43.859 generic h festering_strike Fluffy_Pillow 6.0/100: 6% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(7)
0:45.183 generic g clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(7)
0:46.508 default G antimagic_shell PR_Death_Knight_Unholy 44.0/100: 44% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(8)
0:46.508 generic e death_coil Fluffy_Pillow 44.0/100: 44% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(8)
0:47.835 high_prio_actions l outbreak Fluffy_Pillow 14.0/100: 14% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), runic_corruption, festermight(8)
0:49.160 cooldowns S dark_transformation Fluffy_Pillow 24.0/100: 24% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, icy_talons(3)
0:50.485 Waiting     0.748 sec 24.0/100: 24% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead
0:51.233 generic h festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead
0:52.558 generic e death_coil Fluffy_Pillow 44.0/100: 44% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead
0:53.882 cooldowns T apocalypse Fluffy_Pillow 19.0/100: 19% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead
0:55.208 generic f death_and_decay Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead
0:56.536 generic e death_coil Fluffy_Pillow 46.0/100: 46% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(4), commander_of_the_dead
0:57.799 generic g clawing_shadows Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead
0:59.059 generic g clawing_shadows Fluffy_Pillow 59.0/100: 59% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead
1:00.320 generic e death_coil Fluffy_Pillow 72.0/100: 72% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
1:01.584 generic e death_coil Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, festermight(6), commander_of_the_dead
1:02.847 generic h festering_strike Fluffy_Pillow 42.0/100: 42% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
1:04.109 generic g clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
1:05.371 generic e death_coil Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead
1:06.695 generic g clawing_shadows Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, festermight(7), commander_of_the_dead
1:08.019 generic e death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(8), commander_of_the_dead
1:09.344 generic g clawing_shadows Fluffy_Pillow 73.0/100: 73% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(8), commander_of_the_dead
1:10.669 generic h festering_strike Fluffy_Pillow 86.0/100: 86% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead
1:11.994 generic e death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead
1:13.321 high_prio_actions l outbreak Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead
1:14.646 generic e death_coil Fluffy_Pillow 80.0/100: 80% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead
1:15.973 generic g clawing_shadows Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, commander_of_the_dead
1:17.300 generic g clawing_shadows Fluffy_Pillow 68.0/100: 68% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight, commander_of_the_dead
1:18.626 generic e death_coil Fluffy_Pillow 81.0/100: 81% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(2), commander_of_the_dead
1:19.951 generic e death_coil Fluffy_Pillow 56.0/100: 56% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(2)
1:21.276 generic g clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(2)
1:22.601 generic e death_coil Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3)
1:23.925 generic g clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3)
1:25.250 generic g clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(4)
1:26.573 default G antimagic_shell PR_Death_Knight_Unholy 40.0/100: 40% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(5)
1:26.573 generic e death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, icy_talons(3), festermight(5)
1:27.898 generic e death_coil Fluffy_Pillow 15.0/100: 15% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(5)
1:29.223 generic h festering_strike Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(5)
1:30.551 generic e death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(5)
1:31.877 generic g clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(5)
1:33.203 generic e death_coil Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(6)
1:34.528 cooldowns S dark_transformation Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(6)
1:35.853 generic g clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
1:37.177 generic e death_coil Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead
1:38.503 generic h festering_strike Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead
1:39.829 cooldowns V unholy_assault Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead
1:41.154 high_prio_actions l outbreak Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, commander_of_the_dead
1:42.261 cooldowns T apocalypse Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, commander_of_the_dead
1:43.366 generic e death_coil Fluffy_Pillow 53.0/100: 53% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead
1:44.473 generic f death_and_decay Fluffy_Pillow 53.0/100: 53% runic_power
5.0/6: 83% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead
1:45.578 generic g clawing_shadows Fluffy_Pillow 68.0/100: 68% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead
1:46.629 generic g clawing_shadows Fluffy_Pillow 81.0/100: 81% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead
1:47.681 generic e death_coil Fluffy_Pillow 99.0/100: 99% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead
1:48.732 generic e death_coil Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead
1:49.784 generic h festering_strike Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead
1:50.835 generic g clawing_shadows Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead
1:51.887 generic e death_coil Fluffy_Pillow 82.0/100: 82% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead
1:52.939 generic e death_coil Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead
1:53.992 generic g clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), commander_of_the_dead
1:55.045 generic g clawing_shadows Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead
1:56.151 generic g clawing_shadows Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), unholy_assault, festermight(9), commander_of_the_dead
1:57.257 generic e death_coil Fluffy_Pillow 71.0/100: 71% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), unholy_assault, festermight(10), commander_of_the_dead
1:58.362 generic e death_coil Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), unholy_assault, festermight(10), commander_of_the_dead
1:59.467 generic h festering_strike Fluffy_Pillow 16.0/100: 16% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), unholy_assault, festermight(10), commander_of_the_dead
2:00.573 generic e death_coil Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(10), commander_of_the_dead
2:01.899 generic g clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(10), commander_of_the_dead
2:03.225 generic h festering_strike Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), commander_of_the_dead
2:04.550 generic e death_coil Fluffy_Pillow 44.0/100: 44% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3)
2:05.876 generic g clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3)
2:07.200 default G antimagic_shell PR_Death_Knight_Unholy 27.0/100: 27% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight
2:07.200 Waiting     0.981 sec 27.0/100: 27% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight
2:08.181 high_prio_actions l outbreak Fluffy_Pillow 27.0/100: 27% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight
2:09.506 generic e death_coil Fluffy_Pillow 42.0/100: 42% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight
2:10.831 generic g clawing_shadows Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight
2:12.158 Waiting     1.833 sec 25.0/100: 25% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(2)
2:13.991 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(2)
2:15.317 generic e death_coil Fluffy_Pillow 38.0/100: 38% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3)
2:16.643 generic g clawing_shadows Fluffy_Pillow 8.0/100: 8% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3)
2:17.967 Waiting     2.169 sec 21.0/100: 21% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4)
2:20.136 generic h festering_strike Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4)
2:21.358 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 46.0/100: 46% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4)
2:21.460 generic e death_coil Fluffy_Pillow 46.0/100: 46% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), dragon_games_equipment
2:22.786 cooldowns S dark_transformation Fluffy_Pillow 21.0/100: 21% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(4)
2:24.110 generic e death_coil Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(4), commander_of_the_dead
2:25.435 generic h festering_strike Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead
2:26.760 generic e death_coil Fluffy_Pillow 46.0/100: 46% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead
2:28.084 cooldowns T apocalypse Fluffy_Pillow 16.0/100: 16% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead
2:29.410 generic f death_and_decay Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead
2:30.734 generic e death_coil Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead
2:31.996 generic g clawing_shadows Fluffy_Pillow 13.0/100: 13% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead
2:33.258 generic g clawing_shadows Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead
2:34.520 high_prio_actions l outbreak Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
2:35.781 generic e death_coil Fluffy_Pillow 59.0/100: 59% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
2:37.042 generic h festering_strike Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead
2:38.306 generic e death_coil Fluffy_Pillow 54.0/100: 54% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
2:39.566 generic g clawing_shadows Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead
2:40.889 generic e death_coil Fluffy_Pillow 42.0/100: 42% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead
2:42.215 generic g clawing_shadows Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead
2:43.540 generic e death_coil Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead
2:44.865 Waiting     0.193 sec 0.0/100: 0% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(8), commander_of_the_dead
2:45.058 generic h festering_strike Fluffy_Pillow 0.0/100: 0% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(8), commander_of_the_dead
2:46.384 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(8), commander_of_the_dead
2:47.709 generic e death_coil Fluffy_Pillow 38.0/100: 38% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead
2:49.035 Waiting     0.585 sec 13.0/100: 13% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), commander_of_the_dead
2:49.620 generic g clawing_shadows Fluffy_Pillow 13.0/100: 13% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), commander_of_the_dead
2:50.946 Waiting     1.674 sec 26.0/100: 26% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead
2:52.620 generic g clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead
2:53.946 generic e death_coil Fluffy_Pillow 39.0/100: 39% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2)
2:55.271 generic g clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2)
2:56.596 Waiting     0.160 sec 27.0/100: 27% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3)
2:56.756 generic e death_coil Fluffy_Pillow 27.0/100: 27% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(3)
2:58.081 Waiting     0.314 sec 27.0/100: 27% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(3)
2:58.395 generic g clawing_shadows Fluffy_Pillow 27.0/100: 27% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(3)
2:59.721 generic e death_coil Fluffy_Pillow 40.0/100: 40% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(4)
3:01.047 Waiting     0.410 sec 10.0/100: 10% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(4)
3:01.457 high_prio_actions l outbreak Fluffy_Pillow 10.0/100: 10% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(4)
3:01.457 trinkets n use_item_algethar_puzzle_box Fluffy_Pillow 20.0/100: 20% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(4)
3:03.225 high_prio_actions j army_of_the_dead Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(4), algethar_puzzle
3:04.551 generic e death_coil Fluffy_Pillow 35.0/100: 35% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(4), algethar_puzzle
3:05.875 generic f death_and_decay Fluffy_Pillow 10.0/100: 10% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), algethar_puzzle
3:07.201 Waiting     0.274 sec 20.0/100: 20% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), festermight(4), algethar_puzzle
3:07.475 generic g clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), festermight(4), algethar_puzzle
3:08.737 cooldowns S dark_transformation Fluffy_Pillow 33.0/100: 33% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), festermight(5), algethar_puzzle
3:09.998 cooldowns R summon_gargoyle Fluffy_Pillow 33.0/100: 33% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle
3:09.998 high_prio_actions k death_coil Fluffy_Pillow 83.0/100: 83% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, algethar_puzzle
3:11.262 high_prio_actions k death_coil Fluffy_Pillow 83.0/100: 83% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:12.523 default G antimagic_shell PR_Death_Knight_Unholy 53.0/100: 53% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:12.523 high_prio_actions k death_coil Fluffy_Pillow 53.0/100: 53% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:13.786 cooldowns V unholy_assault Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle
3:15.049 cooldowns T apocalypse Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, algethar_puzzle
3:16.101 cooldowns U empower_rune_weapon Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:16.101 cooldowns W soul_reaper Fluffy_Pillow 50.0/100: 50% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:17.065 generic e death_coil Fluffy_Pillow 65.0/100: 65% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:18.025 generic e death_coil Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:18.987 generic f death_and_decay Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:19.948 generic g clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle
3:20.865 generic e death_coil Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle
3:21.782 racials m berserking Fluffy_Pillow 13.0/100: 13% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle
3:21.782 generic h festering_strike Fluffy_Pillow 13.0/100: 13% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle
3:22.616 cooldowns W soul_reaper Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle
3:23.450 generic e death_coil Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune
berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle
3:24.283 generic g clawing_shadows Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune
berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle
3:25.115 generic e death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle
3:25.950 generic e death_coil Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle
3:26.784 generic g clawing_shadows Fluffy_Pillow 11.0/100: 11% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle
3:27.616 generic g clawing_shadows Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle
3:28.450 high_prio_actions l outbreak Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle
3:29.282 cooldowns W soul_reaper Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle
3:30.155 generic e death_coil Fluffy_Pillow 62.0/100: 62% runic_power
2.0/6: 33% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle
3:31.030 generic e death_coil Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle
3:31.903 generic g clawing_shadows Fluffy_Pillow 12.0/100: 12% runic_power
4.0/6: 67% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle
3:32.778 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle
3:33.652 generic e death_coil Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead
3:34.527 generic g clawing_shadows Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(10), commander_of_the_dead
3:35.681 cooldowns W soul_reaper Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, commander_of_the_dead
3:36.834 generic h festering_strike Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead
3:38.159 generic e death_coil Fluffy_Pillow 61.0/100: 61% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead
3:39.485 generic e death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption
3:40.809 generic g clawing_shadows Fluffy_Pillow 1.0/100: 1% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3)
3:42.135 cooldowns W soul_reaper Fluffy_Pillow 14.0/100: 14% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight
3:43.460 generic e death_coil Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), sudden_doom, festermight
3:44.786 generic g clawing_shadows Fluffy_Pillow 29.0/100: 29% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight
3:46.111 generic g clawing_shadows Fluffy_Pillow 47.0/100: 47% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(2)
3:47.437 generic e death_coil Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3)
3:48.764 cooldowns W soul_reaper Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3)
3:50.091 generic e death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3)
3:51.417 generic h festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3)
3:52.744 default G antimagic_shell PR_Death_Knight_Unholy 40.0/100: 40% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(3)
3:52.744 generic e death_coil Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(3)
3:54.069 generic h festering_strike Fluffy_Pillow 15.0/100: 15% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(3)
3:55.397 high_prio_actions l outbreak Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(3)
3:56.724 cooldowns S dark_transformation Fluffy_Pillow 50.0/100: 50% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(3)
3:58.049 cooldowns W soul_reaper Fluffy_Pillow 50.0/100: 50% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, festermight(3), commander_of_the_dead
3:59.375 generic e death_coil Fluffy_Pillow 60.0/100: 60% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, festermight(3), commander_of_the_dead
4:00.701 cooldowns T apocalypse Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune
icy_talons(3), dark_transformation, festermight(3), commander_of_the_dead
4:02.026 generic f death_and_decay Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, commander_of_the_dead
4:03.353 generic e death_coil Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead
4:04.615 cooldowns W soul_reaper Fluffy_Pillow 27.0/100: 27% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead
4:05.878 generic e death_coil Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead
4:07.142 generic g clawing_shadows Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, commander_of_the_dead
4:08.405 generic e death_coil Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight, commander_of_the_dead
4:09.667 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead
4:10.929 cooldowns W soul_reaper Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(2), commander_of_the_dead
4:12.192 generic e death_coil Fluffy_Pillow 48.0/100: 48% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(2), commander_of_the_dead
4:13.517 generic g clawing_shadows Fluffy_Pillow 48.0/100: 48% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(2), commander_of_the_dead
4:14.844 generic e death_coil Fluffy_Pillow 66.0/100: 66% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(3), commander_of_the_dead
4:16.170 generic h festering_strike Fluffy_Pillow 66.0/100: 66% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(3), commander_of_the_dead
4:17.496 cooldowns W soul_reaper Fluffy_Pillow 91.0/100: 91% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(3), commander_of_the_dead
4:18.822 generic e death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3), commander_of_the_dead
4:20.148 generic e death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
icy_talons(3), sudden_doom, festermight(3), commander_of_the_dead
4:21.358 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
icy_talons(3), festermight(3), commander_of_the_dead
4:21.474 generic g clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
icy_talons(3), festermight(3), commander_of_the_dead, dragon_games_equipment
4:22.800 high_prio_actions l outbreak Fluffy_Pillow 88.0/100: 88% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(4), commander_of_the_dead
4:24.125 cooldowns W soul_reaper Fluffy_Pillow 98.0/100: 98% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(4), commander_of_the_dead
4:25.450 generic e death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(4), commander_of_the_dead
4:26.775 generic e death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(4)
4:28.103 generic g clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption
4:29.429 generic e death_coil Fluffy_Pillow 83.0/100: 83% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight
4:30.754 cooldowns W soul_reaper Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight
4:32.081 generic e death_coil Fluffy_Pillow 68.0/100: 68% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight
4:33.408 generic g clawing_shadows Fluffy_Pillow 68.0/100: 68% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight
4:34.732 generic e death_coil Fluffy_Pillow 81.0/100: 81% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(2)
4:36.057 generic g clawing_shadows Fluffy_Pillow 86.0/100: 86% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2)
4:37.383 cooldowns W soul_reaper Fluffy_Pillow 99.0/100: 99% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3)
4:38.708 generic h festering_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3)
4:40.034 generic e death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3)
4:41.359 generic e death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), sudden_doom, festermight(3)
4:42.684 cooldowns S dark_transformation Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(3)
4:44.009 cooldowns V unholy_assault Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(3), commander_of_the_dead
4:45.333 cooldowns W soul_reaper Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(3), commander_of_the_dead
4:46.436 cooldowns T apocalypse Fluffy_Pillow 85.0/100: 85% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(3), commander_of_the_dead
4:47.542 generic f death_and_decay Fluffy_Pillow 97.0/100: 97% runic_power
5.0/6: 83% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead
4:48.648 generic g clawing_shadows Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead
4:49.702 high_prio_actions l outbreak Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight, commander_of_the_dead
4:50.754 high_prio_actions k death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight, commander_of_the_dead
4:51.806 cooldowns W soul_reaper Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight, commander_of_the_dead
4:52.859 generic e death_coil Fluffy_Pillow 85.0/100: 85% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight, commander_of_the_dead
4:53.912 generic e death_coil Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight, commander_of_the_dead
4:54.964 default G antimagic_shell PR_Death_Knight_Unholy 55.0/100: 55% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight, commander_of_the_dead
4:54.964 generic e death_coil Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight, commander_of_the_dead
4:56.016 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight, commander_of_the_dead
4:57.069 generic e death_coil Fluffy_Pillow 43.0/100: 43% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(2), commander_of_the_dead
4:58.123 generic e death_coil Fluffy_Pillow 43.0/100: 43% runic_power
5.0/6: 83% rune
antimagic_shell, icy_talons(3), dark_transformation, unholy_assault, festermight(2), commander_of_the_dead
4:59.231 generic e death_coil Fluffy_Pillow 18.0/100: 18% runic_power
5.0/6: 83% rune
antimagic_shell, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(2), commander_of_the_dead

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6095 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3848 0 16397 15616 9166
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 327940 312320 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 15.36% 15.36% 1504
Haste 13.49% 13.49% 2293
Versatility 10.62% 3.99% 818
Attack Power 6400 5922 0
Mastery 44.26% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 1.86% 1.86% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +923 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +692 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +923 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +692 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +923 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +692 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +519 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +692 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +519 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +923 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_tepid_versatility_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze,if=target.debuff.casting.react
actions+=/antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
actions+=/antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle)
# Variables
actions+=/variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
actions+=/variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle|time>20
actions+=/variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
actions+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
actions+=/variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4)|fight_remains<5&debuff.festering_wound.stack>=1
actions+=/variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions+=/variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
actions+=/variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
actions+=/invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=20|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))|fight_remains<=21
# Call Action Lists
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=trinkets
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup=0
actions+=/call_action_list,name=cooldowns,if=variable.st_planning
actions+=/call_action_list,name=aoe_cooldowns,if=variable.adds_remain
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
actions+=/call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
actions+=/call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
actions+=/call_action_list,name=generic,if=active_enemies<=3

# Generic AoE
actions.aoe=epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# AoE Burst
actions.aoe_burst=epidemic,if=(!talent.bursting_sores|rune<1|talent.bursting_sores&debuff.festering_wound.stack=0)&!variable.pooling_runic_power&(active_enemies>=6|runic_power.deficit<30|buff.festermight.stack=20)
actions.aoe_burst+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=1
actions.aoe_burst+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_burst+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe_burst+=/wound_spender

# AoE Cooldowns
actions.aoe_cooldowns=vile_contagion,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.aoe_cooldowns+=/summon_gargoyle
actions.aoe_cooldowns+=/abomination_limb,if=rune<2|buff.festermight.stack>10|!talent.festermight|buff.festermight.up&buff.festermight.remains<12
actions.aoe_cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=talent.bursting_sores&debuff.festering_wound.up&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)|!talent.bursting_sores&debuff.festering_wound.stack>=4
actions.aoe_cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.stack<=2|buff.dark_transformation.up
actions.aoe_cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.aoe_cooldowns+=/dark_transformation,if=(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.aoe_cooldowns+=/empower_rune_weapon,if=buff.dark_transformation.up
actions.aoe_cooldowns+=/sacrificial_pact,if=!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# AoE Setup
actions.aoe_setup=any_dnd,if=(!talent.bursting_sores|death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets>=8|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5)
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies&talent.bursting_sores
actions.aoe_setup+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies
actions.aoe_setup+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=cooldown.apocalypse.remains<variable.apoc_timing&debuff.festering_wound.stack<4
actions.aoe_setup+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# ST/Cleave Cooldowns
actions.cooldowns=summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=cooldown.apocalypse.remains<5
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=21|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)

# Garg Setup
actions.garg_setup=apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<21|!talent.commander_of_the_dead)
actions.garg_setup+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
actions.garg_setup+=/empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=21
actions.garg_setup+=/unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=21
actions.garg_setup+=/potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
actions.garg_setup+=/any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>0
actions.garg_setup+=/festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40
actions.garg_setup+=/death_coil,if=rune<=1

# Generic
actions.generic=death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
actions.generic+=/epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
actions.generic+=/any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=10|pet.gargoyle.active&pet.gargoyle.remains>5|pet.army_ghoul.active&pet.army_ghoul.remains>5))&death_knight.fwounded_targets=active_enemies
actions.generic+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.generic+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.generic+=/death_coil

# Priority Actions
actions.high_prio_actions=potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
actions.high_prio_actions+=/army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
actions.high_prio_actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
actions.high_prio_actions+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
actions.high_prio_actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
actions.racials+=/berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Trinkets
actions.trinkets=use_item,use_off_gcd=1,name=algethar_puzzle_box,use_off_gcd=1,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=9166
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 10046 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10046.4 10046.4 7.4 / 0.074% 1282.4 / 12.8% 378.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
26.5 26.0 Mana 0.00% 51.9 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 10046
Mind Spike 6555 65.2% 235.0 1.27sec 8361 7148 Direct 235.0 7378 14789 8361 13.3%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.00 235.00 0.00 0.00 0.00 1.1698 0.0000 1964862.58 1964862.58 0.00% 7147.58 7147.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.74% 203.83 152 257 7378.32 6607 10224 7379.37 7195 7713 1503940 1503940 0.00%
crit 13.26% 31.17 10 55 14789.00 13214 20448 14791.19 14168 15732 460923 460923 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.656374
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage. |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity.|r

Action Priority List

    filler
    [J]:235.85
Shadow Word: Death 659 6.5% 6.4 10.10sec 31008 25582 Direct 6.4 27138 54601 31008 14.1%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.36 6.36 0.00 0.00 0.00 1.2122 0.0000 197261.85 197261.85 0.00% 25581.88 25581.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.91% 5.47 1 8 27137.58 24336 35121 27154.98 24336 35121 148311 148311 0.00%
crit 14.09% 0.90 0 5 54601.35 48673 70241 33472.78 0 70241 48951 48951 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.76

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to the target. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target.{$?=}A364675[ Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][ Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s4=0}/100} Insanity.|r][]

Action Priority List

    filler
    [I]:6.38
  • target_if_expr:target.health.pct<20|buff.deathspeaker.up
Soulseeker Arrow 1021 10.2% 7.0 38.47sec 43953 0 Periodic 79.0 3876 0 3876 0.0% 37.3%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.97 0.00 79.01 79.01 2.31 0.0000 1.4161 306211.73 306211.73 0.00% 2736.97 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 79.01 16 159 3875.72 119 4407 3873.89 3792 4043 306212 306212 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3629.20
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1730}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 1812 18.0% 13.5 21.05sec 40282 34195 Periodic 127.8 3751 7516 4250 13.3% 99.4%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.49 0.00 127.83 127.83 13.49 1.1780 2.3334 543327.71 543327.71 0.00% 1729.37 34195.21
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.74% 110.88 80 143 3751.03 9 5191 3751.73 3631 3918 415920 415920 0.00%
crit 13.26% 16.95 3 37 7516.45 18 10381 7518.07 6681 8602 127408 127408 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.50
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [M]:13.49
  • if_expr:refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
  • target_if_expr:remains
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 1.0 0.00sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    cds
    [F]:1.00
  • if_expr:buff.power_infusion.up|fight_remains<=15
Desperate Prayer 1.0 0.00sec

Stats Details: Desperate Prayer

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Desperate Prayer

  • id:19236
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19236
  • name:Desperate Prayer
  • school:holy
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=false}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.

Action Priority List

    cds
    [H]:1.00
  • if_expr:health.pct<=75
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.00
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Shadowform 1.0 0.00sec

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 1.0 0.00sec

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 127.8 2.33sec

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 127.83 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 1.0 0.0 0.0sec 0.0sec 14.4sec 4.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.5s / 15.0s

Stack Uptimes

  • blood_fury_1:4.86%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Desperate Prayer 1.0 0.0 0.0sec 0.0sec 10.0sec 3.38% 0.00% 9.0 (9.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_desperate_prayer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.0s / 10.0s

Stack Uptimes

  • desperate_prayer_1:3.38%

Spelldata

  • id:19236
  • name:Desperate Prayer
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=false}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0sec 0.0sec 29.4sec 9.92% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.5s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.92%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.8sec 45.5sec 16.6sec 23.81% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 226.4s
  • trigger_min/max:0.0s / 206.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 95.7s

Stack Uptimes

  • sophic_devotion_1:23.81%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.3 0.0 0.0sec 0.0sec 19.4sec 1.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.6s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:1.67%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.3 0.0 0.0sec 0.0sec 19.4sec 1.66% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:1.66%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.2 0.0 0.0sec 0.0sec 19.4sec 1.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:1.62%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.2 0.0 0.0sec 0.0sec 19.4sec 1.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.6s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:1.59%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:Primary stat is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 95.82% 93.71% 97.54% 45.2s 8.8s 288.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Shadow Word: Death37.9180.000289.434241.217192.925292.170

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
mana_regenMana635.257813.98100.00%12.30471373.2898.37%
Mind SpikeInsanity235.0068.0089.47%0.29872.0092.77%
Shadow Word: DeathInsanity6.360.000.00%0.0025.45100.00%
Vampiric TouchInsanity14.498.0010.53%0.5549.9586.20%
Usage Type Count Total Tot% Avg RPE APR
PR_Priest_Shadow
Shadow Word: DeathMana 6.367951.94100.00%1250.001249.9824.81
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 273300.0 393.88 715.37 130238.3 164592.2 -84600.1 252499.3
Mana 49999.0 26.05 26.51 471373.2 49861.0 48749.0 49999.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 10046.41
Minimum 9053.18
Maximum 11428.66
Spread ( max - min ) 2375.47
Range [ ( max - min ) / 2 * 100% ] 11.82%
Standard Deviation 327.4639
5th Percentile 9532.54
95th Percentile 10611.69
( 95th Percentile - 5th Percentile ) 1079.14
Mean Distribution
Standard Deviation 3.7815
95.00% Confidence Interval ( 10039.00 - 10053.82 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4082
0.1 Scale Factor Error with Delta=300 916
0.05 Scale Factor Error with Delta=300 3662
0.01 Scale Factor Error with Delta=300 91540
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 10046.41
Minimum 9053.18
Maximum 11428.66
Spread ( max - min ) 2375.47
Range [ ( max - min ) / 2 * 100% ] 11.82%
Standard Deviation 327.4639
5th Percentile 9532.54
95th Percentile 10611.69
( 95th Percentile - 5th Percentile ) 1079.14
Mean Distribution
Standard Deviation 3.7815
95.00% Confidence Interval ( 10039.00 - 10053.82 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4082
0.1 Scale Factor Error with Delta=300 916
0.05 Scale Factor Error with Delta=300 3662
0.01 Scale Factor Error with Delta=300 91540
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 10046.41
Minimum 9053.18
Maximum 11428.66
Spread ( max - min ) 2375.47
Range [ ( max - min ) / 2 * 100% ] 11.82%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 3011663.88
Minimum 2221749.13
Maximum 3827330.49
Spread ( max - min ) 1605581.36
Range [ ( max - min ) / 2 * 100% ] 26.66%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 716.74
Minimum 468.55
Maximum 1767.91
Spread ( max - min ) 1299.36
Range [ ( max - min ) / 2 * 100% ] 90.64%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 397.81
Minimum 329.20
Maximum 490.01
Spread ( max - min ) 160.81
Range [ ( max - min ) / 2 * 100% ] 20.21%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 shadowform,if=!buff.shadowform.up
5 0.00 arcane_torrent
6 0.00 shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(spell_targets.shadow_crash>1|talent.mental_decay)
7 0.00 vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|spell_targets.shadow_crash=1&!talent.mental_decay|fight_style.dungeonslice
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=holding_crash,op=set,value=raid_event.adds.in<15
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
8 0.00 run_action_list,name=aoe,if=active_enemies>2|spell_targets.vampiric_touch>3
9 0.00 run_action_list,name=main
actions.cds
# count action,conditions
E 1.00 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
TODO: Check VE/DA enter conditions based on dots
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
F 1.00 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
Sync Power Infusion with Voidform or Dark Ascension
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
0.00 dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
G 0.00 call_action_list,name=trinkets
H 1.00 desperate_prayer,if=health.pct<=75
Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.filler
# count action,conditions
0.00 vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
I 6.38 shadow_word_death,target_if=target.health.pct<20|buff.deathspeaker.up
0.00 mind_spike_insanity
0.00 mind_flay,if=buff.mind_flay_insanity.up
0.00 halo,if=raid_event.adds.in>20
Save up to 20s if adds are coming soon.
0.00 shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
0.00 divine_star,if=raid_event.adds.in>10
Save up to 10s if adds are coming soon.
0.00 devouring_plague,if=buff.voidform.up&variable.dots_up
J 235.85 mind_spike
0.00 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 shadow_crash,if=raid_event.adds.in>20
Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 divine_star
Use Divine Star while moving as a low-priority action
0.00 shadow_word_death
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain,target_if=min:remains
Use Shadow Word: Pain while moving as a low-priority action
actions.main
# count action,conditions
K 0.00 call_action_list,name=main_variables
L 0.00 call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|active_enemies>2)
0.00 mindbender,if=variable.dots_up&(fight_remains<30|time_to_die>15)
Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active
0.00 mind_blast,target_if=(dot.devouring_plague.ticking&(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time)|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&active_enemies<=7
High priority Mind Blast action when using Inescapable Torment
0.00 void_bolt,if=variable.dots_up
0.00 devouring_plague,target_if=refreshable|!talent.distorted_reality,if=refreshable&!variable.pool_for_cds|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<(buff.voidform.remains+2)
Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
0.00 shadow_crash,if=!variable.holding_crash&dot.vampiric_touch.refreshable
Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
M 13.49 vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
0.00 mind_spike_insanity,if=variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
High Priority Mind Spike: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available
0.00 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available
0.00 mind_blast,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
0.00 void_torrent,if=!variable.holding_crash,target_if=variable.all_dots_up&dot.devouring_plague.remains>=2
Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
0.00 mindgames,target_if=variable.all_dots_up&dot.devouring_plague.remains>=cast_time
Cast Mindgames if all DoTs will be active by the time the cast finishes
N 0.00 call_action_list,name=filler
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance
0.00 use_item,name=erupting_spear_fragment,if=buff.power_infusion.up|raid_event.adds.up|fight_remains<20
Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
0.00 use_item,name=beacon_to_the_beyond,if=!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20
Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
O 1.00 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex

Sample Sequence

01247JJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJMJJJJJJJJJJJJJJJJJMJJJJJJJJJJJIJJJJMJJIJJJJJJJIJJJJJMJEIHJJJJJJJOIJJJJFJJJJIJJJJJJJJ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 49999.0/49999: 100% mana
24.0/100: 24% insanity
Pre precombat 1 food PR_Priest_Shadow 49999.0/49999: 100% mana
24.0/100: 24% insanity
static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 49999.0/49999: 100% mana
24.0/100: 24% insanity
static_empowerment
Pre precombat 4 shadowform PR_Priest_Shadow 49999.0/49999: 100% mana
24.0/100: 24% insanity
static_empowerment
Pre precombat 7 vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
shadowform, static_empowerment
0:00.000 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity
bloodlust, shadowform, static_empowerment
0:00.940 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity
bloodlust, shadowform, static_empowerment
0:01.881 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
bloodlust, shadowform, static_empowerment(2)
0:02.820 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
bloodlust, shadowform, static_empowerment(3)
0:03.758 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
bloodlust, shadowform, static_empowerment(4)
0:04.697 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity
bloodlust, shadowform, static_empowerment(5)
0:05.637 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
bloodlust, shadowform, static_empowerment(5)
0:06.578 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
bloodlust, shadowform, static_empowerment(5)
0:07.517 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, shadowform, static_empowerment(5)
0:08.456 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
bloodlust, shadowform, static_empowerment(5)
0:09.396 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity
bloodlust, shadowform, static_empowerment(5)
0:10.336 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
72.0/100: 72% insanity
bloodlust, shadowform, static_empowerment(5)
0:11.274 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
bloodlust, shadowform, static_empowerment(5)
0:12.212 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity
bloodlust, shadowform, static_empowerment(5)
0:13.152 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity
bloodlust, shadowform, static_empowerment(5)
0:14.091 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
88.0/100: 88% insanity
bloodlust, shadowform, static_empowerment(5)
0:15.029 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
92.0/100: 92% insanity
bloodlust, shadowform, static_empowerment(5)
0:15.969 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
96.0/100: 96% insanity
bloodlust, shadowform, static_empowerment(5)
0:16.907 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:17.847 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:18.787 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:19.726 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:20.666 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:21.606 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:22.545 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:23.484 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:24.424 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:25.363 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:26.303 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:27.242 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:28.182 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:29.122 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:30.061 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:31.001 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:31.941 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:32.881 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:33.821 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:34.760 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:35.698 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:36.639 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:37.578 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:38.518 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:39.459 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:40.400 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:41.624 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:42.845 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:44.065 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:45.286 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:46.507 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:47.729 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:48.949 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:50.170 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:51.390 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:52.610 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:53.832 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:55.051 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:56.272 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:57.492 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:58.712 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:59.932 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:01.152 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:02.373 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:03.593 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:04.814 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:06.033 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:07.255 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:08.474 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:09.696 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:10.915 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:12.135 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:13.355 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:14.574 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:15.794 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:17.014 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:18.235 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:19.455 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:20.677 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:21.898 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:23.120 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:24.342 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:25.562 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:26.783 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:28.003 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:29.224 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:30.444 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:31.665 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:32.887 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:34.107 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:35.328 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:36.549 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:37.771 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:38.991 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:40.210 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:41.430 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:42.652 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:43.874 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:45.096 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:46.318 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:47.540 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:48.759 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:49.979 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:51.200 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:52.422 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:53.642 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:54.863 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:56.084 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:57.304 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:58.524 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:59.746 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:00.965 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:02.184 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:03.403 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:04.624 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:05.845 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:07.066 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:08.286 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:09.507 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:10.727 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:11.946 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:13.167 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:14.388 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:15.608 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:16.829 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:18.049 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:19.270 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:20.490 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:21.709 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:22.928 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:24.146 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:25.365 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:26.584 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:27.805 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:29.024 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:30.246 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:31.468 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:32.687 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:33.907 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:35.129 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:36.350 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:37.571 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:38.793 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:40.012 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:41.233 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:42.453 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:43.674 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:44.894 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:46.114 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:47.333 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:48.555 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:49.775 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:50.995 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:52.214 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:53.435 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:54.656 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:55.876 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:57.097 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:58.317 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:59.537 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:00.757 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:01.978 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:03.197 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:04.416 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:05.636 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:06.856 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:08.077 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:09.296 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:10.516 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:11.736 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:12.957 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:14.178 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:15.398 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:16.618 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:17.839 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:19.058 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:20.279 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:21.500 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:22.719 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:23.939 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:25.159 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:26.381 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:27.601 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:28.823 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:30.044 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:31.265 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:32.485 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:33.704 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:34.925 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:36.145 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:37.364 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:38.584 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:39.804 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:41.025 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:42.247 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:43.466 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:44.686 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:45.906 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:47.126 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:48.345 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:49.567 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:50.787 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:52.007 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:53.226 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:54.445 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:55.665 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:56.885 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:58.105 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:59.327 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:00.546 filler I shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:01.768 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:02.991 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:04.212 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:05.431 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:06.651 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:07.872 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:09.092 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:10.315 filler I shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:11.767 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:12.986 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:14.206 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:15.430 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:16.650 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:17.871 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:19.092 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:20.313 filler I shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:21.765 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:22.986 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:24.208 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:25.428 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:26.648 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:27.867 main M vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:29.086 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:30.306 cds E potion Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:30.306 filler I shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:31.767 cds H desperate_prayer PR_Priest_Shadow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:31.767 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:32.987 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:34.206 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:35.426 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:36.647 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:37.867 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:39.087 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.307 trinkets O use_items Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.307 filler I shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:41.659 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:42.772 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:43.884 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.000 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:46.114 cds F blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:46.114 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:47.230 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:48.344 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, static_empowerment(5), elemental_potion_of_ultimate_power
4:49.460 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:50.573 filler I shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:51.687 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:52.802 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:53.916 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:55.030 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:56.144 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:57.257 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:58.368 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:59.481 filler J mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3848 1 13665 13015 9166
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 273300 260300 0
Mana 49999 49999 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 1600 1600 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +923 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +519 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +692 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +923 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +923 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +111 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +692 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +519 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +692 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +519 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +519 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +923 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Talents

RowPriest Talents [1]
1
2
3
4
5
6
7
8
9
10
RowShadow Talents [2]
1
2
3
4
5
6
7
8
9
10

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

initial_resource=insanity=24

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice&(spell_targets.shadow_crash>1|talent.mental_decay)
actions.precombat+=/vampiric_touch,if=!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|spell_targets.shadow_crash=1&!talent.mental_decay|fight_style.dungeonslice

# Executed every time the actor is available.
actions=variable,name=holding_crash,op=set,value=raid_event.adds.in<15
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up
actions+=/run_action_list,name=aoe,if=active_enemies>2|spell_targets.vampiric_touch>3
actions+=/run_action_list,name=main

actions.aoe=call_action_list,name=aoe_variables
# High Priority action to put out Vampiric Touch on enemies that will live at least 18 seconds, up to 12 targets manually while prepping AoE
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied),if=variable.max_vts>0&!variable.manual_vts_applied&!action.shadow_crash.in_flight|!talent.whispering_shadows
# Use Shadow Crash to apply Vampiric Touch to as many adds as possible while being efficient with Vampiric Touch refresh windows
actions.aoe+=/shadow_crash,if=!variable.holding_crash,target_if=dot.vampiric_touch.refreshable|dot.vampiric_touch.remains<=target.time_to_die&!buff.voidform.up&(raid_event.adds.in-dot.vampiric_touch.remains)<15
actions.aoe+=/call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend or Mindbender on cooldown if DoTs are active
actions.aoe+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight&talent.whispering_shadows)&(fight_remains<30|time_to_die>15)
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff or if Inescapable Torment is talented with Mindbender active. Only use when facing 3-7 targets.
actions.aoe+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&active_enemies<=7&!buff.mind_devourer.up
actions.aoe+=/void_bolt
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.aoe+=/devouring_plague,target_if=refreshable|!talent.distorted_reality,if=refreshable&!variable.pool_for_cds|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<(buff.voidform.remains+2)
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied),if=variable.max_vts>0&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash)&!action.shadow_crash.in_flight|!talent.whispering_shadows
# High Priority Mind Spike: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_spike_insanity,if=variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.aoe+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# # Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.aoe+=/mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent action list for AoE
actions.aoe+=/call_action_list,name=pl_torrent,target_if=talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=3&(!variable.holding_crash|raid_event.adds.count%(active_dot.vampiric_touch+raid_event.adds.count)<1.5)&((insanity>=50|dot.devouring_plague.ticking|buff.dark_reveries.up)|buff.voidform.up|buff.dark_ascension.up)
actions.aoe+=/mindgames,if=active_enemies<5&dot.devouring_plague.ticking|talent.psychic_link
actions.aoe+=/void_torrent,if=!talent.psychic_link,target_if=variable.dots_up
# High priority action for Mind Flay: Insanity to fish for Idol of C'Thun procs, cancel as soon as something else is more important and most of the channel has completed
actions.aoe+=/mind_flay,if=buff.mind_flay_insanity.up&talent.idol_of_cthun,interrupt_if=ticks>=2,interrupt_immediate=1
actions.aoe+=/call_action_list,name=filler

actions.aoe_variables=variable,name=max_vts,op=set,default=12,value=spell_targets.vampiric_touch>?12
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
# TODO: Revamp to fix undesired behaviour with unstacked fights
actions.aoe_variables+=/variable,name=vts_applied,op=set,value=(active_dot.vampiric_touch+8*(action.shadow_crash.in_flight&talent.whispering_shadows))>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=holding_crash,op=set,value=(variable.max_vts-active_dot.vampiric_touch)<4|raid_event.adds.in<10&raid_event.adds.count>(variable.max_vts-active_dot.vampiric_touch),if=variable.holding_crash&talent.whispering_shadows
actions.aoe_variables+=/variable,name=manual_vts_applied,op=set,value=(active_dot.vampiric_touch+8*!variable.holding_crash)>=variable.max_vts|!variable.is_vt_possible

# TODO: Check VE/DA enter conditions based on dots
actions.cds=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
actions.cds+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions.cds+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions.cds+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions.cds+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
# Sync Power Infusion with Voidform or Dark Ascension
actions.cds+=/power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
# Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender|active_enemies>2&!talent.inescapable_torment.rank)&(cooldown.mind_blast.charges=0|time>15)
# Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.fiend.remains>=4|!talent.mindbender&!cooldown.fiend.up|active_enemies>2&!talent.inescapable_torment
actions.cds+=/call_action_list,name=trinkets
# Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.cds+=/desperate_prayer,if=health.pct<=75

# Cast Vampiric Touch to consume Unfurling Darkness, prefering the target with the lowest DoT duration active
actions.filler=vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
actions.filler+=/shadow_word_death,target_if=target.health.pct<20|buff.deathspeaker.up
actions.filler+=/mind_spike_insanity
actions.filler+=/mind_flay,if=buff.mind_flay_insanity.up
# Save up to 20s if adds are coming soon.
actions.filler+=/halo,if=raid_event.adds.in>20
actions.filler+=/shadow_word_death,target_if=min:target.time_to_die,if=talent.inescapable_torment&pet.fiend.active
# Save up to 10s if adds are coming soon.
actions.filler+=/divine_star,if=raid_event.adds.in>10
actions.filler+=/devouring_plague,if=buff.voidform.up&variable.dots_up
actions.filler+=/mind_spike
actions.filler+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
# Use Shadow Crash while moving as a low-priority action when adds will not come in 20 seconds.
actions.filler+=/shadow_crash,if=raid_event.adds.in>20
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.filler+=/shadow_word_death,target_if=target.health.pct<20
# Use Divine Star while moving as a low-priority action
actions.filler+=/divine_star
# Use Shadow Word: Death while moving as a low-priority action
actions.filler+=/shadow_word_death
# Use Shadow Word: Pain while moving as a low-priority action
actions.filler+=/shadow_word_pain,target_if=min:remains

actions.main=call_action_list,name=main_variables
actions.main+=/call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|active_enemies>2)
# Use Shadowfiend and Mindbender on cooldown as long as Vampiric Touch and Shadow Word: Pain are active
actions.main+=/mindbender,if=variable.dots_up&(fight_remains<30|time_to_die>15)
# High priority Mind Blast action when using Inescapable Torment
actions.main+=/mind_blast,target_if=(dot.devouring_plague.ticking&(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time)|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&active_enemies<=7
actions.main+=/void_bolt,if=variable.dots_up
# Use Devouring Plague to maximize uptime. Short circuit if you are capping on Insanity within 20 or to get out an extra Void Bolt by extending Voidform. With Distorted Reality can maintain more than one at a time in multi-target.
actions.main+=/devouring_plague,target_if=refreshable|!talent.distorted_reality,if=refreshable&!variable.pool_for_cds|insanity.deficit<=20|buff.voidform.up&cooldown.void_bolt.remains>buff.voidform.remains&cooldown.void_bolt.remains<(buff.voidform.remains+2)
# Use Shadow Crash as long as you are not holding for adds and Vampiric Touch is within pandemic range
actions.main+=/shadow_crash,if=!variable.holding_crash&dot.vampiric_touch.refreshable
# Put out Vampiric Touch on enemies that will live at least 12s and Shadow Crash is not available soon
actions.main+=/vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash|!talent.whispering_shadows)
# High Priority Mind Spike: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available
actions.main+=/mind_spike_insanity,if=variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
# Use all charges of Mind Blast if Vampiric Touch and Shadow Word: Pain are active and Mind Devourer is not active or you are prepping Void Eruption
actions.main+=/mind_blast,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# Void Torrent if you are not holding Shadow Crash for an add pack coming, prefer the target with the most DoTs active. Only cast if Devouring Plague is on that target and will last at least 2 seconds
actions.main+=/void_torrent,if=!variable.holding_crash,target_if=variable.all_dots_up&dot.devouring_plague.remains>=2
# Cast Mindgames if all DoTs will be active by the time the cast finishes
actions.main+=/mindgames,target_if=variable.all_dots_up&dot.devouring_plague.remains>=cast_time
actions.main+=/call_action_list,name=filler

actions.main_variables=variable,name=dots_up,op=set,value=(dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking)|action.shadow_crash.in_flight&talent.whispering_shadows
actions.main_variables+=/variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
actions.main_variables+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up

actions.pl_torrent=void_bolt
actions.pl_torrent+=/vampiric_touch,if=remains<=6&cooldown.void_torrent.remains<gcd*2
# Use Devouring Plague before Void Torrent cast
actions.pl_torrent+=/devouring_plague,if=remains<=4&cooldown.void_torrent.remains<gcd*2
actions.pl_torrent+=/mind_blast,if=!talent.mindgames|cooldown.mindgames.remains>=3&!prev_gcd.1.mind_blast
actions.pl_torrent+=/void_torrent,if=dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking|buff.voidform.up
actions.pl_torrent+=/mindgames,if=dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&dot.devouring_plague.ticking|buff.voidform.up

actions.trinkets=use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance
# Use Erupting Spear Fragment with cooldowns, adds are currently active, or the fight will end in less than 20 seconds
actions.trinkets+=/use_item,name=erupting_spear_fragment,if=buff.power_infusion.up|raid_event.adds.up|fight_remains<20
# Use Beacon to the Beyond on cooldown except to hold for incoming adds or if already facing 5 or more targets
actions.trinkets+=/use_item,name=beacon_to_the_beyond,if=!raid_event.adds.exists|raid_event.adds.up|spell_targets.beacon_to_the_beyond>=5|fight_remains<20
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
actions.trinkets+=/use_item,name=desperate_invokers_codex

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=9166
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 50904 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
50904.4 50904.4 52.1 / 0.102% 9120.4 / 17.9% 80.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
602.4 600.5 Mana 0.72% 50.8 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAQSSKRSCSSIIJUSIAAAAAAAAAAAAgSESCJoJQSLJpgIEESaI

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 50904
Ascendance 0 (396) 0.0% (0.8%) 2.0 180.45sec 58576 52067

Stats Details: Ascendance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.1252 0.0000 0.00 0.00 0.00% 52067.14 52067.14

Action Details: Ascendance

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]

Action Priority List

    default
    [G]:2.00
  • if_expr:dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1))
    Ascendance (_damage) 396 0.8% 2.0 180.45sec 58576 0 Direct 2.0 49530 99043 58573 18.3% 0.0%

Stats Details: Ascendance Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 117151.08 117151.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.73% 1.63 0 2 49529.73 39505 81037 47827.08 0 81037 80963 80963 0.00%
crit 18.27% 0.37 0 2 99042.82 79010 160225 32794.72 0 160225 36188 36188 0.00%

Action Details: Ascendance Damage

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Elemental Blast 7504 14.8% 22.4 13.16sec 100419 82900 Direct 22.4 83558 167152 100455 20.2% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.40 22.39 0.00 0.00 0.00 1.2114 0.0000 2248991.91 2248991.91 0.00% 82899.92 82899.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.78% 17.86 8 28 83558.07 49877 184208 83611.85 69031 106212 1492491 1492491 0.00%
crit 20.22% 4.53 0 12 167152.34 99754 369204 165762.91 0 336129 756501 756501 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.97

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:1.30
  • if_expr:buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
    single
    [O]:7.90
  • if_expr:buff.maelstrom_weapon.stack>=5&charges=max_charges
    single
    [Q]:13.20
  • if_expr:buff.maelstrom_weapon.stack>=5&(buff.feral_spirit.up|!talent.elemental_spirits.enabled)
Flame Shock 5155 10.1% 74.1 4.05sec 20867 194709 Direct 74.1 6936 13935 8371 20.5% 0.0%
Periodic 185.6 4133 8288 4988 20.6% 0.0% 99.3%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 74.08 74.08 185.57 185.57 73.05 0.1072 1.6061 1545798.59 1545798.59 0.00% 5052.08 194709.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.51% 58.90 32 92 6936.36 2595 18612 6936.88 5921 8206 408534 408534 0.00%
crit 20.49% 15.18 2 30 13935.21 5376 36092 13937.21 11151 18816 211573 211573 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.41% 147.35 105 192 4132.59 38 10890 4132.84 3596 4781 608953 608953 0.00%
crit 20.59% 38.21 18 67 8288.34 51 21519 8288.93 6925 10271 316740 316740 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:1.02
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Fire damage and knocking them into the air.]

Action Priority List

    single
    [K]:0.01
  • if_expr:!ticking&talent.lashing_flames.enabled
    single
    [b]:6.28
Flametongue Weapon 0 (1010) 0.0% (2.0%) 1.0 0.00sec 302487 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1010 2.0% 633.3 0.75sec 478 0 Direct 633.3 410 820 478 16.5% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 633.34 633.34 0.00 0.00 0.00 0.0000 0.0000 302486.57 302486.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.49% 528.77 392 679 409.80 317 1098 409.95 364 482 216692 216692 0.00%
crit 16.51% 104.57 58 159 820.48 634 2196 820.77 720 968 85795 85795 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.23

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }
Forgestorm Ignited (_damage) 1079 2.1% 27.5 7.95sec 11750 0 Direct 27.5 10072 20144 11750 16.7% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.55 27.55 0.00 0.00 0.00 0.0000 0.0000 323717.97 323717.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.34% 22.96 1 60 10072.03 10072 10072 10072.03 10072 10072 231247 231247 0.00%
crit 16.66% 4.59 0 18 20144.06 20144 20144 19663.23 0 20144 92471 92471 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 3935 7.8% 37.3 7.68sec 31708 25753 Direct 37.3 27183 54341 31708 16.7% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.29 37.29 0.00 0.00 0.00 1.2312 0.0000 1182336.70 1182336.70 0.00% 25753.36 25753.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.34% 31.07 16 51 27183.14 8384 98882 27209.61 21569 33769 844722 844722 0.00%
crit 16.66% 6.21 0 18 54341.33 16769 150807 54293.08 0 135532 337614 337614 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [V]:34.04
  • if_expr:buff.hailstorm.up
    single
    [Z]:3.25
Ice Strike 1680 3.3% 21.1 14.12sec 23944 19634 Direct 21.1 20542 41018 23944 16.6% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.06 21.06 0.00 0.00 0.00 1.2195 0.0000 504261.07 504261.07 0.00% 19634.04 19634.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.39% 17.56 7 26 20541.97 16431 49952 20533.19 17751 24701 360737 360737 0.00%
crit 16.61% 3.50 0 11 41017.54 32863 85729 39977.82 0 72314 143524 143524 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [U]:21.06
Lava Lash 8827 17.4% 61.0 4.77sec 43363 35687 Direct 61.0 (61.0) 37191 74475 43363 16.6% (16.6%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.04 61.04 0.00 0.00 0.00 1.2151 0.0000 2647056.21 2647056.21 0.00% 35687.12 35687.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.45% 50.94 23 86 37190.94 19381 165091 37226.16 31897 44833 1894516 1894516 0.00%
crit 16.55% 10.10 0 24 74475.36 38762 265646 74527.80 0 141151 752540 752540 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [N]:43.18
  • if_expr:buff.hot_hand.up
    single
    [T]:0.18
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [W]:17.69
Lightning Bolt 5903 11.6% 31.1 9.17sec 56855 46746 Direct 31.1 47118 94352 56856 20.6% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 31.13 31.13 0.00 0.00 0.00 1.2163 0.0000 1769942.57 1769942.57 0.00% 46745.97 46745.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.39% 24.71 11 44 47118.06 37854 121211 47095.77 40575 57705 1164468 1164468 0.00%
crit 20.61% 6.42 0 17 94352.40 75708 242423 94086.75 0 157870 605475 605475 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [P]:5.65
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [R]:25.48
  • if_expr:((buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
main_hand 1453 2.9% 164.0 2.14sec 2663 1429 Direct 164.0 2658 5318 2663 16.6% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 163.98 163.98 0.00 0.00 0.00 1.8635 0.0000 436723.27 623906.29 30.00% 1429.16 1429.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.07% 109.98 65 157 2658.05 2336 4357 2656.85 2424 2988 292331 417626 30.00%
crit 16.56% 27.15 9 55 5317.77 4671 8616 5315.37 4753 6117 144392 206280 30.00%
miss 16.37% 26.85 7 48 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 731 1.4% 164.9 2.11sec 1333 714 Direct 164.9 1330 2660 1333 16.5% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 164.88 164.88 0.00 0.00 0.00 1.8658 0.0000 219702.40 313868.57 30.00% 714.19 714.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.08% 110.60 69 157 1330.49 1168 2178 1329.89 1212 1501 147148 210217 30.00%
crit 16.54% 27.27 10 54 2660.26 2336 4357 2659.91 2364 3088 72554 103651 30.00%
miss 16.38% 27.01 8 48 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 154 (1807) 0.3% (3.6%) 6.7 48.16sec 80452 66129 Direct 6.7 (12.4) 5904 11807 6870 16.4% (18.3%) 0.0%

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.74 6.74 0.00 0.00 0.00 1.2166 0.0000 46299.51 46299.51 0.00% 66129.18 66129.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.64% 5.64 0 8 5903.58 4871 8994 5902.95 0 7511 33279 33279 0.00%
crit 16.36% 1.10 0 6 11806.94 9743 17987 8259.65 0 17987 13021 13021 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=false}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [J]:1.02
  • if_expr:!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>42|raid_event.adds.in<6)
    single
    [S]:5.73
  • if_expr:raid_event.adds.in>42|raid_event.adds.in<6
    Lightning Bolt (_pw) 1653 3.3% 5.7 50.81sec 87720 0 Direct 5.7 72784 145634 87716 20.5% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.66 5.66 0.00 0.00 0.00 0.0000 0.0000 496092.05 496092.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.50% 4.50 0 8 72784.20 56781 181817 72543.81 0 108311 327250 327250 0.00%
crit 20.50% 1.16 0 6 145634.46 113562 289533 105542.83 0 268023 168842 168842 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
Stormstrike 0 (1027) 0.0% (2.0%) 26.0 10.63sec 11887 9574

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.98 0.00 0.00 0.00 0.00 1.2417 0.0000 0.00 0.00 0.00% 9573.71 9573.71

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [X]:25.98
    Stormstrike (_mh) 685 1.4% 26.0 10.63sec 7923 0 Direct 26.0 6797 13615 7923 16.5% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.98 25.98 0.00 0.00 0.00 0.0000 0.0000 205855.22 294086.38 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.48% 21.69 8 39 6796.66 5983 11356 6793.08 6082 7855 147402 210579 30.00%
crit 16.52% 4.29 0 15 13615.43 11966 22712 13417.80 0 20314 58453 83507 29.60%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 343 0.7% 26.0 10.63sec 3964 0 Direct 26.0 3399 6801 3964 16.6% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.98 25.98 0.00 0.00 0.00 0.0000 0.0000 102983.23 147122.65 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.40% 21.67 8 39 3399.01 2991 5678 3397.02 2991 3941 73645 105210 30.00%
crit 16.60% 4.31 0 14 6800.81 5983 11356 6705.19 0 9663 29338 41912 29.60%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Sundering 671 1.3% 4.9 58.13sec 41071 33388 Direct 4.9 35252 70687 41070 16.4% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.91 4.91 0.00 0.00 0.00 1.2301 0.0000 201664.23 201664.23 0.00% 33388.12 33388.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.58% 4.10 0 8 35252.12 29211 75243 35172.37 0 55840 144672 144672 0.00%
crit 16.42% 0.81 0 5 70687.24 58423 135882 40587.50 0 128352 56993 56993 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [Y]:4.91
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (1087) 0.0% (2.1%) 1.0 0.00sec 325668 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 1087 2.1% 141.1 4.39sec 2308 0 Direct 141.1 1981 3960 2308 16.6% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 141.08 141.08 0.00 0.00 0.00 0.0000 0.0000 325668.39 465252.41 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.44% 117.72 61 186 1980.67 1669 3167 1980.80 1802 2280 233158 333091 30.00%
crit 16.56% 23.36 7 46 3959.71 3338 6335 3960.09 3406 4652 92510 132161 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}
Windlash 434 0.8% 23.1 10.62sec 5566 3961 Direct 23.1 4620 9234 5566 20.5% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.06 23.06 0.00 0.00 0.00 1.4052 0.0000 128330.72 128330.72 0.00% 3960.95 3960.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.50% 18.33 9 27 4620.26 3614 6154 4620.36 4209 5590 84694 84694 0.00%
crit 20.50% 4.73 0 13 9234.09 7228 12309 9181.41 0 11824 43637 43637 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 228 0.4% 24.1 10.15sec 2796 1969 Direct 24.1 2323 4641 2796 20.4% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.15 24.15 0.00 0.00 0.00 1.4202 0.0000 67522.41 67522.41 0.00% 1968.76 1968.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.61% 19.22 11 28 2323.36 1807 3077 2323.61 2111 2780 44666 44666 0.00%
crit 20.39% 4.93 0 13 4640.71 3614 6154 4619.17 0 6040 22856 22856 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (5674) 0.0% (11.0%) 15.5 13.27sec 108083 106362

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.54 0.00 0.00 0.00 0.00 1.0162 0.0000 0.00 0.00 0.00% 106361.76 106361.76

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [M]:15.54
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1&(talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|(talent.elemental_assault.enabled&talent.stormflurry.enabled)|ti_lightning_bolt)
    Windstrike (_mh) 739 1.4% 15.5 13.27sec 14078 0 Direct 15.5 12110 24186 14078 16.3% 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.54 15.54 0.00 0.00 0.00 0.0000 0.0000 218731.06 218731.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.71% 13.01 6 19 12110.28 9469 15854 12111.67 10749 14748 157513 157513 0.00%
crit 16.29% 2.53 0 8 24185.56 18939 31709 22647.81 0 31709 61218 61218 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
    Windstrike Off-Hand 370 0.7% 15.5 13.27sec 7053 0 Direct 15.5 6056 12088 7053 16.5% 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.54 15.54 0.00 0.00 0.00 0.0000 0.0000 109585.56 109585.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.47% 12.97 6 19 6055.62 4735 7927 6056.42 5442 7291 78536 78536 0.00%
crit 16.53% 2.57 0 9 12088.25 9469 15854 11350.77 0 15854 31049 31049 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
    Lightning Bolt (_ti) 4565 8.9% 15.5 13.27sec 86953 0 Direct 15.5 72153 144264 86951 20.5% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.54 15.54 0.00 0.00 0.00 0.0000 0.0000 1351029.15 1351029.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.48% 12.35 5 18 72152.73 27786 197870 72212.29 46331 115831 891027 891027 0.00%
crit 20.52% 3.19 0 10 144264.19 55572 363634 140211.07 0 281383 460002 460002 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 403 / 82
melee 403 0.2% 35.7 1.85sec 680 410 Direct 35.7 584 1169 680 16.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.67 35.67 0.00 0.00 0.00 1.6613 0.0000 24269.75 34671.96 30.00% 409.59 409.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.52% 29.79 0 50 584.03 520 976 583.90 0 735 17398 24855 30.00%
crit 16.48% 5.88 0 16 1169.06 1040 1952 1164.75 0 1680 6872 9817 29.91%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2439 / 739
melee 2439 1.4% 90.6 3.39sec 2437 2101 Direct 90.6 2087 4167 2437 16.8% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.59 90.59 0.00 0.00 0.00 1.1598 0.0000 220734.48 315343.01 30.00% 2100.93 2100.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.19% 75.36 3 165 2087.02 1738 3262 2085.34 1738 2939 157278 224689 30.00%
crit 16.81% 15.23 0 41 4166.56 3477 6523 4160.95 0 5844 63456 90654 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2450 / 741
melee 2450 1.5% 90.9 3.41sec 2437 2100 Direct 90.9 2087 4171 2437 16.8% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.88 90.88 0.00 0.00 0.00 1.1603 0.0000 221485.58 316416.05 30.00% 2100.42 2100.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.21% 75.63 8 181 2087.32 1738 3299 2084.83 1738 2722 157861 225521 30.00%
crit 16.79% 15.25 0 38 4170.79 3477 6523 4164.66 0 5454 63625 90895 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2444 / 741
melee 2444 1.5% 90.7 3.40sec 2440 2104 Direct 90.7 2090 4176 2440 16.8% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.73 90.73 0.00 0.00 0.00 1.1594 0.0000 221369.02 316249.52 30.00% 2104.43 2104.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.21% 75.49 2 208 2089.67 1738 3299 2087.64 1738 2796 157754 225368 30.00%
crit 16.79% 15.24 0 43 4175.56 3477 6523 4168.37 0 6044 63615 90882 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 180.73sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.0 308.19sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.03 0.00 0.00 0.00 0.00 1.1806 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [a]:1.03
Feral Spirit 11.2 29.21sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.25 0.00 0.00 0.00 0.00 1.1774 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:11.25
Phial of Tepid Versatility 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371172
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.50
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 91.88% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 182.5s
  • trigger_min/max:180.0s / 182.5s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • ascendance_1:10.14%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Ashen Catalyst 61.0 124.6 4.9sec 1.6sec 4.1sec 82.52% 98.62% 5.1 (5.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 37.8s
  • trigger_min/max:0.0s / 3.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.9s

Stack Uptimes

  • ashen_catalyst_1:29.85%
  • ashen_catalyst_2:16.34%
  • ashen_catalyst_3:11.74%
  • ashen_catalyst_4:9.65%
  • ashen_catalyst_5:6.30%
  • ashen_catalyst_6:3.56%
  • ashen_catalyst_7:1.93%
  • ashen_catalyst_8:3.16%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.7sec 180.7sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.3s / 182.8s
  • trigger_min/max:180.3s / 182.8s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crackling Surge 6.2 0.0 47.5sec 46.3sec 15.8sec 30.27% 36.84% 0.0 (0.0) 5.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.9s / 312.2s
  • trigger_min/max:6.9s / 312.2s
  • trigger_pct:84.94%
  • duration_min/max:0.0s / 44.3s

Stack Uptimes

  • crackling_surge_1:23.89%
  • crackling_surge_2:6.22%
  • crackling_surge_3:0.14%
  • crackling_surge_4:0.02%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.6sec 5.6sec 19.2sec 12.96% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.5s
  • trigger_min/max:0.0s / 163.3s
  • trigger_pct:100.00%
  • duration_min/max:18.0s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.33%
  • crumbling_power_2:0.33%
  • crumbling_power_3:0.43%
  • crumbling_power_4:0.69%
  • crumbling_power_5:0.76%
  • crumbling_power_6:0.73%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.71%
  • crumbling_power_10:0.70%
  • crumbling_power_11:0.70%
  • crumbling_power_12:0.70%
  • crumbling_power_13:0.70%
  • crumbling_power_14:0.71%
  • crumbling_power_15:0.71%
  • crumbling_power_16:0.71%
  • crumbling_power_17:0.72%
  • crumbling_power_18:0.76%
  • crumbling_power_19:1.10%
  • crumbling_power_20:0.01%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Elemental Blast: Critical Strike 7.5 0.0 38.4sec 38.4sec 9.8sec 24.46% 0.00% 0.0 (0.0) 7.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 287.6s
  • trigger_min/max:10.0s / 287.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_critical_strike_1:24.46%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.4 0.0 38.6sec 38.6sec 9.8sec 24.38% 0.00% 0.0 (0.0) 7.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 254.6s
  • trigger_min/max:10.0s / 254.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_haste_1:24.38%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.5 0.0 38.0sec 38.0sec 9.8sec 24.63% 0.00% 0.0 (0.0) 7.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 224.5s
  • trigger_min/max:10.0s / 224.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_mastery_1:24.63%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 308.1sec 0.0sec 27.4sec 13.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 331.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.41%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 9.6 1.6 32.8sec 29.2sec 16.8sec 53.87% 0.00% 45.1 (45.1) 9.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 73.2s
  • trigger_min/max:6.9s / 51.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.4s

Stack Uptimes

  • feral_spirit_1:53.87%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 49.4 211.5 6.1sec 1.1sec 4.7sec 77.33% 87.77% 211.5 (453.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 48.3s
  • trigger_min/max:0.0s / 18.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.3s

Stack Uptimes

  • flurry_1:22.26%
  • flurry_2:32.82%
  • flurry_3:22.25%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.5sec 46.4sec 13.0sec 19.46% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 215.6s
  • trigger_min/max:0.1s / 215.6s
  • trigger_pct:98.87%
  • duration_min/max:0.1s / 55.1s

Stack Uptimes

  • forgestorm_ignited_1:19.46%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 34.5 34.6 8.7sec 4.3sec 4.6sec 53.14% 91.35% 34.5 (164.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hailstorm
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 60.9s
  • trigger_min/max:0.9s / 28.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.0s

Stack Uptimes

  • hailstorm_1:0.14%
  • hailstorm_2:0.16%
  • hailstorm_3:0.12%
  • hailstorm_4:0.09%
  • hailstorm_5:52.63%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.5 5.6 28.0sec 17.8sec 9.9sec 34.85% 88.34% 5.6 (5.6) 10.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 188.7s
  • trigger_min/max:0.0s / 188.7s
  • trigger_pct:5.00%
  • duration_min/max:0.0s / 60.9s

Stack Uptimes

  • hot_hand_1:34.85%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 21.0 0.1 14.2sec 14.1sec 3.5sec 24.71% 54.13% 0.1 (0.1) 0.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.8s / 52.3s
  • trigger_min/max:8.7s / 52.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.2s

Stack Uptimes

  • ice_strike_1:24.71%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 6.2 0.0 47.5sec 46.3sec 15.8sec 30.23% 100.00% 0.0 (0.0) 5.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 307.6s
  • trigger_min/max:7.7s / 307.6s
  • trigger_pct:84.54%
  • duration_min/max:0.0s / 44.1s

Stack Uptimes

  • icy_edge_1:23.74%
  • icy_edge_2:6.34%
  • icy_edge_3:0.15%
  • icy_edge_4:0.02%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 32.3 251.2 9.3sec 1.1sec 8.4sec 90.98% 100.00% 6.9 (9.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 98.1s
  • trigger_min/max:0.0s / 14.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 97.6s

Stack Uptimes

  • maelstrom_weapon_1:13.09%
  • maelstrom_weapon_2:15.30%
  • maelstrom_weapon_3:16.80%
  • maelstrom_weapon_4:17.91%
  • maelstrom_weapon_5:13.60%
  • maelstrom_weapon_6:6.79%
  • maelstrom_weapon_7:3.40%
  • maelstrom_weapon_8:1.67%
  • maelstrom_weapon_9:0.86%
  • maelstrom_weapon_10:1.56%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 6.2 0.0 47.3sec 46.1sec 15.8sec 30.27% 100.00% 0.0 (0.0) 5.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.0s / 297.1s
  • trigger_min/max:7.0s / 284.5s
  • trigger_pct:84.94%
  • duration_min/max:0.0s / 44.2s

Stack Uptimes

  • molten_weapon_1:23.93%
  • molten_weapon_2:6.19%
  • molten_weapon_3:0.14%
  • molten_weapon_4:0.02%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Wave 6.7 0.0 48.1sec 48.1sec 6.7sec 15.01% 18.35% 0.0 (0.0) 0.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 77.6s
  • trigger_min/max:45.0s / 77.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • primordial_wave_1:15.01%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=false}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.1 60.8sec 45.6sec 16.5sec 23.63% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 209.5s
  • trigger_min/max:0.1s / 209.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.0s

Stack Uptimes

  • sophic_devotion_1:23.63%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.5 1.9 76.4sec 45.7sec 32.2sec 38.03% 0.00% 25.6 (25.6) 3.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 250.9s
  • trigger_min/max:0.1s / 207.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 181.8s

Stack Uptimes

  • spiraling_winds_1:2.33%
  • spiraling_winds_2:2.30%
  • spiraling_winds_3:2.29%
  • spiraling_winds_4:2.27%
  • spiraling_winds_5:2.26%
  • spiraling_winds_6:2.24%
  • spiraling_winds_7:2.23%
  • spiraling_winds_8:2.21%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.68%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 100.00% 28.0 (28.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:180.0s / 182.5s
  • trigger_min/max:180.0s / 182.5s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • static_accumulation_1:10.14%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411={$s2=10}% chance to refund Maelstrom Weapon stacks spent on Lightning Bolt or Chain Lightning. While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 24.0 10.3 12.3sec 8.5sec 5.0sec 39.92% 52.70% 10.3 (10.3) 1.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 128.6s
  • trigger_min/max:0.0s / 118.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 59.5s

Stack Uptimes

  • stormbringer_1:39.92%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Tepid Versatility

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_phial_of_tepid_versatility
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Phial of Tepid Versatility

Stat Details

  • stat:versatility_rating
  • amount:745.00

Spelldata

  • id:371172
  • name:Phial of Tepid Versatility
  • tooltip:Versatility increased by {$=}w1.
  • description:Increases your Versatility by {$s1=315}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.5 9.0 47.0 11.1s 1.3s 150.7s
windfury_totem_extra_attack_oh 26.8 9.0 51.0 10.9s 0.1s 148.0s
Elemental Blast: Critical Strike 7.5 1.0 15.0 38.4s 10.0s 287.6s
Elemental Blast: Haste 7.4 1.0 15.0 38.6s 10.0s 254.6s
Elemental Blast: Mastery 7.5 1.0 15.0 38.0s 10.0s 224.5s
Maelstrom Weapon: Feral Spirit 62.2 44.0 82.0 4.8s 0.0s 36.4s
Maelstrom Weapon: Swirling Maelstrom 55.1 35.0 74.0 5.3s 1.0s 45.3s
Maelstrom Weapon: Static Accumulation 60.0 60.0 60.0 6.7s 1.0s 168.5s
Maelstrom Weapon: Static Accumulation Refund 45.2 0.0 118.0 28.3s 0.9s 303.7s
Maelstrom Weapon: Windfury Attack 28.2 8.0 55.0 11.7s 0.0s 133.2s
Maelstrom Weapon: main_hand 27.5 7.0 50.0 10.7s 1.4s 127.8s
Maelstrom Weapon: Windlash 4.6 0.0 12.0 44.8s 1.3s 194.2s
Maelstrom Weapon: offhand 27.6 9.0 55.0 10.6s 1.4s 114.5s
Maelstrom Weapon: Windlash Off-Hand 4.8 0.0 13.0 43.8s 1.3s 194.8s
Maelstrom Weapon: Lava Lash 12.2 1.0 28.0 22.4s 1.0s 258.4s
Maelstrom Weapon: Sundering 1.0 0.0 5.0 105.5s 40.0s 325.9s
Maelstrom Weapon: Windstrike 3.1 0.0 10.0 58.6s 0.9s 194.1s
Maelstrom Weapon: Windstrike Off-Hand 3.1 0.0 9.0 58.2s 0.9s 194.1s
Maelstrom Weapon: Ice Strike 4.2 0.0 14.0 54.7s 8.9s 304.9s
Maelstrom Weapon: Stormstrike 5.2 0.0 15.0 43.8s 1.0s 302.4s
Maelstrom Weapon: Stormstrike Off-Hand 5.2 0.0 15.0 44.1s 1.0s 285.6s
Flametongue: Windfury Attack 141.1 78.0 216.0 4.4s 0.0s 54.4s
Stormbringer: Windfury Attack 15.6 3.0 38.0 19.5s 0.0s 228.6s
Flametongue: main_hand 137.1 89.0 187.0 2.6s 1.4s 29.9s
Hot Hand: main_hand 6.8 0.0 22.0 36.5s 1.4s 279.2s
Windfury: main_hand 42.5 18.0 74.0 7.2s 1.4s 95.2s
Flametongue: Windlash 23.1 18.0 31.0 10.6s 1.3s 170.4s
Hot Hand: Windlash 1.2 0.0 8.0 78.4s 1.3s 194.7s
Windfury: Windlash 7.1 0.0 17.0 31.5s 1.3s 191.8s
Flametongue: offhand 137.9 88.0 194.0 2.6s 1.4s 27.2s
Hot Hand: offhand 6.9 0.0 19.0 36.0s 1.4s 301.2s
Flametongue: Windlash Off-Hand 24.1 19.0 32.0 10.2s 1.3s 168.8s
Hot Hand: Windlash Off-Hand 1.2 0.0 9.0 82.8s 1.3s 195.2s
Flametongue: Lava Lash 61.0 32.0 96.0 4.8s 1.0s 38.2s
Stormbringer: Lava Lash 6.7 0.0 21.0 37.1s 1.0s 292.5s
Flametongue: Sundering 4.9 1.0 8.0 58.0s 40.0s 243.2s
Stormbringer: Sundering 0.5 0.0 5.0 112.9s 40.0s 322.0s
Windfury: Sundering 1.5 0.0 6.0 98.5s 40.0s 317.6s
Flametongue: Windstrike 15.5 12.0 20.0 13.3s 0.9s 170.3s
Stormbringer: Windstrike 1.7 0.0 9.0 69.8s 0.9s 194.2s
Windfury: Windstrike 4.8 0.0 12.0 42.4s 0.9s 194.0s
Flametongue: Windstrike Off-Hand 15.5 12.0 20.0 13.3s 0.9s 170.3s
Stormbringer: Windstrike Off-Hand 1.7 0.0 8.0 69.2s 0.9s 194.0s
Flametongue: Ice Strike 21.1 14.0 28.0 14.1s 8.7s 52.3s
Stormbringer: Ice Strike 2.3 0.0 9.0 73.4s 9.2s 347.9s
Windfury: Ice Strike 6.5 0.0 16.0 40.5s 8.8s 287.0s
Flametongue: Stormstrike 26.0 11.0 45.0 10.6s 1.0s 107.8s
Stormbringer: Stormstrike 2.8 0.0 12.0 59.7s 1.0s 302.5s
Windfury: Stormstrike 8.0 0.0 20.0 31.2s 1.0s 277.7s
Flametongue: Stormstrike Off-Hand 26.0 11.0 45.0 10.6s 1.0s 107.8s
Stormbringer: Stormstrike Off-Hand 2.8 0.0 11.0 59.7s 1.0s 307.8s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 30.35% 21.54% 37.71% 0.7s 0.0s 13.7s
Hot Hand 34.85% 9.47% 62.64% 9.9s 0.0s 60.9s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.6500.0001.4557.3202.13913.349
Ascendance1.2080.0002.4702.4171.9624.435
Lava Lash1.1020.00030.95067.59630.472120.762
Primordial Wave2.8250.00032.64219.1131.53341.110
Elemental Blast1.7470.00028.46839.5687.255104.220
Sundering22.7220.000256.214117.37643.699286.611
Windstrike
Stormstrike
2.8520.00046.070121.09453.048201.054
Ice Strike2.2930.00040.51948.48115.37288.433
Frost Shock3.1390.00053.226118.12362.270184.805
Flame Shock37.5400.000324.451268.632187.166357.016
Earth Elemental60.9070.000299.00763.82721.409357.016

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack27.70.58.15%5.38%
main_hand27.40.18.06%1.10%
Windlash4.10.51.22%5.21%
offhand27.40.28.06%1.78%
Windlash Off-Hand4.30.51.28%5.23%
Feral Spirit61.11.117.98%11.80%
Ascendance53.96.115.85%64.56%
Lightning Bolt31.20.09.19%0.00%
Lava Lash12.10.23.55%1.97%
Sundering1.00.00.28%0.00%
Windstrike (_mh)3.00.10.87%1.46%
Windstrike Off-Hand2.90.10.86%1.51%
Ice Strike25.30.07.44%0.00%
Frost Shock34.00.010.01%0.00%
Stormstrike (_mh)5.20.01.54%0.00%
Stormstrike Off-Hand5.20.01.53%0.00%
Lightning Bolt (_ti)14.00.04.12%0.00%
Overflow Stacks0.09.50.00%2.71%
Actual Stacks339.90.097.29%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt155.746.21%
Elemental Blast112.033.24%
Lightning Bolt (_ti)69.220.55%
Total Spent336.9100.00%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
mana_regenMana617.20180146.79100.00%291.88299212.3462.42%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 600.49 602.39 299211.5 49431.7 47000.0 50000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.001000.000.55%1000.001000.000.00
Elemental BlastMana 22.4030794.4317.04%1375.001374.9973.03
Flame ShockMana 6.304721.572.61%750.0063.74327.39
Frost ShockMana 37.2918643.8510.32%500.00500.0063.42
Ice StrikeMana 21.0634749.2119.23%1650.001650.0014.51
Lava LashMana 61.0524418.1313.51%400.00400.00108.41
Lightning BoltMana 31.1315565.598.61%500.00500.01113.71
Primordial WaveMana 6.7410112.855.60%1500.001500.0253.63
StormstrikeMana 25.9825979.7414.38%1000.00999.9711.89
SunderingMana 4.9114729.648.15%3000.002999.8513.69

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 50904.37
Minimum 43510.72
Maximum 60947.84
Spread ( max - min ) 17437.11
Range [ ( max - min ) / 2 * 100% ] 17.13%
Standard Deviation 2300.1627
5th Percentile 47331.27
95th Percentile 54923.57
( 95th Percentile - 5th Percentile ) 7592.29
Mean Distribution
Standard Deviation 26.5618
95.00% Confidence Interval ( 50852.31 - 50956.43 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 79
0.1% Error 7844
0.1 Scale Factor Error with Delta=300 45165
0.05 Scale Factor Error with Delta=300 180660
0.01 Scale Factor Error with Delta=300 4516488
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 50904.37
Minimum 43510.72
Maximum 60947.84
Spread ( max - min ) 17437.11
Range [ ( max - min ) / 2 * 100% ] 17.13%
Standard Deviation 2300.1627
5th Percentile 47331.27
95th Percentile 54923.57
( 95th Percentile - 5th Percentile ) 7592.29
Mean Distribution
Standard Deviation 26.5618
95.00% Confidence Interval ( 50852.31 - 50956.43 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 79
0.1% Error 7844
0.1 Scale Factor Error with Delta=300 45165
0.05 Scale Factor Error with Delta=300 180660
0.01 Scale Factor Error with Delta=300 4516488
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 50904.37
Minimum 43510.72
Maximum 60947.84
Spread ( max - min ) 17437.11
Range [ ( max - min ) / 2 * 100% ] 17.13%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 14551929.85
Minimum 10703264.54
Maximum 18929182.64
Spread ( max - min ) 8225918.10
Range [ ( max - min ) / 2 * 100% ] 28.26%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.50 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 invoke_external_buff,name=power_infusion,if=(talent.ascendance.enabled&talent.thorims_invocation.enabled&buff.ascendance.up)|(!talent.thorims_invocation.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.thorims_invocation.enabled&!talent.feral_spirit.enabled)|fight_remains<=20
F 11.25 feral_spirit
G 2.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1))
0.00 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
I 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
J 1.02 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>42|raid_event.adds.in<6)
K 0.01 flame_shock,if=!ticking&talent.lashing_flames.enabled
L 1.30 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=40
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
M 15.54 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1&(talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|(talent.elemental_assault.enabled&talent.stormflurry.enabled)|ti_lightning_bolt)
0.00 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|((talent.elemental_assault.enabled&talent.stormflurry.enabled)&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack)
N 43.18 lava_lash,if=buff.hot_hand.up
0.00 windfury_totem,if=!buff.windfury_totem.up
O 7.90 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
P 5.65 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
Q 13.20 elemental_blast,if=buff.maelstrom_weapon.stack>=5&(buff.feral_spirit.up|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
R 25.48 lightning_bolt,if=((buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
0.00 ice_strike,if=buff.doom_winds.up
0.00 sundering,if=buff.doom_winds.up&raid_event.adds.in>=40
0.00 crash_lightning,if=buff.doom_winds.up|(talent.alpha_wolf.enabled&buff.feral_spirit.up&((action.crash_lightning.last_used<action.feral_spirit.last_used&action.chain_lightning.last_used<action.feral_spirit.last_used)|(time-action.chain_lightning.last_used>8&time-action.crash_lightning.last_used>8)))
S 5.73 primordial_wave,if=raid_event.adds.in>42|raid_event.adds.in<6
0.00 flame_shock,if=!ticking
T 0.18 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
U 21.06 ice_strike
V 34.04 frost_shock,if=buff.hailstorm.up
W 17.69 lava_lash
0.00 windstrike
X 25.98 stormstrike
Y 4.91 sundering,if=raid_event.adds.in>=40
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
0.00 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Z 3.25 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
a 1.03 earth_elemental
b 6.28 flame_shock
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

0123478ABCDFJGEMUMNMNMNMNMFLLMNRNRNRNUNRVWXRVYFQUVWXQVaRWVUSPVXWbZXURVWXNZNbNFOUQVWXYXXRVRUWVRSXVbWUOVXFPVWQXUQVbRWVRRXUVNRFNQNVRSUVWPQVXYWXURVbXRVWbNUFNXNOVQXRUVWDXGEMNMNMFMNMMOMQSUPVWFXYQVWURVXRQVWXRNUNVNXbWNRFNQNUQSVPWXVRYUVWXXRRVbNUFNONVXQWVURRVXWbZSXUPVWX

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 2 augmentation PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana flurry(3)
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement 50000.0/50000: 100% mana flurry(3)
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement 50000.0/50000: 100% mana flurry(3)
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3)
0:00.000 default B potion Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(3)
0:00.000 default C auto_attack Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(3), elemental_potion_of_ultimate_power
0:00.000 default D use_items Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(2), elemental_potion_of_ultimate_power
0:00.000 default F feral_spirit Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(2), crumbling_power(20), elemental_potion_of_ultimate_power
0:00.984 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, crackling_surge(2), maelstrom_weapon, crumbling_power(19), elemental_potion_of_ultimate_power
0:01.967 default G ascendance Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), primordial_wave, feral_spirit, crackling_surge(2), maelstrom_weapon(2), crumbling_power(19), elemental_potion_of_ultimate_power
0:02.951 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(4), static_accumulation, crumbling_power(18), elemental_potion_of_ultimate_power
0:02.951 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(4), static_accumulation, crumbling_power(18), elemental_potion_of_ultimate_power
0:03.845 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(3), hailstorm(4), static_accumulation, crumbling_power(17), elemental_potion_of_ultimate_power
0:04.738 single M windstrike Fluffy_Pillow 49778.8/50000: 100% mana bloodlust, berserking, ascendance, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(6), hailstorm(4), static_accumulation, ice_strike, crumbling_power(16), elemental_potion_of_ultimate_power
0:05.631 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(3), hot_hand, maelstrom_weapon(5), hailstorm(5), static_accumulation, ice_strike, crumbling_power(15), elemental_potion_of_ultimate_power
0:06.525 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(5), static_accumulation, ice_strike, crumbling_power(14), elemental_potion_of_ultimate_power
0:07.419 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(9), hailstorm(5), static_accumulation, ice_strike, crumbling_power(13), elemental_potion_of_ultimate_power
0:08.314 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), primordial_wave, feral_spirit, crackling_surge(2), hot_hand, maelstrom_weapon(10), hailstorm(5), static_accumulation, ice_strike, crumbling_power(12), elemental_potion_of_ultimate_power
0:09.207 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(8), hailstorm(5), static_accumulation, ice_strike, crumbling_power(11), elemental_potion_of_ultimate_power
0:10.103 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(5), static_accumulation, ice_strike, crumbling_power(10), elemental_potion_of_ultimate_power
0:10.995 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(7), hailstorm(5), static_accumulation, ice_strike, crumbling_power(9), elemental_potion_of_ultimate_power
0:11.888 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, primordial_wave, feral_spirit, crackling_surge(2), hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(5), static_accumulation, ice_strike, crumbling_power(8), elemental_potion_of_ultimate_power
0:12.783 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(5), static_accumulation, ice_strike, crumbling_power(7), elemental_potion_of_ultimate_power
0:13.677 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, primordial_wave, feral_spirit, icy_edge, crackling_surge(3), ashen_catalyst(2), hot_hand, maelstrom_weapon(8), hailstorm(5), static_accumulation, ice_strike, crumbling_power(6), elemental_potion_of_ultimate_power
0:14.571 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, crackling_surge(3), ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(5), static_accumulation, ice_strike, crumbling_power(5), elemental_potion_of_ultimate_power
0:15.468 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5), static_accumulation, ice_strike, crumbling_power(4), elemental_potion_of_ultimate_power
0:16.453 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hot_hand, maelstrom_weapon(7), hailstorm(5), static_accumulation, crumbling_power(3), elemental_potion_of_ultimate_power
0:17.437 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(9), hailstorm(5), crumbling_power(2), elemental_potion_of_ultimate_power
0:18.420 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(9), hailstorm(5), crumbling_power, elemental_potion_of_ultimate_power
0:19.403 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, hot_hand, maelstrom_weapon(10), hailstorm(5), elemental_potion_of_ultimate_power
0:20.388 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(5), elemental_potion_of_ultimate_power
0:21.371 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(5), elemental_potion_of_ultimate_power
0:22.356 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(2), hailstorm(5), elemental_potion_of_ultimate_power
0:23.341 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, hot_hand, maelstrom_weapon(4), hailstorm(5), elemental_potion_of_ultimate_power
0:24.325 single N lava_lash Fluffy_Pillow 49924.4/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(5), ice_strike, elemental_potion_of_ultimate_power
0:25.307 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(5), ice_strike, elemental_potion_of_ultimate_power
0:26.291 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(5), ice_strike, elemental_potion_of_ultimate_power
0:27.274 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), elemental_potion_of_ultimate_power
0:28.259 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ashen_catalyst, maelstrom_weapon(4), elemental_potion_of_ultimate_power
0:29.243 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, ashen_catalyst(2), maelstrom_weapon(6), elemental_potion_of_ultimate_power
0:30.224 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(5)
0:31.208 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), ashen_catalyst(3), maelstrom_weapon(3)
0:32.193 default F feral_spirit Fluffy_Pillow 48576.0/50000: 97% mana bloodlust, flurry(2), ashen_catalyst(4), maelstrom_weapon(4)
0:33.176 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(5)
0:34.158 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), hailstorm(5)
0:35.141 single V frost_shock Fluffy_Pillow 49922.8/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), maelstrom_weapon(2), hailstorm(5), ice_strike
0:36.124 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(7), maelstrom_weapon(4)
0:37.108 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(4)
0:38.091 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6)
0:39.073 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(5)
0:40.056 single a earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4)
0:41.332 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(5)
0:42.609 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), hailstorm(5)
0:43.887 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon, hailstorm(5)
0:45.164 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(3)
0:46.441 single S primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), ice_strike
0:47.717 single P lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, primordial_wave, ashen_catalyst(3), stormbringer, maelstrom_weapon(6), ice_strike
0:48.992 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), stormbringer, maelstrom_weapon, hailstorm(5), ice_strike
0:50.270 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(2)
0:51.547 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(5), maelstrom_weapon(3)
0:52.823 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(3)
0:54.100 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(3)
0:55.377 Waiting     1.109 sec 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(3)
0:56.486 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(3)
0:57.910 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(4), maelstrom_weapon(4)
0:59.188 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(5), maelstrom_weapon(5), ice_strike
1:00.465 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), maelstrom_weapon, hailstorm(5), ice_strike
1:01.741 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(6), maelstrom_weapon(2)
1:03.016 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(3)
1:04.294 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(4)
1:05.569 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, hot_hand, maelstrom_weapon(4)
1:06.846 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(4)
1:08.123 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(4)
1:09.397 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), hot_hand, maelstrom_weapon(4)
1:10.674 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana hot_hand, stormbringer, maelstrom_weapon(5)
1:11.950 single O elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(7)
1:13.226 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(2), hailstorm(5)
1:14.502 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(5), hailstorm(5), ice_strike, spiraling_winds(2)
1:15.778 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, hailstorm(5), ice_strike, spiraling_winds(3)
1:17.055 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(2), spiraling_winds(3)
1:18.332 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(2), spiraling_winds(4)
1:19.609 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), spiraling_winds(5)
1:20.887 single X stormstrike Fluffy_Pillow 49044.8/50000: 98% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), spiraling_winds(5)
1:22.163 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), spiraling_winds(6)
1:23.439 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(7), spiraling_winds(7)
1:24.717 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(2), hailstorm(5), spiraling_winds(7)
1:25.993 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), stormbringer, maelstrom_weapon(6), spiraling_winds(8), sophic_devotion
1:27.270 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(6), stormbringer, maelstrom_weapon, hailstorm(5), spiraling_winds(8), sophic_devotion
1:28.546 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(7), stormbringer, maelstrom_weapon(4), hailstorm(5), ice_strike, spiraling_winds(9), sophic_devotion
1:29.824 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, stormbringer, maelstrom_weapon(4), hailstorm(5), ice_strike, spiraling_winds(10), sophic_devotion
1:31.099 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, stormbringer, maelstrom_weapon(5), spiraling_winds(10), sophic_devotion
1:32.374 single S primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), stormbringer, hailstorm(5), spiraling_winds(10), sophic_devotion
1:33.653 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(3), stormbringer, hailstorm(5), spiraling_winds(10), sophic_devotion
1:34.930 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(4), hailstorm(5), spiraling_winds(10), sophic_devotion
1:36.208 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(4), maelstrom_weapon(2), spiraling_winds(10), sophic_devotion
1:37.485 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, ashen_catalyst(5), maelstrom_weapon(3), spiraling_winds(10), sophic_devotion
1:38.761 Waiting     1.015 sec 50000.0/50000: 100% mana primordial_wave, ashen_catalyst, maelstrom_weapon(3), spiraling_winds(10), sophic_devotion
1:39.776 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, ashen_catalyst(2), maelstrom_weapon(3), spiraling_winds(10), sophic_devotion
1:41.275 single O elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(10)
1:42.550 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, primordial_wave, ashen_catalyst(3), stormbringer, maelstrom_weapon(2), hailstorm(5), ice_strike, spiraling_winds(10)
1:43.828 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, primordial_wave, ashen_catalyst(4), stormbringer, maelstrom_weapon(3), spiraling_winds(10)
1:45.106 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, primordial_wave, ashen_catalyst(5), maelstrom_weapon(5), spiraling_winds(10)
1:46.382 single P lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(7)
1:47.659 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(6), maelstrom_weapon(2), hailstorm(5), spiraling_winds
1:48.935 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(7), maelstrom_weapon(4), spiraling_winds(2)
1:50.213 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(5), spiraling_winds(2)
1:51.491 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(2), hailstorm(5), spiraling_winds(3)
1:52.768 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(3), hailstorm(5), spiraling_winds(4)
1:54.044 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(5), hailstorm(5), ice_strike, spiraling_winds(4)
1:55.321 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(2), hailstorm(5), ice_strike, spiraling_winds(5)
1:56.599 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds(6)
1:57.876 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(5), spiraling_winds(6)
1:59.152 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(6), hailstorm(5), spiraling_winds(7)
2:00.431 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(2), hailstorm(5), spiraling_winds(8)
2:01.706 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(5), spiraling_winds(8)
2:02.984 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(5), hailstorm(5), spiraling_winds(9)
2:04.261 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), hailstorm(5), spiraling_winds(9)
2:05.537 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), hailstorm(5), spiraling_winds(10)
2:06.813 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(4), maelstrom_weapon(3), hailstorm(5), ice_strike, spiraling_winds(10)
2:08.089 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), hot_hand, maelstrom_weapon(5), spiraling_winds(10)
2:09.366 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(5), spiraling_winds(10)
2:10.642 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(5), hailstorm(5), spiraling_winds(10)
2:11.918 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(6), hailstorm(5)
2:13.194 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(5)
2:14.471 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(2), hailstorm(5)
2:15.709 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon(3), hailstorm(5)
2:16.947 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon(5)
2:18.186 single S primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, hailstorm(5)
2:19.423 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(3), stormbringer, hailstorm(5)
2:20.661 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(2), hailstorm(5), ice_strike
2:21.900 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(4)
2:23.140 single P lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon(5)
2:24.378 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(5), hailstorm(5)
2:25.654 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, icy_edge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon, hailstorm(5)
2:26.893 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(3), stormbringer, maelstrom_weapon(2)
2:28.133 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(3)
2:29.372 single W lava_lash Fluffy_Pillow 48982.4/50000: 98% mana flurry, elemental_blast_haste, ashen_catalyst(5), maelstrom_weapon(3)
2:30.612 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, stormbringer, maelstrom_weapon(3), spiraling_winds, sophic_devotion
2:31.852 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, maelstrom_weapon(3), spiraling_winds(2), sophic_devotion
2:33.090 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(6), ice_strike, spiraling_winds(2), sophic_devotion
2:34.328 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon, hailstorm(5), ice_strike, spiraling_winds(3), sophic_devotion
2:35.567 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(2), spiraling_winds(4), sophic_devotion
2:36.843 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds(4), sophic_devotion
2:38.140 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon(5), spiraling_winds(5), sophic_devotion
2:39.418 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(6), hailstorm(5), spiraling_winds(6), sophic_devotion
2:40.693 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(7), maelstrom_weapon, spiraling_winds(6), sophic_devotion
2:41.969 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon, spiraling_winds(7), sophic_devotion
2:43.246 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon, spiraling_winds(7), sophic_devotion
2:44.522 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(2), spiraling_winds(8), forgestorm_ignited
2:45.798 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3), ice_strike, spiraling_winds(9), forgestorm_ignited
2:47.074 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(9), forgestorm_ignited
2:48.350 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(10), forgestorm_ignited
2:49.626 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), ice_strike, spiraling_winds(10), forgestorm_ignited
2:50.901 single O elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(8), ice_strike, spiraling_winds(10), forgestorm_ignited
2:52.178 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), hailstorm(5), ice_strike, spiraling_winds(10), forgestorm_ignited
2:53.419 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited
2:54.659 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(5), forgestorm_ignited
2:55.899 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(5), hailstorm(5), forgestorm_ignited
2:57.138 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, hailstorm(5)
2:58.377 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(2), hailstorm(5), ice_strike, forgestorm_ignited
2:59.615 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), stormbringer, maelstrom_weapon(3), forgestorm_ignited
3:00.854 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst, stormbringer, maelstrom_weapon(4), forgestorm_ignited
3:00.854 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst, stormbringer, maelstrom_weapon(4), crumbling_power(20), forgestorm_ignited
3:02.094 default G ascendance Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(4), crumbling_power(19), spiraling_winds, forgestorm_ignited
3:03.370 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(7), static_accumulation, crumbling_power(18), spiraling_winds(2), forgestorm_ignited
3:03.370 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(7), static_accumulation, crumbling_power(18), spiraling_winds(2), forgestorm_ignited
3:04.530 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, ashen_catalyst(3), hot_hand, maelstrom_weapon(5), hailstorm(5), static_accumulation, crumbling_power(17), spiraling_winds(2), forgestorm_ignited
3:05.693 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), ashen_catalyst, hot_hand, maelstrom_weapon(7), hailstorm(5), static_accumulation, crumbling_power(16), spiraling_winds(3), forgestorm_ignited
3:06.855 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), hailstorm(5), static_accumulation, crumbling_power(15), spiraling_winds(4), forgestorm_ignited
3:08.015 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, hot_hand, maelstrom_weapon(9), hailstorm(5), static_accumulation, crumbling_power(14), spiraling_winds(5), forgestorm_ignited
3:09.176 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(5), static_accumulation, crumbling_power(13), spiraling_winds(6)
3:10.336 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), hailstorm(5), static_accumulation, crumbling_power(12), spiraling_winds(6)
3:11.497 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hot_hand, maelstrom_weapon(10), hailstorm(5), static_accumulation, crumbling_power(11), spiraling_winds(7)
3:12.660 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, feral_spirit, molten_weapon, crackling_surge, maelstrom_weapon(10), hailstorm(5), static_accumulation, crumbling_power(10), spiraling_winds(7)
3:13.821 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(10), hailstorm(5), static_accumulation, crumbling_power(9), spiraling_winds(8)
3:14.980 single O elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(8), hailstorm(5), static_accumulation, crumbling_power(8), spiraling_winds(9)
3:16.142 single M windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(8), hailstorm(5), static_accumulation, crumbling_power(7), spiraling_winds(9)
3:17.488 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(6), hailstorm(5), crumbling_power(6), spiraling_winds(10)
3:18.765 single S primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(2), hailstorm(5), crumbling_power(5), spiraling_winds(10)
3:20.004 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(2), hailstorm(5), crumbling_power(5), spiraling_winds(10)
3:21.244 single P lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), maelstrom_weapon(5), hailstorm(5), ice_strike, spiraling_winds(10)
3:22.485 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), hailstorm(5), ice_strike, spiraling_winds(10)
3:23.726 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(7), maelstrom_weapon, spiraling_winds(10)
3:24.966 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(2), spiraling_winds(10)
3:26.206 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(3), spiraling_winds(10)
3:27.445 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(10)
3:28.685 single Q elemental_blast Fluffy_Pillow 48984.0/50000: 98% mana flurry, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(5), spiraling_winds(10)
3:29.963 single V frost_shock Fluffy_Pillow 49653.8/50000: 99% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon, hailstorm(5), spiraling_winds(10)
3:31.239 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(3), spiraling_winds(10)
3:32.541 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), maelstrom_weapon(4), spiraling_winds(10)
3:33.817 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(10)
3:35.093 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon, hailstorm(5), ice_strike, spiraling_winds(10)
3:36.371 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(3), spiraling_winds(10)
3:37.647 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(5), spiraling_winds(10)
3:38.924 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(6), hailstorm(5), spiraling_winds(10)
3:40.257 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(5), maelstrom_weapon(3), hailstorm(5)
3:41.533 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(6), maelstrom_weapon(4)
3:42.810 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, maelstrom_weapon(4)
3:44.085 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, stormbringer, maelstrom_weapon(6)
3:45.361 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(5)
3:46.637 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(5)
3:47.912 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5), ice_strike
3:49.190 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5), ice_strike
3:50.466 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4)
3:51.744 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4)
3:53.020 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(4)
3:54.299 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(4)
3:55.577 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(5)
3:56.852 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(5)
3:58.129 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(5)
3:59.406 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(6), hailstorm(5)
4:00.681 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(5)
4:01.959 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), hailstorm(5)
4:03.199 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, maelstrom_weapon(3), hailstorm(5)
4:04.437 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, maelstrom_weapon(8), hailstorm(5), ice_strike
4:05.675 single S primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), hailstorm(5), ice_strike
4:06.913 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(3), hailstorm(5), ice_strike, spiraling_winds
4:08.151 single P lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(6), spiraling_winds(2)
4:09.392 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), stormbringer, maelstrom_weapon(2), hailstorm(5), spiraling_winds(2)
4:10.631 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, maelstrom_weapon(3), hailstorm(5), spiraling_winds(3)
4:11.871 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(3), hailstorm(5), spiraling_winds(4)
4:13.166 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, icy_edge, ashen_catalyst(3), maelstrom_weapon(5), spiraling_winds(4)
4:14.441 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), hailstorm(5), spiraling_winds(5)
4:15.717 single U ice_strike Fluffy_Pillow 49041.6/50000: 98% mana flurry(2), ashen_catalyst(4), stormbringer, hailstorm(5), spiraling_winds(6)
4:16.993 single V frost_shock Fluffy_Pillow 49433.2/50000: 99% mana flurry(2), ashen_catalyst(5), stormbringer, maelstrom_weapon, hailstorm(5), ice_strike, spiraling_winds(6)
4:18.271 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(6), stormbringer, maelstrom_weapon(3), spiraling_winds(7)
4:19.548 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, stormbringer, maelstrom_weapon(3), spiraling_winds(7)
4:20.824 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, stormbringer, maelstrom_weapon(4), spiraling_winds(8)
4:22.100 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(6), spiraling_winds(9)
4:23.377 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), maelstrom_weapon(7), hailstorm(5), spiraling_winds(9)
4:24.651 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), maelstrom_weapon(2), hailstorm(5), spiraling_winds(10)
4:25.927 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(4), spiraling_winds(10)
4:27.201 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(5), hot_hand, maelstrom_weapon(4), spiraling_winds(10)
4:28.477 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(4), spiraling_winds(10)
4:29.754 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(5), ice_strike, spiraling_winds(10)
4:31.032 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(6), ice_strike
4:32.310 single O elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(6), ice_strike
4:33.586 single N lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(2), hailstorm(5), ice_strike
4:34.826 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, maelstrom_weapon(2), hailstorm(5), ice_strike
4:36.065 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(4)
4:37.304 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5)
4:38.544 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hailstorm(5), spiraling_winds
4:39.784 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, maelstrom_weapon(2), hailstorm(5), spiraling_winds(2)
4:41.023 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(3)
4:42.264 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), ice_strike, spiraling_winds(3)
4:43.504 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(6), hailstorm(5), ice_strike, spiraling_winds(4)
4:44.778 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(5), ice_strike, spiraling_winds(5)
4:46.075 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(4), spiraling_winds(5), forgestorm_ignited
4:47.351 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), maelstrom_weapon(4), spiraling_winds(6), forgestorm_ignited
4:48.626 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, maelstrom_weapon(4), spiraling_winds(7), forgestorm_ignited
4:49.901 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(7), forgestorm_ignited
4:51.177 single S primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(8), forgestorm_ignited
4:52.453 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(9), forgestorm_ignited
4:53.731 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(4), maelstrom_weapon(4), spiraling_winds(9), forgestorm_ignited
4:55.007 single P lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, ashen_catalyst(4), maelstrom_weapon(5), ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited
4:56.283 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), hailstorm(5), ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited
4:57.559 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(6), maelstrom_weapon, spiraling_winds(10), sophic_devotion
4:58.836 single X stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon, spiraling_winds(10), sophic_devotion

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.82% 15.82% 1047
Haste 17.84% 17.84% 3032
Versatility 7.57% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 58.69% 58.69% 3842
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +519 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAQSSKRSCSSIIJUSIAAAAAAAAAAAAgSESCJoJQSLJpgIEESaI

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_tepid_versatility_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/invoke_external_buff,name=power_infusion,if=(talent.ascendance.enabled&talent.thorims_invocation.enabled&buff.ascendance.up)|(!talent.thorims_invocation.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.thorims_invocation.enabled&!talent.feral_spirit.enabled)|fight_remains<=20
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&buff.feral_spirit.up&((action.crash_lightning.last_used<action.feral_spirit.last_used&action.chain_lightning.last_used<action.feral_spirit.last_used)|(time-action.chain_lightning.last_used>8&time-action.crash_lightning.last_used>8)))
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=40
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1&(talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|(talent.elemental_assault.enabled&talent.stormflurry.enabled)|ti_lightning_bolt)
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|((talent.elemental_assault.enabled&talent.stormflurry.enabled)&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&(buff.feral_spirit.up|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up&raid_event.adds.in>=40
actions.single+=/crash_lightning,if=buff.doom_winds.up|(talent.alpha_wolf.enabled&buff.feral_spirit.up&((action.crash_lightning.last_used<action.feral_spirit.last_used&action.chain_lightning.last_used<action.feral_spirit.last_used)|(time-action.chain_lightning.last_used>8&time-action.crash_lightning.last_used>8)))
actions.single+=/primordial_wave,if=raid_event.adds.in>42|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/ice_strike
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1047
# gear_haste_rating=3032
# gear_mastery_rating=3842
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Storm : 51774 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
51773.9 51773.9 66.7 / 0.129% 11661.3 / 22.5% 59.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
818.1 815.5 Mana 0.97% 52.2 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAoEhkQCKCk0SSaICQikCC

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Storm 51774
Ascendance (_dre) 0 (1018) 0.0% (2.0%) 7.9 35.88sec 38796 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.88 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
    Ascendance (_damage_dre) 1018 2.0% 7.9 35.88sec 38796 0 Direct 7.9 32691 65385 38795 18.7% 0.0%

Stats Details: Ascendance Damage Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.88 7.88 0.00 0.00 0.00 0.0000 0.0000 305564.76 305564.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.33% 6.41 1 14 32690.63 27692 54635 32666.20 27692 41324 209402 209402 0.00%
crit 18.67% 1.47 0 6 65385.11 55384 109270 51405.15 0 109270 96163 96163 0.00%

Action Details: Ascendance Damage Dre

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 85 0.2% 3.7 90.41sec 6828 6198 Direct 3.7 6828 0 6828 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.1019 0.0000 25492.01 36418.09 30.00% 6197.91 6197.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.73 3 4 6828.25 4017 13843 6843.96 5319 9128 25492 36418 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [G]:3.73
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 7705 14.9% 25.9 11.64sec 89351 75837 Direct 25.8 74466 148867 89386 20.1% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.86 25.85 0.00 0.00 0.00 1.1782 0.0000 2310518.96 2310518.96 0.00% 75836.77 75836.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.95% 20.67 9 30 74466.43 47792 143342 74471.78 60821 90998 1538840 1538840 0.00%
crit 20.05% 5.18 0 13 148867.49 95584 286684 148152.73 0 249494 771679 771679 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.97

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:1.21
  • if_expr:buff.maelstrom_weapon.stack>=5&charges=max_charges
    single
    [M]:24.65
  • if_expr:buff.maelstrom_weapon.stack>=5&(buff.feral_spirit.up|!talent.elemental_spirits.enabled)
Flame Shock 1472 2.8% 24.7 11.72sec 17859 35024 Direct 24.7 2925 5853 3530 20.7% 0.0%
Periodic 171.1 1720 3439 2071 20.4% 0.0% 89.1%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.74 24.74 171.13 171.13 21.07 0.5099 1.5612 441754.53 441754.53 0.00% 1579.01 35023.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.33% 19.62 7 34 2925.03 2487 4906 2924.60 2616 3422 57394 57394 0.00%
crit 20.67% 5.11 0 15 5852.96 4973 9812 5823.11 0 8137 29931 29931 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.57% 136.16 72 185 1719.90 1 2919 1719.19 1528 1914 234186 234186 0.00%
crit 20.43% 34.96 14 68 3439.31 2 5837 3437.72 2825 4065 120244 120244 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:1.02
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Fire damage and knocking them into the air.]

Action Priority List

    single
    [Q]:3.67
  • if_expr:!ticking
    single
    [Y]:7.08
Flametongue Weapon 0 (1560) 0.0% (3.0%) 1.0 0.00sec 467535 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1560 3.0% 1101.3 0.69sec 425 0 Direct 1101.3 365 729 425 16.5% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1101.33 1101.33 0.00 0.00 0.00 0.0000 0.0000 467534.95 467534.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.52% 919.82 644 1229 364.51 304 597 364.57 339 403 335278 335278 0.00%
crit 16.48% 181.51 110 269 728.64 607 1193 728.79 669 821 132257 132257 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.23

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }
Forgestorm Ignited (_damage) 1125 2.2% 28.8 7.64sec 11728 0 Direct 28.8 10072 20144 11728 16.4% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.79 28.79 0.00 0.00 0.00 0.0000 0.0000 337638.03 337638.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.55% 24.05 2 70 10072.03 10072 10072 10072.03 10072 10072 242271 242271 0.00%
crit 16.45% 4.73 0 17 20144.06 20144 20144 19698.15 0 20144 95367 95367 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 838 1.6% 12.9 20.97sec 19529 16495 Direct 12.9 16741 33442 19529 16.7% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.89 12.89 0.00 0.00 0.00 1.1840 0.0000 251635.06 251635.06 0.00% 16495.25 16495.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.31% 10.73 1 24 16741.47 8034 31701 16819.15 11814 22869 179709 179709 0.00%
crit 16.69% 2.15 0 10 33442.43 16068 62676 29706.97 0 59094 71926 71926 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [W]:12.88
Ice Strike 1221 2.4% 16.7 17.91sec 21883 18732 Direct 16.7 18736 37549 21884 16.7% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.73 16.73 0.00 0.00 0.00 1.1682 0.0000 366025.06 366025.06 0.00% 18732.09 18732.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.27% 13.93 6 24 18735.50 15744 31063 18730.70 16472 22358 260940 260940 0.00%
crit 16.73% 2.80 0 10 37549.38 31489 61415 35617.92 0 61415 105086 105086 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [O]:1.51
  • if_expr:buff.doom_winds.up
    single
    [S]:15.22
Lava Lash 1056 2.0% 14.0 20.71sec 22651 19173 Direct 14.0 19451 38931 22651 16.4% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.99 13.99 0.00 0.00 0.00 1.1814 0.0000 316873.06 316873.06 0.00% 19173.05 19173.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.57% 11.69 3 21 19450.81 16581 32714 19443.71 16712 22980 227404 227404 0.00%
crit 16.43% 2.30 0 9 38930.91 33162 65428 35513.14 0 61114 89469 89469 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [R]:3.26
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [T]:10.73
Lightning Bolt 6212 12.0% 29.2 9.90sec 63699 54298 Direct 29.2 52790 105599 63700 20.7% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.24 29.24 0.00 0.00 0.00 1.1731 0.0000 1862786.45 1862786.45 0.00% 54297.56 54297.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.34% 23.20 10 40 52790.46 36272 111320 52787.01 44258 65370 1224849 1224849 0.00%
crit 20.66% 6.04 0 16 105599.42 72543 222639 105226.73 0 185352 637937 637937 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [N]:29.24
  • if_expr:((buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
main_hand 1493 2.9% 163.9 2.13sec 2731 1616 Direct 163.9 2728 5458 2731 16.5% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 163.93 163.93 0.00 0.00 0.00 1.6896 0.0000 447645.90 639510.45 30.00% 1616.12 1616.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.19% 110.14 67 157 2727.91 2336 4357 2727.97 2519 3086 300451 429227 30.00%
crit 16.45% 26.97 9 52 5458.25 4671 8714 5457.87 4837 6362 147195 210283 30.00%
miss 16.36% 26.83 10 48 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 767 1.5% 168.3 2.07sec 1367 807 Direct 168.3 1367 2733 1367 16.5% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 168.30 168.30 0.00 0.00 0.00 1.6933 0.0000 230009.91 328593.96 30.00% 807.09 807.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 67.10% 112.94 68 166 1366.58 1168 2178 1366.57 1260 1512 154336 220486 30.00%
crit 16.45% 27.69 7 53 2733.13 2336 4357 2733.44 2396 3228 75674 108108 30.00%
miss 16.44% 27.68 10 53 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (8760) 0.0% (16.9%) 97.2 3.08sec 27011 23151

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.18 0.00 0.00 0.00 0.00 1.1668 0.0000 0.00 0.00 0.00% 23150.50 23150.50

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:97.18
  • if_expr:buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|((talent.elemental_assault.enabled&talent.stormflurry.enabled)&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack)
    Stormstrike (_mh) 4775 (5840) 9.2% (11.3%) 129.5 3.08sec 13513 0 Direct 129.5 (191.1) 9482 18987 11048 16.5% (11.2%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.50 129.50 0.00 0.00 0.00 0.0000 0.0000 1430763.16 2043999.49 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.52% 108.16 62 168 9482.02 2872 25026 9495.75 8080 11388 1025566 1465131 30.00%
crit 16.48% 21.34 6 42 18986.77 5744 50052 19025.14 13672 27408 405198 578868 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 1066 2.1% 61.6 5.45sec 5180 0 Direct 61.6 5180 0 5180 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.63 61.63 0.00 0.00 0.00 0.0000 0.0000 319211.81 319211.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.63 24 107 5179.64 1261 21976 5192.37 4087 6867 319212 319212 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2387 (2920) 4.6% (5.6%) 129.5 3.08sec 6756 0 Direct 129.5 (191.1) 4742 9481 5523 16.5% (11.2%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.50 129.50 0.00 0.00 0.00 0.0000 0.0000 715227.80 1021780.05 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.52% 108.16 60 168 4742.25 1436 12513 4749.37 4023 5625 512937 732785 30.00%
crit 16.48% 21.34 5 44 9480.82 2872 25026 9493.56 6171 12882 202291 288995 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 533 1.0% 61.6 5.45sec 2591 0 Direct 61.6 2591 0 2591 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.63 61.63 0.00 0.00 0.00 0.0000 0.0000 159670.79 159670.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.63 24 107 2590.90 630 10987 2597.52 1991 3446 159671 159671 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 944 1.8% 5.7 54.33sec 49716 42460 Direct 5.7 42700 85398 49717 16.4% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.69 5.69 0.00 0.00 0.00 1.1709 0.0000 282870.66 282870.66 0.00% 42460.32 42460.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.56% 4.75 1 8 42699.57 27990 88034 42714.76 28491 61143 203008 203008 0.00%
crit 16.44% 0.94 0 5 85398.33 55980 147662 54151.37 0 147662 79862 79862 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [P]:0.69
  • if_expr:buff.doom_winds.up&raid_event.adds.in>=40
    single
    [V]:5.00
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (7583) 0.0% (14.6%) 1.0 0.00sec 2269708 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 7583 14.6% 403.9 2.49sec 5619 0 Direct 403.9 4823 9658 5619 16.5% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 403.93 403.93 0.00 0.00 0.00 0.0000 0.0000 2269708.39 3242523.23 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.54% 337.43 195 474 4823.21 2003 12651 4822.66 4127 5652 1627490 2325045 30.00%
crit 16.46% 66.50 32 120 9657.70 4005 25013 9656.41 7904 12003 642218 917478 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}
Windlash 482 0.9% 31.1 10.01sec 4657 3498 Direct 31.1 3870 7744 4657 20.3% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 31.06 31.06 0.00 0.00 0.00 1.3314 0.0000 144627.87 144627.87 0.00% 3497.82 3497.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.68% 24.75 5 59 3869.53 3337 6224 3866.19 3337 4697 95759 95759 0.00%
crit 20.32% 6.31 0 17 7744.39 6673 12309 7722.31 0 11160 48869 48869 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 297 0.6% 38.3 8.14sec 2328 1644 Direct 38.3 1934 3867 2328 20.4% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.28 38.28 0.00 0.00 0.00 1.4159 0.0000 89129.66 89129.66 0.00% 1644.37 1644.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.59% 30.47 8 60 1933.60 1668 3112 1932.10 1668 2323 58910 58910 0.00%
crit 20.41% 7.81 0 21 3866.97 3337 6154 3861.39 0 5413 30220 30220 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (5922) 0.0% (11.4%) 20.6 12.65sec 86044 73222

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.64 0.00 0.00 0.00 0.00 1.1752 0.0000 0.00 0.00 0.00% 73222.35 73222.35

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [J]:20.64
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1&(talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|(talent.elemental_assault.enabled&talent.stormflurry.enabled)|ti_lightning_bolt)
    single
    [U]:0.00
    Windstrike (_mh) 1453 (1725) 2.8% (3.3%) 27.5 12.65sec 18821 0 Direct 27.5 (37.2) 13640 27289 15869 16.3% (12.0%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.47 27.46 0.00 0.00 0.00 0.0000 0.0000 435755.17 435755.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.67% 22.98 5 57 13640.43 4103 35343 13692.71 9293 19459 313394 313394 0.00%
crit 16.33% 4.48 0 14 27288.93 8205 68099 26909.00 0 51604 122361 122361 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 271 0.5% 9.8 25.30sec 8308 0 Direct 9.8 8308 0 8308 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.79 9.79 0.00 0.00 0.00 0.0000 0.0000 81331.01 81331.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 9.79 0 26 8307.69 2942 31080 8272.75 0 16444 81331 81331 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 728 (864) 1.4% (1.7%) 27.5 12.65sec 9432 0 Direct 27.5 (37.2) 6821 13637 7949 16.6% (12.2%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.47 27.46 0.00 0.00 0.00 0.0000 0.0000 218290.45 218290.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.44% 22.91 5 54 6820.98 2051 17062 6846.56 4720 10048 156284 156284 0.00%
crit 16.56% 4.55 0 15 13636.69 4103 35343 13478.28 0 26275 62006 62006 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 136 0.3% 9.8 25.30sec 4172 0 Direct 9.8 4172 0 4172 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.79 9.79 0.00 0.00 0.00 0.0000 0.0000 40843.52 40843.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 9.79 0 26 4171.87 1470 16131 4153.01 0 8812 40844 40844 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3333 6.4% 20.6 12.65sec 48431 0 Direct 20.6 40299 80370 48430 20.3% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.64 20.64 0.00 0.00 0.00 0.0000 0.0000 999421.93 999421.93 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.71% 16.45 3 37 40298.71 20151 71563 40234.96 30433 51427 662855 662855 0.00%
crit 20.29% 4.19 0 15 80369.77 40302 143125 78917.34 0 123153 336567 336567 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 437 / 90
melee 437 0.2% 39.0 2.10sec 687 445 Direct 39.0 590 1180 687 16.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.02 39.02 0.00 0.00 0.00 1.5455 0.0000 26826.68 38324.81 30.00% 444.78 444.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.51% 32.59 4 62 590.09 520 987 589.32 520 749 19230 27472 30.00%
crit 16.49% 6.44 0 20 1180.42 1040 1975 1177.10 0 1614 7597 10853 29.97%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4196 / 3141
melee 4196 6.1% 393.2 1.52sec 2393 2073 Direct 393.2 2055 4110 2393 16.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 393.21 393.21 0.00 0.00 0.00 1.1545 0.0000 941106.52 1344472.16 30.00% 2073.07 2073.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.52% 328.41 210 468 2054.58 1738 3299 2054.90 1892 2293 674730 963925 30.00%
crit 16.48% 64.81 31 111 4110.30 3477 6599 4110.95 3680 4636 266376 380547 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Storm
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Storm
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 308.59sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.09 0.00 0.00 0.00 0.00 1.0473 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [X]:1.09
Feral Spirit 15.9 19.62sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.90 0.00 0.00 0.00 0.00 1.1655 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:15.90
Phial of Tepid Versatility 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371172
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Storm
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Storm
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 307.46sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.48
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 7.8 0.0 36.2sec 36.2sec 6.0sec 15.60% 88.95% 0.0 (0.0) 7.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 135.4s
  • trigger_min/max:6.0s / 135.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.0s

Stack Uptimes

  • ascendance_1:15.60%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.8sec 12.73% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 163.7s
  • trigger_pct:100.00%
  • duration_min/max:17.4s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.41%
  • crumbling_power_4:0.72%
  • crumbling_power_5:0.73%
  • crumbling_power_6:0.73%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.70%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.68%
  • crumbling_power_18:0.75%
  • crumbling_power_19:1.20%
  • crumbling_power_20:0.07%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4sec 90.4sec 7.9sec 9.88% 11.12% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.5s
  • trigger_min/max:90.0s / 92.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 15.9 0.0 23.2sec 19.4sec 18.5sec 74.84% 100.00% 0.0 (0.0) 11.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.6s / 101.4s
  • trigger_min/max:4.6s / 46.4s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 90.4s

Stack Uptimes

  • earthen_weapon_2:71.97%
  • earthen_weapon_4:2.87%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 8.6 0.0 33.8sec 33.8sec 9.8sec 28.24% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 268.3s
  • trigger_min/max:10.0s / 268.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_critical_strike_1:28.24%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 8.6 0.0 33.6sec 33.6sec 9.8sec 28.32% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 240.3s
  • trigger_min/max:10.0s / 240.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_haste_1:28.32%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 8.6 0.0 33.7sec 33.7sec 9.8sec 28.26% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 229.7s
  • trigger_min/max:10.0s / 229.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_mastery_1:28.26%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.4sec 307.4sec 27.4sec 13.27% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.4s
  • trigger_min/max:300.0s / 329.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.27%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 12.1 3.8 25.7sec 19.6sec 18.6sec 74.84% 0.00% 64.8 (64.8) 11.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 101.4s
  • trigger_min/max:4.7s / 46.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 90.4s

Stack Uptimes

  • feral_spirit_1:74.84%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 46.2 357.0 6.5sec 0.7sec 5.5sec 84.01% 90.20% 357.0 (840.2) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 60.7s
  • trigger_min/max:0.0s / 15.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 59.6s

Stack Uptimes

  • flurry_1:20.33%
  • flurry_2:34.51%
  • flurry_3:29.18%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.4 117.3 17.7sec 2.2sec 14.6sec 84.75% 100.00% 54.3 (54.3) 16.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 51.1s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:14.83%
  • forceful_winds_2:14.07%
  • forceful_winds_3:12.62%
  • forceful_winds_4:10.76%
  • forceful_winds_5:32.48%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=20}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.5sec 46.4sec 13.0sec 19.49% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 212.9s
  • trigger_min/max:0.2s / 212.9s
  • trigger_pct:98.78%
  • duration_min/max:0.0s / 55.8s

Stack Uptimes

  • forgestorm_ignited_1:19.49%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 16.1 0.6 18.7sec 17.9sec 7.8sec 41.62% 79.63% 0.6 (0.6) 5.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.4s / 110.4s
  • trigger_min/max:8.4s / 110.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.3s

Stack Uptimes

  • ice_strike_1:41.62%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 22.4 27.2 13.3sec 6.0sec 8.9sec 66.42% 100.00% 27.2 (27.2) 21.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 75.5s
  • trigger_min/max:0.8s / 32.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.9s

Stack Uptimes

  • legacy_of_the_frost_witch_1:66.42%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 63.2 416.6 4.8sec 0.6sec 4.1sec 85.68% 100.00% 65.0 (71.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 29.9s
  • trigger_min/max:0.0s / 7.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.0s

Stack Uptimes

  • maelstrom_weapon_1:9.25%
  • maelstrom_weapon_2:11.13%
  • maelstrom_weapon_3:12.56%
  • maelstrom_weapon_4:12.81%
  • maelstrom_weapon_5:8.51%
  • maelstrom_weapon_6:6.63%
  • maelstrom_weapon_7:5.01%
  • maelstrom_weapon_8:4.18%
  • maelstrom_weapon_9:3.35%
  • maelstrom_weapon_10:12.25%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.4sec 45.9sec 16.5sec 23.50% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 243.1s
  • trigger_min/max:0.0s / 225.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.8s

Stack Uptimes

  • sophic_devotion_1:23.50%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.5sec 45.6sec 32.3sec 38.29% 0.00% 25.9 (25.9) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 286.1s
  • trigger_min/max:0.0s / 213.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 187.0s

Stack Uptimes

  • spiraling_winds_1:2.34%
  • spiraling_winds_2:2.31%
  • spiraling_winds_3:2.30%
  • spiraling_winds_4:2.28%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.23%
  • spiraling_winds_8:2.22%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.89%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 7.8 0.0 36.2sec 36.2sec 6.0sec 15.60% 100.00% 39.1 (39.1) 7.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:6.0s / 135.4s
  • trigger_min/max:6.0s / 135.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.0s

Stack Uptimes

  • static_accumulation_1:15.60%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411={$s2=10}% chance to refund Maelstrom Weapon stacks spent on Lightning Bolt or Chain Lightning. While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 60.3 18.0 4.9sec 3.8sec 1.1sec 22.51% 50.85% 18.0 (18.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 72.7s
  • trigger_min/max:0.0s / 72.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s

Stack Uptimes

  • stormbringer_1:22.51%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Tepid Versatility

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_phial_of_tepid_versatility
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Phial of Tepid Versatility

Stat Details

  • stat:versatility_rating
  • amount:745.00

Spelldata

  • id:371172
  • name:Phial of Tepid Versatility
  • tooltip:Versatility increased by {$=}w1.
  • description:Increases your Versatility by {$s1=315}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Storm
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.8 36.0 66.0 17.8s 15.0s 57.9s
Windfury-ForcefulWinds: 2 51.3 36.0 69.0 18.0s 0.1s 63.4s
Windfury-ForcefulWinds: 3 49.7 30.0 72.0 18.6s 0.5s 91.3s
Windfury-ForcefulWinds: 4 46.4 24.0 69.0 19.9s 1.1s 101.6s
Windfury-ForcefulWinds: 5 204.6 93.0 336.0 4.9s 0.0s 90.8s
windfury_totem_extra_attack_mh 27.8 9.0 49.0 10.5s 1.3s 128.9s
windfury_totem_extra_attack_oh 29.6 11.0 57.0 9.9s 0.1s 113.8s
Elemental Blast: Critical Strike 8.6 1.0 18.0 33.8s 10.0s 268.3s
Elemental Blast: Haste 8.6 1.0 17.0 33.6s 10.0s 240.3s
Elemental Blast: Mastery 8.6 1.0 17.0 33.7s 10.0s 229.7s
Windfury: Unruly Winds 134.6 81.0 197.0 2.5s 0.0s 40.0s
Maelstrom Weapon: Feral Spirit 84.5 56.0 112.0 3.6s 0.0s 31.4s
Maelstrom Weapon: Elemental Assault 117.8 78.0 163.0 2.5s 0.8s 10.1s
Maelstrom Weapon: Static Accumulation 93.5 36.0 180.0 5.5s 1.0s 130.4s
Maelstrom Weapon: Static Accumulation Refund 59.9 0.0 180.0 26.3s 0.8s 254.2s
Stormflurry 39.2 12.0 83.0 9.9s 0.8s 129.2s
Legacy of the Frost Witch: Bugged Trigger 9.0 0.0 20.0 29.5s 1.7s 287.9s
Maelstrom Weapon: Windfury Attack 80.8 43.0 130.0 4.8s 0.0s 71.7s
Maelstrom Weapon: main_hand 27.4 9.0 48.0 11.1s 1.3s 144.1s
Maelstrom Weapon: Windlash 6.2 0.0 18.0 38.9s 1.3s 332.8s
Maelstrom Weapon: offhand 28.1 11.0 49.0 10.8s 1.3s 107.7s
Maelstrom Weapon: Windlash Off-Hand 7.6 0.0 21.0 32.8s 0.3s 264.0s
Maelstrom Weapon: Doom Winds 0.7 0.0 4.0 135.9s 90.0s 273.6s
Maelstrom Weapon: Lava Lash 2.8 0.0 10.0 68.6s 8.8s 326.8s
Maelstrom Weapon: Sundering 1.1 0.0 5.0 108.5s 40.0s 347.6s
Maelstrom Weapon: Windstrike 5.4 0.0 18.0 43.9s 0.8s 305.7s
Maelstrom Weapon: Windstrike Off-Hand 5.5 0.0 18.0 43.5s 0.8s 324.3s
Maelstrom Weapon: Ice Strike 3.3 0.0 12.0 64.8s 8.4s 344.8s
Maelstrom Weapon: Stormstrike 25.8 9.0 48.0 12.1s 0.8s 156.2s
Maelstrom Weapon: Stormstrike Off-Hand 25.9 4.0 52.0 12.1s 0.8s 137.8s
Flametongue: Windfury Attack 403.9 243.0 591.0 2.5s 0.0s 40.0s
Stormbringer: Windfury Attack 41.9 16.0 70.0 8.1s 0.0s 106.9s
Flametongue: main_hand 137.1 89.0 190.0 2.6s 1.3s 27.3s
Windfury: main_hand 52.5 26.0 81.0 6.2s 1.3s 84.3s
Flametongue: Windlash 31.1 9.0 63.0 10.0s 1.3s 130.9s
Windfury: Windlash 11.2 0.0 28.0 24.1s 1.3s 277.5s
Flametongue: offhand 140.6 88.0 197.0 2.6s 1.3s 26.1s
Flametongue: Windlash Off-Hand 38.3 12.0 75.0 8.1s 0.2s 129.6s
Flametongue: Lava Lash 14.0 5.0 23.0 20.7s 8.7s 135.5s
Stormbringer: Lava Lash 1.5 0.0 8.0 84.3s 9.1s 346.6s
Flametongue: Sundering 5.7 2.0 9.0 54.3s 40.0s 214.7s
Stormbringer: Sundering 0.6 0.0 4.0 117.9s 40.0s 340.0s
Windfury: Sundering 2.2 0.0 7.0 100.5s 40.0s 345.7s
Flametongue: Windstrike 27.5 7.0 67.0 12.6s 0.8s 131.8s
Stormbringer: Windstrike 2.8 0.0 12.0 59.7s 0.8s 317.6s
Windfury: Windstrike 10.1 0.0 29.0 28.0s 0.8s 293.2s
Flametongue: Windstrike Off-Hand 27.5 7.0 67.0 12.6s 0.8s 131.8s
Stormbringer: Windstrike Off-Hand 2.8 0.0 11.0 59.8s 0.8s 329.1s
Flametongue: Ice Strike 16.7 7.0 25.0 17.9s 8.4s 110.4s
Stormbringer: Ice Strike 1.7 0.0 7.0 83.7s 8.4s 331.8s
Windfury: Ice Strike 6.1 0.0 16.0 46.4s 8.4s 306.1s
Flametongue: Stormstrike 129.5 78.0 193.0 3.1s 0.8s 22.4s
Stormbringer: Stormstrike 13.5 2.0 32.0 21.4s 0.8s 254.6s
Windfury: Stormstrike 52.5 24.0 84.0 6.6s 0.8s 87.0s
Flametongue: Stormstrike Off-Hand 129.5 78.0 193.0 3.1s 0.8s 22.4s
Stormbringer: Stormstrike Off-Hand 13.4 1.0 31.0 21.5s 0.8s 267.2s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 26.20% 19.31% 33.30% 0.7s 0.0s 11.9s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7420.0001.48911.8204.55721.352
Doom Winds0.5290.0002.4551.9780.8645.992
Lava Lash9.4890.000123.173137.74759.641242.214
Elemental Blast0.1740.00017.0774.4892.59421.414
Sundering14.5540.000174.71787.1367.914210.161
Windstrike
Stormstrike
1.0220.0003.963120.70571.174178.607
Ice Strike6.2910.00099.893108.14426.861215.969
Frost Shock17.2010.000242.421239.532142.947328.319
Flame Shock21.6630.000179.690249.953172.547329.944
Earth Elemental37.6810.000311.02243.1158.514311.022

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack68.212.613.51%17.57%
main_hand24.52.94.86%3.97%
Windlash5.01.11.00%1.59%
offhand24.93.24.93%4.51%
Windlash Off-Hand6.41.21.27%1.71%
Feral Spirit74.69.914.78%13.79%
Doom Winds0.70.10.13%0.10%
Lightning Bolt41.50.08.23%0.00%
Lava Lash2.80.00.55%0.00%
Sundering1.10.00.22%0.00%
Windstrike19.41.33.84%1.77%
Windstrike (_mh)4.90.50.98%0.70%
Windstrike Off-Hand5.00.50.99%0.73%
Ice Strike3.30.00.66%0.00%
Stormstrike81.815.416.21%21.41%
Stormstrike (_mh)22.33.54.43%4.87%
Stormstrike Off-Hand22.23.74.40%5.12%
Lightning Bolt (_ti)18.40.03.64%0.00%
Ascendance (_dre)77.615.915.37%22.15%
Overflow Stacks0.071.80.00%12.46%
Actual Stacks504.70.087.54%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt207.041.37%
Elemental Blast201.540.27%
Lightning Bolt (_ti)91.918.36%
Total Spent500.5100.00%

Deeply Rooted Elements Proc Details

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Storm
mana_regenMana644.15244650.42100.00%379.80234743.2848.97%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 815.50 818.15 234744.2 49205.3 41945.6 50000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement_Storm
BloodlustMana 1.001000.000.41%1000.001000.000.00
Elemental BlastMana 25.8635555.8814.49%1375.001374.9964.98
Flame ShockMana 10.758059.633.28%750.00325.8354.81
Frost ShockMana 12.886442.412.62%500.00499.9939.06
Ice StrikeMana 16.7327597.7411.24%1650.001649.9713.26
Lava LashMana 13.995595.632.28%400.00399.9956.63
Lightning BoltMana 29.2414621.585.96%500.00499.99127.40
StormstrikeMana 129.50129503.4052.76%1000.001332.6520.27
SunderingMana 5.6917068.926.95%3000.002999.9716.57

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Storm Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Storm Damage Per Second
Count 7499
Mean 51773.90
Minimum 40775.62
Maximum 63623.10
Spread ( max - min ) 22847.48
Range [ ( max - min ) / 2 * 100% ] 22.06%
Standard Deviation 2947.1255
5th Percentile 47065.13
95th Percentile 56714.92
( 95th Percentile - 5th Percentile ) 9649.79
Mean Distribution
Standard Deviation 34.0327
95.00% Confidence Interval ( 51707.19 - 51840.60 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 125
0.1% Error 12448
0.1 Scale Factor Error with Delta=300 74145
0.05 Scale Factor Error with Delta=300 296580
0.01 Scale Factor Error with Delta=300 7414484
Priority Target DPS
PR_Shaman_Enhancement_Storm Priority Target Damage Per Second
Count 7499
Mean 51773.90
Minimum 40775.62
Maximum 63623.10
Spread ( max - min ) 22847.48
Range [ ( max - min ) / 2 * 100% ] 22.06%
Standard Deviation 2947.1255
5th Percentile 47065.13
95th Percentile 56714.92
( 95th Percentile - 5th Percentile ) 9649.79
Mean Distribution
Standard Deviation 34.0327
95.00% Confidence Interval ( 51707.19 - 51840.60 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 125
0.1% Error 12448
0.1 Scale Factor Error with Delta=300 74145
0.05 Scale Factor Error with Delta=300 296580
0.01 Scale Factor Error with Delta=300 7414484
DPS(e)
PR_Shaman_Enhancement_Storm Damage Per Second (Effective)
Count 7499
Mean 51773.90
Minimum 40775.62
Maximum 63623.10
Spread ( max - min ) 22847.48
Range [ ( max - min ) / 2 * 100% ] 22.06%
Damage
PR_Shaman_Enhancement_Storm Damage
Count 7499
Mean 14550330.89
Minimum 9825118.88
Maximum 19998581.30
Spread ( max - min ) 10173462.42
Range [ ( max - min ) / 2 * 100% ] 34.96%
DTPS
PR_Shaman_Enhancement_Storm Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Storm Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Storm Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Storm Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Storm Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Storm Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_StormTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Storm Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.48 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 invoke_external_buff,name=power_infusion,if=(talent.ascendance.enabled&talent.thorims_invocation.enabled&buff.ascendance.up)|(!talent.thorims_invocation.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.thorims_invocation.enabled&!talent.feral_spirit.enabled)|fight_remains<=20
F 15.90 feral_spirit
0.00 ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1))
G 3.73 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
I 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
0.00 primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>42|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking&talent.lashing_flames.enabled
0.00 elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
0.00 sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=40
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
J 20.64 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1&(talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|(talent.elemental_assault.enabled&talent.stormflurry.enabled)|ti_lightning_bolt)
K 97.18 stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|((talent.elemental_assault.enabled&talent.stormflurry.enabled)&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack)
0.00 lava_lash,if=buff.hot_hand.up
0.00 windfury_totem,if=!buff.windfury_totem.up
L 1.21 elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
M 24.65 elemental_blast,if=buff.maelstrom_weapon.stack>=5&(buff.feral_spirit.up|!talent.elemental_spirits.enabled)
0.00 lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
N 29.24 lightning_bolt,if=((buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
O 1.51 ice_strike,if=buff.doom_winds.up
P 0.69 sundering,if=buff.doom_winds.up&raid_event.adds.in>=40
0.00 crash_lightning,if=buff.doom_winds.up|(talent.alpha_wolf.enabled&buff.feral_spirit.up&((action.crash_lightning.last_used<action.feral_spirit.last_used&action.chain_lightning.last_used<action.feral_spirit.last_used)|(time-action.chain_lightning.last_used>8&time-action.crash_lightning.last_used>8)))
0.00 primordial_wave,if=raid_event.adds.in>42|raid_event.adds.in<6
Q 3.67 flame_shock,if=!ticking
R 3.26 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
S 15.22 ice_strike
0.00 frost_shock,if=buff.hailstorm.up
T 10.73 lava_lash
U 0.00 windstrike
0.00 stormstrike
V 5.00 sundering,if=raid_event.adds.in>=40
0.00 bag_of_tricks
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
0.00 lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
W 12.88 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
X 1.09 earth_elemental
Y 7.08 flame_shock
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ACDEFGBKLOKKKMKKKNKQSTMKVWXYKWNKFNSTKWYMKWYSNKJMJFJKNKSTWMKNKKKKKNKFKKMKKJNJJMKKFNKKKNKKMKGONKKFKKMKQSNNKTVMWKKJFJJNKSTMWKYWMKSTKKKFNKMKSTKNKVWYMKKNKFJNJNSTKMKWYEDNGKFKKMKKNKKNKRSMVKNFKNKKMKSTWNKYWKKMKSFTWKMKJJJJNKKMSFKRNKMKKNSVWKKJFJJMGKKKKKKFMKQSTWKKMKKWNSK

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Storm 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Storm 50000.0/50000: 100% mana
Pre precombat 2 augmentation PR_Shaman_Enhancement_Storm 50000.0/50000: 100% mana
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Storm 50000.0/50000: 100% mana
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Storm 50000.0/50000: 100% mana
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 default C auto_attack Fluffy_Pillow 49000.0/50000: 98% mana bloodlust
0:00.000 default D use_items Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(2)
0:00.000 default E berserking Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(2), crumbling_power(20)
0:00.000 default F feral_spirit Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, berserking, flurry(2), crumbling_power(20)
0:00.866 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), crumbling_power(19)
0:01.733 default B potion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), doom_winds, crumbling_power(19)
0:01.733 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), doom_winds, crumbling_power(19), elemental_potion_of_ultimate_power
0:02.600 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), doom_winds, crumbling_power(18), elemental_potion_of_ultimate_power
0:03.467 single O ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, doom_winds, crumbling_power(17), elemental_potion_of_ultimate_power
0:04.333 single K stormstrike Fluffy_Pillow 49735.6/50000: 99% mana bloodlust, berserking, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(2), doom_winds, ice_strike, crumbling_power(16), elemental_potion_of_ultimate_power
0:05.199 single K stormstrike Fluffy_Pillow 49121.2/50000: 98% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, ice_strike, crumbling_power(15), elemental_potion_of_ultimate_power
0:06.066 single K stormstrike Fluffy_Pillow 49508.4/50000: 99% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, ice_strike, crumbling_power(14), elemental_potion_of_ultimate_power
0:06.932 single M elemental_blast Fluffy_Pillow 49894.0/50000: 100% mana bloodlust, berserking, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), doom_winds, ice_strike, crumbling_power(13), elemental_potion_of_ultimate_power
0:07.798 single K stormstrike Fluffy_Pillow 49904.6/50000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), elemental_potion_of_ultimate_power
0:08.639 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds, elemental_potion_of_ultimate_power
0:09.482 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds, elemental_potion_of_ultimate_power
0:10.323 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(2), elemental_potion_of_ultimate_power
0:11.165 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(2), elemental_potion_of_ultimate_power
0:12.007 single Q flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(3), elemental_potion_of_ultimate_power
0:12.933 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(3), elemental_potion_of_ultimate_power
0:13.859 single T lava_lash Fluffy_Pillow 49831.6/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(4), elemental_potion_of_ultimate_power
0:14.784 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(4), elemental_potion_of_ultimate_power
0:15.710 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(5), maelstrom_weapon, ice_strike, crumbling_power(3), spiraling_winds(5), elemental_potion_of_ultimate_power
0:16.634 single V sundering Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), ice_strike, crumbling_power(2), spiraling_winds(5), elemental_potion_of_ultimate_power
0:17.560 single W frost_shock Fluffy_Pillow 48481.6/50000: 97% mana bloodlust, flurry(3), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(2), ice_strike, crumbling_power, spiraling_winds(6), elemental_potion_of_ultimate_power
0:18.515 single X earth_elemental Fluffy_Pillow 49509.6/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(2), spiraling_winds(6), elemental_potion_of_ultimate_power
0:19.468 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(2), spiraling_winds(7), elemental_potion_of_ultimate_power
0:20.420 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(2), spiraling_winds(7), elemental_potion_of_ultimate_power
0:21.375 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(3), spiraling_winds(8), elemental_potion_of_ultimate_power
0:22.328 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(5), spiraling_winds(8), forgestorm_ignited, elemental_potion_of_ultimate_power
0:23.282 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_potion_of_ultimate_power
0:24.236 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_potion_of_ultimate_power
0:25.190 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_potion_of_ultimate_power
0:26.143 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_potion_of_ultimate_power
0:27.098 single T lava_lash Fluffy_Pillow 49878.0/50000: 100% mana bloodlust, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_potion_of_ultimate_power
0:28.052 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_potion_of_ultimate_power
0:29.006 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_potion_of_ultimate_power
0:29.960 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(10), forgestorm_ignited, elemental_potion_of_ultimate_power
0:30.914 Waiting     0.809 sec 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, elemental_potion_of_ultimate_power
0:31.723 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(10), forgestorm_ignited, elemental_potion_of_ultimate_power
0:32.675 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited
0:33.627 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10)
0:34.582 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10)
0:35.536 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10)
0:36.589 single N lightning_bolt Fluffy_Pillow 49876.4/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
0:37.542 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
0:38.496 single J windstrike Fluffy_Pillow 48526.4/50000: 97% mana bloodlust, ascendance, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
0:39.448 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
0:40.403 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(2), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
0:41.639 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
0:42.878 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
0:44.117 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
0:45.356 single N lightning_bolt Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
0:46.593 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch
0:47.832 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch
0:49.072 single T lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch
0:50.310 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch
0:51.549 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(5)
0:52.789 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon
0:53.992 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5)
0:55.193 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch
0:56.395 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch
0:57.598 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch
0:58.802 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch
1:00.005 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(9)
1:01.208 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(10)
1:02.410 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon, legacy_of_the_frost_witch
1:03.650 default F feral_spirit Fluffy_Pillow 49984.0/50000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch
1:04.887 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch
1:06.126 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch
1:07.366 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8)
1:08.604 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch
1:09.842 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch
1:11.081 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch
1:12.319 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch
1:13.558 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch
1:14.797 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch
1:16.036 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch
1:17.273 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch
1:18.474 single K stormstrike Fluffy_Pillow 48921.6/50000: 98% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch
1:19.676 default F feral_spirit Fluffy_Pillow 49844.8/50000: 100% mana elemental_blast_haste, forceful_winds(4), maelstrom_weapon(8), legacy_of_the_frost_witch
1:20.881 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch
1:22.082 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch
1:23.285 single K stormstrike Fluffy_Pillow 49924.8/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch
1:24.486 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch
1:25.690 single N lightning_bolt Fluffy_Pillow 49926.4/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, spiraling_winds
1:26.892 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds
1:28.130 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(2)
1:29.369 single M elemental_blast Fluffy_Pillow 48982.4/50000: 98% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(2)
1:30.607 single K stormstrike Fluffy_Pillow 49588.2/50000: 99% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(3)
1:31.810 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(4)
1:33.012 single O ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch, spiraling_winds(4)
1:34.214 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(7), doom_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5)
1:35.418 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(4), maelstrom_weapon, doom_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5)
1:36.620 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(5), doom_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(6)
1:37.824 default F feral_spirit Fluffy_Pillow 49926.4/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(7)
1:39.027 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(7)
1:40.230 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(8)
1:41.470 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(8)
1:42.710 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9)
1:43.913 single Q flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
1:45.117 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10)
1:46.319 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
1:47.522 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), ice_strike, spiraling_winds(10)
1:48.723 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
1:49.925 single T lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
1:51.129 single V sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
1:52.331 single M elemental_blast Fluffy_Pillow 48923.2/50000: 98% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
1:53.571 single W frost_shock Fluffy_Pillow 49532.2/50000: 99% mana flurry, elemental_blast_mastery, forceful_winds(2), maelstrom_weapon, ice_strike, spiraling_winds(10)
1:54.808 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), stormbringer, maelstrom_weapon(2), spiraling_winds(10)
1:56.046 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), stormbringer, maelstrom_weapon(3), spiraling_winds(10)
1:57.284 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(6), static_accumulation, spiraling_winds(10)
1:58.523 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10)
1:59.761 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10)
2:01.001 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10)
2:02.240 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10)
2:03.478 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10)
2:04.715 single S ice_strike Fluffy_Pillow 49979.2/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10)
2:05.954 single T lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
2:07.191 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
2:08.430 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds(10)
2:09.631 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, spiraling_winds(10)
2:10.834 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(10)
2:12.035 Waiting     0.946 sec 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10)
2:12.981 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10)
2:14.423 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds, maelstrom_weapon(5), spiraling_winds(10)
2:15.803 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, forceful_winds, legacy_of_the_frost_witch
2:17.006 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds, maelstrom_weapon(2), legacy_of_the_frost_witch
2:18.208 single T lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch
2:19.446 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch
2:20.683 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(6), ice_strike
2:21.923 single K stormstrike Fluffy_Pillow 49984.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), stormbringer, maelstrom_weapon(8), ice_strike
2:23.161 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(9), ice_strike
2:24.399 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike
2:25.639 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch
2:26.877 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
2:28.116 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
2:29.318 single S ice_strike Fluffy_Pillow 49923.2/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited
2:30.521 single T lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
2:31.725 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited
2:32.928 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), ice_strike, sophic_devotion, forgestorm_ignited
2:34.130 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited
2:35.334 single V sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion, forgestorm_ignited
2:36.536 single W frost_shock Fluffy_Pillow 48923.2/50000: 98% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, forgestorm_ignited
2:37.736 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, forgestorm_ignited
2:38.976 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(6), spiraling_winds(3), sophic_devotion
2:40.214 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(4), maelstrom_weapon, spiraling_winds(4), sophic_devotion
2:41.418 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(4), stormbringer, maelstrom_weapon(2), spiraling_winds(4), sophic_devotion
2:42.620 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(4), maelstrom_weapon(5), spiraling_winds(5), sophic_devotion
2:43.824 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion
2:45.027 default F feral_spirit Fluffy_Pillow 49924.8/50000: 100% mana ascendance, elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion
2:46.229 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(7)
2:47.432 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(7)
2:48.636 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(8)
2:49.839 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(8)
2:51.077 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(9)
2:52.313 single T lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
2:53.551 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10)
2:54.789 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(10)
2:56.029 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
2:57.230 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
2:58.432 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion
2:59.637 Waiting     0.204 sec 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion
2:59.841 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion
3:00.000 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion
3:00.000 Waiting     0.074 sec 50000.0/50000: 100% mana berserking, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), crumbling_power(20), sophic_devotion
3:00.074 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_haste, maelstrom_weapon(5), crumbling_power(20), sophic_devotion
3:01.168 Waiting     0.411 sec 50000.0/50000: 100% mana berserking, flurry, elemental_blast_haste, crumbling_power(19), sophic_devotion
3:01.579 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_haste, crumbling_power(19), sophic_devotion
3:02.904 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon, doom_winds, crumbling_power(19), sophic_devotion
3:03.997 default F feral_spirit Fluffy_Pillow 49748.8/50000: 99% mana berserking, flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(4), doom_winds, crumbling_power(18), sophic_devotion
3:05.090 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), doom_winds, crumbling_power(17), sophic_devotion
3:06.215 single K stormstrike Fluffy_Pillow 48800.0/50000: 98% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds, crumbling_power(16), sophic_devotion
3:07.341 single M elemental_blast Fluffy_Pillow 49601.6/50000: 99% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(15), sophic_devotion
3:08.466 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), doom_winds, legacy_of_the_frost_witch, crumbling_power(14), sophic_devotion
3:09.559 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch, crumbling_power(13), sophic_devotion
3:10.651 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, crumbling_power(12), sophic_devotion
3:11.744 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(11), sophic_devotion
3:12.838 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, crumbling_power(10), sophic_devotion
3:14.041 single N lightning_bolt Fluffy_Pillow 49924.8/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, crumbling_power(9), sophic_devotion
3:15.244 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power(8)
3:16.445 single R lava_lash Fluffy_Pillow 49921.6/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, crumbling_power(7)
3:17.647 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, crumbling_power(6)
3:18.886 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(5)
3:20.125 single V sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, ice_strike, sophic_devotion
3:21.363 single K stormstrike Fluffy_Pillow 48980.8/50000: 98% mana flurry(3), elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon(3), ice_strike, sophic_devotion
3:22.601 single N lightning_bolt Fluffy_Pillow 49961.6/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(6), ice_strike, sophic_devotion
3:23.839 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion
3:25.078 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, sophic_devotion
3:26.317 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion
3:27.554 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion
3:28.792 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion
3:30.031 single M elemental_blast Fluffy_Pillow 49982.4/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion
3:31.268 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion
3:32.507 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion
3:33.747 single T lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion
3:34.986 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch
3:36.224 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5)
3:37.462 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2)
3:38.702 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon
3:39.940 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(2)
3:41.177 Waiting     2.306 sec 50000.0/50000: 100% mana forceful_winds, maelstrom_weapon(2)
3:43.483 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds, maelstrom_weapon(2), sophic_devotion
3:44.871 single K stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry, forceful_winds, stormbringer, maelstrom_weapon(4), sophic_devotion
3:46.111 single M elemental_blast Fluffy_Pillow 49966.4/50000: 100% mana flurry(3), forceful_winds(2), maelstrom_weapon(6), sophic_devotion
3:47.349 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), legacy_of_the_frost_witch, sophic_devotion
3:48.587 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion
3:49.824 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion
3:51.077 single T lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion
3:52.315 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), ice_strike, sophic_devotion
3:53.554 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), sophic_devotion
3:54.793 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), sophic_devotion
3:56.030 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion
3:57.267 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, sophic_devotion
3:58.506 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch, sophic_devotion
3:59.745 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, sophic_devotion
4:00.983 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, sophic_devotion
4:02.220 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion
4:03.459 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion
4:04.697 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion
4:05.935 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion
4:07.173 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), legacy_of_the_frost_witch, sophic_devotion
4:08.375 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon, ice_strike, sophic_devotion
4:09.577 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike
4:10.780 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike
4:11.982 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike
4:13.184 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
4:14.384 single M elemental_blast Fluffy_Pillow 49920.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
4:15.802 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
4:17.005 single K stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
4:18.244 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited
4:19.482 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited
4:20.722 single V sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, forgestorm_ignited
4:21.962 single W frost_shock Fluffy_Pillow 48984.0/50000: 98% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, forgestorm_ignited
4:23.200 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), forgestorm_ignited
4:24.439 single K stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(10), forgestorm_ignited
4:25.678 single J windstrike Fluffy_Pillow 48964.8/50000: 98% mana ascendance, flurry(2), forceful_winds(5), maelstrom_weapon(10), static_accumulation
4:26.915 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, forceful_winds(5), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch
4:28.156 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch
4:29.393 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch
4:30.632 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch
4:31.871 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch
4:33.108 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch
4:34.347 single K stormstrike Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, legacy_of_the_frost_witch, sophic_devotion
4:35.585 single K stormstrike Fluffy_Pillow 49963.2/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, legacy_of_the_frost_witch, sophic_devotion
4:36.825 single K stormstrike Fluffy_Pillow 49947.2/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, sophic_devotion
4:38.064 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, sophic_devotion
4:39.303 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, sophic_devotion
4:40.541 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), sophic_devotion
4:41.779 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), sophic_devotion
4:43.018 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion
4:44.257 single Q flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion
4:45.497 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion
4:46.735 single T lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion
4:47.974 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, spiraling_winds, sophic_devotion
4:49.211 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(2), sophic_devotion
4:50.450 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(7), spiraling_winds(2)
4:51.688 single M elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), spiraling_winds(3)
4:52.925 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(4)
4:54.128 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(4)
4:55.328 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(5)
4:56.530 single N lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(5)
4:57.732 single S ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, spiraling_winds(6)
4:58.935 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, stormbringer, ice_strike, spiraling_winds(7)

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 13549 12904 9056
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 270980 258080 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 21.55% 21.55% 3663
Versatility 7.57% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +923 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +519 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +692 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +923 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +692 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +923 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +692 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +519 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +692 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +519 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +519 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +519 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +462 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +462 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Storm"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAoEhkQCKCk0SSaICQikCC

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_tepid_versatility_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/invoke_external_buff,name=power_infusion,if=(talent.ascendance.enabled&talent.thorims_invocation.enabled&buff.ascendance.up)|(!talent.thorims_invocation.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.thorims_invocation.enabled&!talent.feral_spirit.enabled)|fight_remains<=20
actions+=/feral_spirit
actions+=/ascendance,if=dot.flame_shock.ticking&((ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1))
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up|(talent.alpha_wolf.enabled&buff.feral_spirit.up&((action.crash_lightning.last_used<action.feral_spirit.last_used&action.chain_lightning.last_used<action.feral_spirit.last_used)|(time-action.chain_lightning.last_used>8&time-action.crash_lightning.last_used>8)))
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=primordial_wave,if=!dot.flame_shock.ticking&talent.lashing_flames.enabled&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking&talent.lashing_flames.enabled
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&talent.elemental_spirits.enabled&feral_spirit.active>=4
actions.single+=/sundering,if=set_bonus.tier30_2pc&raid_event.adds.in>=40
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.down&buff.ascendance.up&ti_chain_lightning&(buff.ascendance.remains>(cooldown.strike.remains+gcd))
actions.single+=/windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1&(talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|(talent.elemental_assault.enabled&talent.stormflurry.enabled)|ti_lightning_bolt)
actions.single+=/stormstrike,if=buff.doom_winds.up|talent.deeply_rooted_elements.enabled|(talent.stormblast.enabled&buff.stormbringer.up)|((talent.elemental_assault.enabled&talent.stormflurry.enabled)&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack)
actions.single+=/lava_lash,if=buff.hot_hand.up
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&charges=max_charges
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
actions.single+=/elemental_blast,if=buff.maelstrom_weapon.stack>=5&(buff.feral_spirit.up|!talent.elemental_spirits.enabled)
actions.single+=/lava_burst,if=!talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=((buff.maelstrom_weapon.stack=buff.maelstrom_weapon.max_stack)|(talent.static_accumulation.enabled&buff.maelstrom_weapon.stack>=5))&buff.primordial_wave.down
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up&raid_event.adds.in>=40
actions.single+=/crash_lightning,if=buff.doom_winds.up|(talent.alpha_wolf.enabled&buff.feral_spirit.up&((action.crash_lightning.last_used<action.feral_spirit.last_used&action.chain_lightning.last_used<action.feral_spirit.last_used)|(time-action.chain_lightning.last_used>8&time-action.crash_lightning.last_used>8)))
actions.single+=/primordial_wave,if=raid_event.adds.in>42|raid_event.adds.in<6
actions.single+=/flame_shock,if=!ticking
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/ice_strike
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/bag_of_tricks
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock&buff.maelstrom_weapon.stack<buff.maelstrom_weapon.max_stack
actions.single+=/lightning_bolt,if=talent.hailstorm.enabled&buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=9056
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 220178719
Max Event Queue: 269
Sim Seconds: 2250297
CPU Seconds: 206.5666
Physical Seconds: 103.5668
Speed Up: 10894

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.52sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 154800 516 7.65 3205 6435 38.2 38.2 26.1% 0.0% 0.0% 0.0% 6.91sec 154800 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost antimagic_shell 48707 0 0 0.00 0 0 7.4 0.0 0.0% 0.0% 0.0% 0.0% 43.21sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 143.36sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 775830 2586 38.31 3678 7361 191.5 191.5 26.4% 16.3% 0.0% 0.0% 1.83sec 1108357 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 377564 1259 37.42 1839 3680 187.1 187.1 26.4% 16.7% 0.0% 0.0% 1.83sec 539391 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost blood_draw 374606 28446 95 0.40 11341 22769 2.0 2.0 25.2% 0.0% 0.0% 0.0% 0.00sec 28446 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.53sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_tick 155166 2787994 9293 25.97 17002 33935 129.9 129.9 26.4% 0.0% 0.0% 0.0% 2.06sec 2787994 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 206046 687 0.53 61040 122596 2.8 2.7 26.5% 0.0% 0.0% 0.0% 119.28sec 206046 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay 43265 3446 11 1.31 417 833 0.6 6.5 26.5% 0.0% 0.0% 0.0% 84.69sec 3446 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 258730 862 1.20 34304 68609 6.0 6.0 25.9% 0.0% 0.0% 0.0% 48.06sec 369624 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 82.84sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 371172 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 634851 2116 19.74 5092 10164 60.8 98.7 26.4% 0.0% 0.0% 0.0% 4.92sec 634851 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 49143 664021 2213 8.84 11891 23750 44.2 44.2 26.4% 0.0% 0.0% 0.0% 4.96sec 664021 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 331832 1106 8.84 5948 11862 44.2 44.2 26.4% 0.0% 0.0% 0.0% 4.96sec 331832 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 4.1 0.0 0.0% 0.0% 0.0% 0.0% 75.05sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 1771678 5906 12.15 23078 46070 60.8 60.8 26.4% 0.0% 0.0% 0.0% 4.92sec 1771678 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 371550 1239 12.15 4837 9662 60.8 60.8 26.5% 0.0% 0.0% 0.0% 4.92sec 371550 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 397733 1326 11.18 5628 11273 55.9 55.9 26.3% 0.0% 0.0% 0.0% 5.29sec 568204 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 198817 663 11.18 2813 5640 55.9 55.9 26.3% 0.0% 0.0% 0.0% 5.29sec 284031 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1330323 4434 9.67 0 27503 48.4 48.4 100.0% 0.0% 0.0% 0.0% 6.09sec 1330323 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 665161 2217 9.67 0 13752 48.4 48.4 100.0% 0.0% 0.0% 0.0% 6.09sec 665161 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 8.2 0.0 0.0% 0.0% 0.0% 0.0% 38.19sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 304.06sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.69sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 20.39sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1481748 4939 47.61 4924 9839 238.0 238.0 26.5% 0.0% 0.0% 0.0% 1.26sec 1481748 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 60514 202 4.03 2375 4750 20.2 20.2 26.4% 0.0% 0.0% 0.0% 14.50sec 86450 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 60558 202 4.03 2375 4750 20.2 20.2 26.5% 0.0% 0.0% 0.0% 14.50sec 86513 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.2 0.0 0.0% 0.0% 0.0% 0.0% 14.46sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul auto_attack 0 214474 1309 34.91 1781 3561 95.3 95.3 26.4% 0.0% 0.0% 0.0% 2.91sec 306399 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 105870 646 19.33 1586 3176 52.8 52.8 26.5% 0.0% 0.0% 0.0% 5.33sec 151247 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 199 1 1.07 54 107 2.9 2.9 26.3% 0.0% 0.0% 0.0% 120.70sec 284 163.79sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy algethar_puzzle_box_channel 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy antimagic_shell 48707 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 44.52sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 65146 217 1.37 8237 16491 6.9 6.9 15.4% 0.0% 0.0% 0.0% 46.09sec 65146 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 175.57sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 852842 2843 30.89 4786 9572 154.5 154.5 15.4% 0.0% 0.0% 0.0% 2.34sec 1218377 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.38sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy blood_draw 374606 26945 90 0.40 11621 23205 2.0 2.0 16.0% 0.0% 0.0% 0.0% 0.00sec 26945 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy clawing_shadows 207311 1769623 5899 14.69 20880 41762 73.5 73.5 15.4% 0.0% 0.0% 0.0% 3.94sec 1769623 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 61002 203 1.39 7608 15219 7.0 7.0 15.3% 0.0% 0.0% 0.0% 46.11sec 61002 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_and_decay 43265 70624 235 18.22 672 1345 8.4 91.1 15.3% 0.0% 0.0% 0.0% 37.28sec 70624 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 1683977 5613 19.88 14688 29369 99.4 99.4 15.4% 0.0% 0.0% 0.0% 2.99sec 1683977 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 496415 1655 27.18 3653 0 0.0 135.9 0.0% 0.0% 0.0% 0.0% 0.00sec 496415 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 281506 938 1.41 34507 69013 7.1 7.1 15.7% 0.0% 0.0% 0.0% 29.36sec 402162 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 169.31sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 328158 1094 5.00 11378 22757 25.0 25.0 15.4% 0.0% 0.0% 0.0% 11.95sec 468809 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 565960 1887 20.17 4863 9729 100.9 100.9 15.4% 0.0% 0.0% 0.0% 3.65sec 565960 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 371172 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 23661 79 2.32 1765 3530 11.6 11.6 15.3% 0.0% 0.0% 0.0% 27.05sec 23661 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak_aoe 196780 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 27.05sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 172790 576 3.13 9575 19158 15.6 15.6 15.4% 0.0% 0.0% 0.0% 6.86sec 172790 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 832740 2776 3.13 46166 92320 15.6 15.6 15.4% 0.0% 0.0% 0.0% 6.86sec 832740 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.37sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 58808 196 0.73 14035 28078 3.6 3.6 15.2% 0.0% 0.0% 0.0% 91.68sec 58808 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 21.9 0.0 0.0% 0.0% 0.0% 0.0% 13.36sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 251959 840 19.90 2196 4393 11.6 99.5 15.3% 0.0% 0.0% 0.0% 27.05sec 251959 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul auto_attack 0 1357874 4526 39.08 6027 12035 195.4 195.4 15.4% 0.0% 0.0% 0.0% 1.53sec 1939870 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 100598 335 7.62 2290 4581 38.1 38.1 15.3% 0.0% 0.0% 0.0% 8.02sec 143715 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 353 1 0.75 82 164 3.7 3.7 15.2% 0.0% 0.0% 0.0% 90.14sec 504 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 434481 1448 13.85 5438 10880 69.2 69.2 15.4% 0.0% 0.0% 0.0% 4.23sec 434481 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 1399221 27984 38.40 37922 75894 32.0 32.0 15.3% 0.0% 0.0% 0.0% 6.62sec 1399221 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul auto_attack 0 1468998 24704 370.71 3466 6933 367.4 367.4 15.4% 0.0% 0.0% 0.0% 0.66sec 2098622 59.46sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 285756 4805 222.07 1126 2252 220.1 220.1 15.3% 0.0% 0.0% 0.0% 1.21sec 408234 59.46sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead frostbolt 317792 227956 2393 17.57 7074 14168 27.9 27.9 15.5% 0.0% 0.0% 0.0% 10.79sec 227956 95.25sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead shadow_bolt 317791 919536 9654 70.71 7104 14222 112.3 112.2 15.3% 0.0% 0.0% 0.0% 2.60sec 919536 95.25sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul auto_attack 0 1064378 8030 131.67 3172 6345 290.9 290.9 15.4% 0.0% 0.0% 0.0% 3.84sec 1520579 132.55sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 238315 1798 89.81 1041 2082 198.4 198.4 15.4% 0.0% 0.0% 0.0% 5.68sec 340459 132.55sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow desperate_prayer 19236 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 1964863 6550 47.00 7378 14789 235.0 235.0 13.3% 0.0% 0.0% 0.0% 1.27sec 1964863 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 197262 658 1.27 27138 54601 6.4 6.4 14.1% 0.0% 0.0% 0.0% 10.10sec 197262 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage ticks -32409 214610 715 1.25 29938 60522 6.4 6.3 14.2% 0.0% 0.0% 0.0% 10.10sec 221479 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 306212 1021 15.80 3876 0 7.0 79.0 0.0% 0.0% 0.0% 0.0% 38.47sec 306212 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 543328 1811 25.57 3751 7516 13.5 127.8 13.3% 0.0% 0.0% 0.0% 21.05sec 543328 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 127.8 0.0 0.0% 0.0% 0.0% 0.0% 2.33sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.45sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ascendance_damage 344548 117151 391 0.40 49530 99043 2.0 2.0 18.3% 0.0% 0.0% 0.0% 180.45sec 117151 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.73sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 308.19sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement elemental_blast 117014 2248992 7497 4.48 83558 167152 22.4 22.4 20.2% 0.0% 0.0% 0.0% 13.16sec 2248992 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 11.2 0.0 0.0% 0.0% 0.0% 0.0% 29.21sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 620106 2067 14.82 6936 13935 74.1 74.1 20.5% 0.0% 0.0% 0.0% 4.05sec 1545799 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 925692 3086 37.11 4133 8288 74.1 185.6 20.6% 0.0% 0.0% 0.0% 4.05sec 1545799 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 302487 1008 126.67 410 820 633.3 633.3 16.5% 0.0% 0.0% 0.0% 0.75sec 302487 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 371172 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 323718 1079 5.51 10072 20144 27.5 27.5 16.7% 0.0% 0.0% 0.0% 7.95sec 323718 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 1182337 3941 7.46 27183 54341 37.3 37.3 16.7% 0.0% 0.0% 0.0% 7.68sec 1182337 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 504261 1681 4.21 20542 41018 21.1 21.1 16.6% 0.0% 0.0% 0.0% 14.12sec 504261 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 2647056 8824 12.21 37191 74475 61.0 61.0 16.6% 0.0% 0.0% 0.0% 4.77sec 2647056 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 1769943 5900 6.23 47118 94352 31.1 31.1 20.6% 0.0% 0.0% 0.0% 9.17sec 1769943 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 1 436723 1456 32.80 2658 5318 164.0 164.0 16.6% 16.4% 0.0% 0.0% 2.14sec 623906 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 2 219702 732 32.98 1330 2660 164.9 164.9 16.5% 16.4% 0.0% 0.0% 2.11sec 313869 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement primordial_wave 375982 46300 154 1.35 5904 11807 6.7 6.7 16.4% 0.0% 0.0% 0.0% 48.16sec 46300 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt_pw 188196 496092 1654 1.13 72784 145634 5.7 5.7 20.5% 0.0% 0.0% 0.0% 50.81sec 496092 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 26.0 0.0 0.0% 0.0% 0.0% 0.0% 10.63sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 205855 686 5.20 6797 13615 26.0 26.0 16.5% 0.0% 0.0% 0.0% 10.63sec 294086 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 102983 343 5.20 3399 6801 26.0 26.0 16.6% 0.0% 0.0% 0.0% 10.63sec 147123 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 201664 672 0.98 35252 70687 4.9 4.9 16.4% 0.0% 0.0% 0.0% 58.13sec 201664 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 325668 1086 28.22 1981 3960 141.1 141.1 16.6% 0.0% 0.0% 0.0% 4.39sec 465252 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windlash 114089 128331 428 4.61 4620 9234 23.1 23.1 20.5% 0.0% 0.0% 0.0% 10.62sec 128331 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windlash_offhand 114093 67522 225 4.83 2323 4641 24.1 24.1 20.4% 0.0% 0.0% 0.0% 10.15sec 67522 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windstrike 115356 0 0 0.00 0 0 15.5 0.0 0.0% 0.0% 0.0% 0.0% 13.27sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windstrike_mh 115357 218731 729 3.11 12110 24186 15.5 15.5 16.3% 0.0% 0.0% 0.0% 13.27sec 218731 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windstrike_offhand 115360 109586 365 3.11 6056 12088 15.5 15.5 16.5% 0.0% 0.0% 0.0% 13.27sec 109586 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt_ti 188196 1351029 4503 3.11 72153 144264 15.5 15.5 20.5% 0.0% 0.0% 0.0% 13.27sec 1351029 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 24270 403 35.54 584 1169 35.7 35.7 16.5% 0.0% 0.0% 0.0% 1.85sec 34672 60.22sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_fiery_wolf melee 0 220734 8333 205.20 2087 4167 90.6 90.6 16.8% 0.0% 0.0% 0.0% 3.39sec 315343 26.49sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_frost_wolf melee 0 221486 7023 172.89 2087 4171 90.9 90.9 16.8% 0.0% 0.0% 0.0% 3.41sec 316416 31.54sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_lightning_wolf melee 0 221369 8353 205.40 2090 4176 90.7 90.7 16.8% 0.0% 0.0% 0.0% 3.40sec 316250 26.50sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm ascendance_dre 114051 0 0 0.00 0 0 7.9 0.0 0.0% 0.0% 0.0% 0.0% 35.88sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm ascendance_damage_dre 344548 305565 1019 1.58 32691 65385 7.9 7.9 18.7% 0.0% 0.0% 0.0% 35.88sec 305565 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm doom_winds 384352 25492 85 0.75 6828 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.41sec 36418 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 308.59sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm elemental_blast 117014 2310519 7702 5.17 74466 148867 25.9 25.8 20.1% 0.0% 0.0% 0.0% 11.64sec 2310519 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm feral_spirit 51533 0 0 0.00 0 0 15.9 0.0 0.0% 0.0% 0.0% 0.0% 19.62sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm flame_shock 188389 87324 291 4.95 2925 5853 24.7 24.7 20.7% 0.0% 0.0% 0.0% 11.72sec 441755 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm flame_shock ticks -188389 354430 1181 34.23 1720 3439 24.7 171.1 20.4% 0.0% 0.0% 0.0% 11.72sec 441755 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm flametongue_attack 10444 467535 1558 220.27 365 729 1101.3 1101.3 16.5% 0.0% 0.0% 0.0% 0.69sec 467535 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm flask 371172 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm forgestorm_ignited_damage 381700 337638 1125 5.76 10072 20144 28.8 28.8 16.4% 0.0% 0.0% 0.0% 7.64sec 337638 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm frost_shock 196840 251635 839 2.58 16741 33442 12.9 12.9 16.7% 0.0% 0.0% 0.0% 20.97sec 251635 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm ice_strike 342240 366025 1220 3.35 18736 37549 16.7 16.7 16.7% 0.0% 0.0% 0.0% 17.91sec 366025 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm lava_lash 60103 316873 1056 2.80 19451 38931 14.0 14.0 16.4% 0.0% 0.0% 0.0% 20.71sec 316873 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm lightning_bolt 188196 1862786 6209 5.85 52790 105599 29.2 29.2 20.7% 0.0% 0.0% 0.0% 9.90sec 1862786 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm main_hand 1 447646 1492 32.79 2728 5458 163.9 163.9 16.5% 16.4% 0.0% 0.0% 2.13sec 639510 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm offhand 2 230010 767 33.66 1367 2733 168.3 168.3 16.5% 16.4% 0.0% 0.0% 2.07sec 328594 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.46sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm stormstrike 17364 0 0 0.00 0 0 97.2 0.0 0.0% 0.0% 0.0% 0.0% 3.08sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm stormstrike_mh 32175 1430763 4769 25.90 9482 18987 129.5 129.5 16.5% 0.0% 0.0% 0.0% 3.08sec 2043999 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm stormblast_stormstrike_mh 390287 319212 1064 12.33 5180 0 61.6 61.6 0.0% 0.0% 0.0% 0.0% 5.45sec 319212 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm stormstrike_offhand 32176 715228 2384 25.90 4742 9481 129.5 129.5 16.5% 0.0% 0.0% 0.0% 3.08sec 1021780 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm stormblast_stormstrike_offhand 390287 159671 532 12.33 2591 0 61.6 61.6 0.0% 0.0% 0.0% 0.0% 5.45sec 159671 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm sundering 197214 282871 943 1.14 42700 85398 5.7 5.7 16.4% 0.0% 0.0% 0.0% 54.33sec 282871 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm windfury_attack 25504 2269708 7566 80.79 4823 9658 403.9 403.9 16.5% 0.0% 0.0% 0.0% 2.49sec 3242523 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm windlash 114089 144628 482 6.21 3870 7744 31.1 31.1 20.3% 0.0% 0.0% 0.0% 10.01sec 144628 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm windlash_offhand 114093 89130 297 7.66 1934 3867 38.3 38.3 20.4% 0.0% 0.0% 0.0% 8.14sec 89130 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm windstrike 115356 0 0 0.00 0 0 20.6 0.0 0.0% 0.0% 0.0% 0.0% 12.65sec 0 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm windstrike_mh 115357 435755 1453 5.49 13640 27289 27.5 27.5 16.3% 0.0% 0.0% 0.0% 12.65sec 435755 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm stormblast_windstrike_mh 390287 81331 271 1.96 8308 0 9.8 9.8 0.0% 0.0% 0.0% 0.0% 25.30sec 81331 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm windstrike_offhand 115360 218290 728 5.49 6821 13637 27.5 27.5 16.6% 0.0% 0.0% 0.0% 12.65sec 218290 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm stormblast_windstrike_offhand 390287 40844 136 1.96 4172 0 9.8 9.8 0.0% 0.0% 0.0% 0.0% 25.30sec 40844 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm lightning_bolt_ti 188196 999422 3331 4.13 40299 80370 20.6 20.6 20.3% 0.0% 0.0% 0.0% 12.65sec 999422 300.00sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm_greater_earth_elemental melee 0 26827 438 38.21 590 1180 39.0 39.0 16.5% 0.0% 0.0% 0.0% 2.10sec 38325 61.28sec
PR_Shaman_Enhancement_Storm PR_Shaman_Enhancement_Storm_spirit_wolf melee 0 941107 8554 214.44 2055 4110 393.2 393.2 16.5% 0.0% 0.0% 0.0% 1.52sec 1344472 110.02sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
204359.6 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.6 2.2 22.2sec 18.8sec 5.5sec 23.01% 0.00% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 186.0s
  • trigger_min/max:0.5s / 186.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.01%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.3sec 18.8sec 5.5sec 23.17% 0.00% 2.2 (2.2) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 198.0s
  • trigger_min/max:3.0s / 195.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • brittle_1:23.17%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 119.5 161.8sec 2.5sec 292.5sec 98.53% 0.00% 110.4 (110.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.3s / 328.8s
  • trigger_min/max:0.0s / 16.3s
  • trigger_pct:100.00%
  • duration_min/max:6.5s / 355.7s

Stack Uptimes

  • death_rot_1:0.28%
  • death_rot_2:0.29%
  • death_rot_3:0.89%
  • death_rot_4:0.29%
  • death_rot_5:0.68%
  • death_rot_6:0.52%
  • death_rot_7:0.48%
  • death_rot_8:0.47%
  • death_rot_9:0.49%
  • death_rot_10:94.12%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% from you for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 6.6 231.4 48.3sec 1.3sec 44.4sec 97.84% 0.00% 173.2 (173.2) 5.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 242.1s
  • trigger_min/max:0.0s / 15.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.4s

Stack Uptimes

  • everfrost_1:2.20%
  • everfrost_2:2.19%
  • everfrost_3:2.18%
  • everfrost_4:2.17%
  • everfrost_5:2.16%
  • everfrost_6:2.16%
  • everfrost_7:2.15%
  • everfrost_8:2.14%
  • everfrost_9:2.13%
  • everfrost_10:78.36%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 21.0 39.8 14.3sec 4.9sec 12.2sec 85.64% 0.00% 5.0 (6.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 115.2s
  • trigger_min/max:0.0s / 31.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 121.1s

Stack Uptimes

  • festering_wound_1:19.88%
  • festering_wound_2:25.66%
  • festering_wound_3:19.21%
  • festering_wound_4:9.29%
  • festering_wound_5:5.40%
  • festering_wound_6:6.20%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.3 59.7 190.7sec 4.8sec 218.7sec 96.23% 96.18% 59.7 (59.7) 0.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.8s / 340.4s
  • trigger_min/max:1.0s / 38.2s
  • trigger_pct:100.00%
  • duration_min/max:4.8s / 356.1s

Stack Uptimes

  • lashing_flames_1:96.23%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 59.7 179.9sec 4.9sec 285.2sec 99.16% 0.00% 55.6 (55.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 350.8s
  • trigger_min/max:0.9s / 53.7s
  • trigger_pct:100.00%
  • duration_min/max:1.7s / 357.9s

Stack Uptimes

  • razorice_1:1.03%
  • razorice_2:0.86%
  • razorice_3:0.93%
  • razorice_4:0.87%
  • razorice_5:95.47%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Rotten Touch 11.7 9.4 25.7sec 13.9sec 13.8sec 53.63% 59.40% 9.4 (9.4) 11.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rotten_touch
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 104.8s
  • trigger_min/max:0.8s / 57.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.7s

Stack Uptimes

  • rotten_touch_1:53.63%

Spelldata

  • id:390276
  • name:Rotten Touch
  • tooltip:Scourge Strike damage taken from {$@=}auracaster is increased by {$s1=50}%.
  • description:{$@spelldesc390275=Sudden Doom causes your next Death Coil to also increase your {$?s207311=true}[Clawing Shadows][Scourge Strike] damage against the target by {$390276s1=50}% for {$390276d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 206066.23
Minimum 188226.54
Maximum 226602.41
Spread ( max - min ) 38375.87
Range [ ( max - min ) / 2 * 100% ] 9.31%
Standard Deviation 5570.5938
5th Percentile 197215.16
95th Percentile 215413.30
( 95th Percentile - 5th Percentile ) 18198.14
Mean Distribution
Standard Deviation 64.3280
95.00% Confidence Interval ( 205940.15 - 206192.31 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2808
0.1 Scale Factor Error with Delta=300 264903
0.05 Scale Factor Error with Delta=300 1059612
0.01 Scale Factor Error with Delta=300 26490287
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3781
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 75395183 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.