SimulationCraft 1007-01

for World of Warcraft 10.1.0.49318 Live (hotfix 2023-04-29/49318, git build 8574ced00e)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2022-11-14 Ebonbolt is slower than spell data suggests.
Ebonbolt prj_speed 20.00 30.00
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 44314 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
44313.6 44313.6 48.1 / 0.109% 8296.1 / 18.7% 3527.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.2 12.5 Runic Power 2.60% 53.7 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 44314
Abomination Limb 0 (517) 0.0% (1.2%) 3.0 120.53sec 51337 41373

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.00 1.2411 0.0000 0.00 0.00 0.00% 41373.48 41373.48

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [e]:0.10
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<12
    cooldowns
    [f]:2.89
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
    Abomination Limb (_damage) 517 1.2% 38.2 6.91sec 4017 0 Direct 38.2 3068 6136 4017 30.9% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.24 38.24 0.00 0.00 0.00 0.0000 0.0000 153619.75 153619.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.07% 26.41 10 36 3067.95 2211 5096 3068.81 2621 3597 81031 81031 0.00%
crit 30.93% 11.83 1 23 6136.23 4422 10069 6139.24 4760 7865 72589 72589 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 2627 5.9% 191.4 1.83sec 4115 2265 Direct 191.4 3595 7191 4115 30.8% 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 191.44 191.44 0.00 0.00 0.00 1.8170 0.0000 787801.11 1125458.86 30.00% 2264.75 2264.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.90% 101.27 59 144 3594.62 2435 6696 3594.31 3323 3884 364039 520070 30.00%
crit 30.78% 58.93 30 94 7191.33 4870 13201 7188.30 6537 7916 423762 605389 30.00%
miss 16.32% 31.24 11 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1279 2.9% 187.1 1.83sec 2050 1129 Direct 187.1 1797 3595 2050 30.8% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 187.09 187.09 0.00 0.00 0.00 1.8167 0.0000 383607.93 548025.29 30.00% 1128.60 1128.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.46% 98.16 59 141 1797.38 1217 3300 1797.26 1658 1938 176426 252043 30.00%
crit 30.80% 57.63 29 95 3594.99 2435 6601 3593.43 3162 4000 207182 295982 30.00%
miss 16.73% 31.30 11 60 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 95 0.2% 2.0 179.84sec 14007 0 Direct 2.0 10757 21435 14006 30.4% 0.0%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 28020.23 28020.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.56% 1.39 0 3 10757.13 9342 18679 9777.67 0 17969 14969 14969 0.00%
crit 30.44% 0.61 0 3 21434.97 18685 34758 11093.73 0 34321 13051 13051 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}
Breath of Sindragosa 0 (9587) 0.0% (21.6%) 2.9 120.52sec 972535 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [i]:2.95
  • if_expr:!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
    Breath of Sindragosa (_tick) 9587 21.6% 131.5 2.04sec 21795 0 Direct 131.5 16686 33259 21796 30.8% 0.0%

Stats Details: Breath Of Sindragosa Tick

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.46 131.46 0.00 0.00 0.00 0.0000 0.0000 2865209.67 2865209.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.17% 90.93 41 143 16685.86 8588 32560 16698.44 15020 18759 1517238 1517238 0.00%
crit 30.83% 40.53 13 70 33259.09 17175 64581 33281.25 28214 38686 1347971 1347971 0.00%

Action Details: Breath Of Sindragosa Tick

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}
Burnout Wave 681 1.5% 2.8 119.19sec 72387 0 Direct 2.7 59039 118247 76936 30.2% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.83 2.66 0.00 0.00 0.00 0.0000 0.0000 204968.72 204968.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.77% 1.86 0 3 59038.77 22015 66044 56235.52 0 66044 109747 109747 0.00%
crit 30.23% 0.81 0 3 118247.02 44029 132088 71749.82 0 132088 95222 95222 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 11 0.0% 0.6 79.47sec 5704 4382 Direct 6.2 403 807 527 30.6% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.57 6.22 0.00 0.00 0.00 1.3027 0.0000 3277.45 3277.45 0.00% 4381.62 4381.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.39% 4.32 0 37 403.23 295 711 174.60 0 610 1741 1741 0.00%
crit 30.61% 1.90 0 19 806.63 589 1439 342.26 0 1260 1536 1536 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    breath
    [W]:0.57
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
Dragon Games Equipment 877 2.0% 6.0 48.06sec 43348 0 Direct 6.0 33171 66341 43378 30.8% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 0.00 0.0000 0.0000 259823.15 371185.39 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.23% 4.15 0 6 33170.70 33171 33171 33135.31 0 33171 137544 196497 29.97%
crit 30.77% 1.84 0 6 66341.40 66341 66341 58857.09 0 66341 122279 174689 26.62%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 2156 4.9% 60.3 4.95sec 10733 0 Periodic 98.7 5021 10014 6557 30.8% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.30 0.00 98.69 98.69 59.29 0.0000 2.9999 647173.27 647173.27 0.00% 2185.92 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 69.23% 68.32 42 95 5021.19 230 10640 5020.37 4524 5458 343061 343061 0.00%
crit 30.77% 30.37 12 53 10013.56 279 20369 10011.29 8518 11662 304112 304112 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.11
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 2231 (3345) 5.1% (7.6%) 43.7 5.00sec 23066 17205 Direct 43.7 (87.4) 11774 23489 15387 30.8% (30.7%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.71 43.71 0.00 0.00 0.00 1.3407 0.0000 672498.25 672498.25 0.00% 17204.54 17204.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.16% 30.23 12 55 11773.96 7212 24336 11754.39 10311 13289 355907 355907 0.00%
crit 30.84% 13.48 2 30 23489.22 14424 47486 23428.16 19456 28248 316591 316591 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [H]:2.82
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [l]:28.79
  • if_expr:buff.killing_machine.stack<2&runic_power.deficit<20&!variable.2h_check
    single_target
    [o]:4.25
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [s]:7.85
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 1114 2.5% 43.7 5.00sec 7679 0 Direct 43.7 5889 11735 7679 30.6% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.71 43.71 0.00 0.00 0.00 0.0000 0.0000 335636.06 335636.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.38% 30.32 14 60 5889.06 3606 12168 5878.82 5146 6622 178566 178566 0.00%
crit 30.62% 13.38 2 30 11734.96 7212 24040 11707.25 9464 14432 157070 157070 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Howling Blast 5976 (7227) 13.5% (16.3%) 60.3 4.95sec 35882 29579 Direct 60.3 (120.6) 22699 45276 29669 30.9% (30.8%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.30 60.30 0.00 0.00 0.00 1.2131 0.0000 1788902.72 1788902.72 0.00% 29579.29 29579.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.13% 41.68 21 64 22699.50 3792 46005 22696.04 20175 25046 946142 946142 0.00%
crit 30.87% 18.61 6 35 45275.73 7971 91506 45275.98 36189 55684 842761 842761 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [S]:36.82
  • if_expr:variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
    breath
    [X]:0.21
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
    breath
    [Z]:0.56
  • if_expr:buff.rime.react
    single_target
    [n]:22.70
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 1252 2.8% 60.3 4.95sec 6214 0 Direct 60.3 4760 9486 6214 30.8% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.29 60.29 0.00 0.00 0.00 0.0000 0.0000 374644.94 374644.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.23% 41.74 20 63 4759.52 2542 9696 4758.84 4194 5377 198677 198677 0.00%
crit 30.77% 18.55 3 39 9485.90 5083 18679 9485.56 7641 11935 175968 175968 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Obliterate 1202 (9356) 2.7% (21.1%) 50.0 5.88sec 56089 21632 Direct 50.0 (211.6) 5516 11043 7200 30.5% (67.2%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.00 50.00 0.00 0.00 0.00 2.5929 0.0000 360056.83 514380.01 30.00% 21632.09 21632.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.52% 34.76 13 57 5515.51 3548 9891 5519.85 4884 6238 191725 273899 30.00%
crit 30.48% 15.24 1 33 11042.82 7097 19522 11040.92 8754 13762 168332 240481 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    breath
    [U]:22.71
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [V]:30.98
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Y]:6.59
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [m]:26.82
  • if_expr:buff.killing_machine.react
    single_target
    [p]:18.69
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 601 1.4% 50.0 5.88sec 3601 0 Direct 50.0 2758 5522 3601 30.5% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.00 50.00 0.00 0.00 0.00 0.0000 0.0000 180084.77 257270.51 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.48% 34.74 15 56 2757.58 1774 4946 2759.89 2465 3143 95806 136869 30.00%
crit 30.52% 15.26 3 33 5522.21 3548 9631 5521.24 4529 7174 84279 120401 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 5035 11.4% 55.8 5.31sec 27060 0 Direct 55.8 0 27061 27061 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.79 55.79 0.00 0.00 0.00 0.0000 0.0000 1509711.37 1509711.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 55.79 33 85 27060.56 14730 55402 27032.29 24047 30457 1509711 1509711 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 2517 5.7% 55.8 5.31sec 13530 0 Direct 55.8 0 13530 13530 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.79 55.79 0.00 0.00 0.00 0.0000 0.0000 754855.69 754855.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 55.79 33 85 13530.28 7365 27701 13516.14 12024 15228 754856 754856 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Remorseless Winter 0 (5079) 0.0% (11.5%) 15.2 20.39sec 100357 79562

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.17 0.00 0.00 0.00 0.00 1.2614 0.0000 0.00 0.00 0.00% 79562.34 79562.34

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    breath
    [R]:5.86
  • if_expr:variable.rw_buffs|variable.adds_remain
    single_target
    [k]:9.30
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5079 11.5% 239.2 1.25sec 6363 0 Direct 239.2 4872 9720 6363 30.8% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 239.18 239.18 0.00 0.00 0.00 0.0000 0.0000 1521948.05 1521948.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.24% 165.60 110 217 4872.16 1038 12756 4872.37 4087 5554 806818 806818 0.00%
crit 30.76% 73.58 42 111 9719.60 2077 24780 9718.52 7609 11665 715130 715130 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}
Strike Twice 201 0.5% 20.1 14.52sec 3002 0 Direct 20.1 2296 4593 3002 30.8% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.10 20.10 0.00 0.00 0.00 0.0000 0.0000 60361.27 86232.59 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.25% 13.92 3 31 2296.31 2296 2296 2296.31 2296 2296 31969 45671 30.00%
crit 30.75% 6.18 0 18 4592.63 4593 4593 4582.21 0 4593 28392 40562 29.93%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 202 0.5% 20.2 14.45sec 3002 0 Direct 20.2 2296 4593 3002 30.7% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.17 20.17 0.00 0.00 0.00 0.0000 0.0000 60558.17 86513.88 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.26% 13.97 3 29 2296.31 2296 2296 2296.31 2296 2296 32081 45831 30.00%
crit 30.74% 6.20 0 16 4592.63 4593 4593 4584.05 0 4593 28477 40683 29.95%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 1967 / 1073
auto_attack 1317 1.6% 95.2 2.91sec 2261 1462 Direct 95.2 1729 3460 2261 30.8% 0.0%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.24 95.24 0.00 0.00 0.00 1.5471 0.0000 215374.57 307685.80 30.00% 1461.80 1461.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.23% 65.94 35 89 1728.77 1097 3012 1730.21 1589 1914 113987 162843 30.00%
crit 30.77% 29.30 8 53 3460.28 2194 5935 3462.77 2993 4022 101388 144843 30.00%

Action Details: Auto Attack

  • id:0
  • school:none
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:2.94
Claw 649 0.8% 52.7 5.34sec 2011 2011 Direct 52.7 1538 3074 2011 30.8% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.72 52.72 0.00 0.00 0.00 1.0000 0.0000 106033.96 151480.95 30.00% 2011.30 2011.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.16% 36.46 19 53 1537.53 971 2665 1538.53 1398 1728 56058 80085 30.00%
crit 30.84% 16.26 4 31 3073.59 1942 5266 3076.21 2538 3776 49976 71396 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.72
  • if_expr:energy>70
Gnaw 1 0.0% 2.9 120.71sec 66 66 Direct 2.9 51 101 66 31.5% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 0.00 1.0000 0.0000 194.24 277.49 30.00% 66.38 66.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.54% 2.01 0 3 50.50 36 70 48.79 0 68 101 145 28.94%
crit 31.46% 0.92 0 3 100.96 70 139 67.97 0 139 93 133 20.17%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.93
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Anti-Magic Shell 7.4 43.45sec

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 7.40 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    default
    [G]:7.40
  • if_expr:runic_power.deficit>40
Arcane Torrent 2.0 145.35sec

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.99 0.00 0.00 0.00 0.00 1.2742 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [a]:0.92
  • if_expr:runic_power<60
    single_target
    [r]:1.08
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 3.9 82.82sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [c]:0.28
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [d]:3.67
  • if_expr:buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
Iced Phial of Corrupting Rage 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 4.0 76.54sec

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.96 0.00 0.00 0.00 0.00 1.1860 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [T]:3.06
  • if_expr:rune<2&runic_power.deficit>25
    single_target
    [q]:0.90
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
Pillar of Frost 8.6 36.27sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.61 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [g]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [h]:8.29
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
Elemental Potion of Ultimate Power 1.4 304.05sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [b]:1.45
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.70sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [j]:2.98
Unholy Strength 20.2 14.40sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.19 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.5sec 120.5sec 11.8sec 11.88% 0.00% 32.4 (32.4) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 122.4s
  • trigger_min/max:120.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.88%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Anti-Magic Shell 7.4 0.0 43.3sec 43.4sec 6.9sec 17.09% 0.00% 0.0 (0.0) 7.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 98.3s
  • trigger_min/max:40.0s / 98.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s

Stack Uptimes

  • antimagic_shell_1:17.09%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 10.6 36.3 29.1sec 6.3sec 18.9sec 66.56% 0.00% 0.0 (0.0) 4.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 73.9s
  • trigger_min/max:0.9s / 43.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.0s

Stack Uptimes

  • bonegrinder_crit_1:17.66%
  • bonegrinder_crit_2:15.03%
  • bonegrinder_crit_3:12.88%
  • bonegrinder_crit_4:11.18%
  • bonegrinder_crit_5:9.81%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 5.7 0.0 50.6sec 50.6sec 9.8sec 18.75% 15.83% 0.0 (0.0) 5.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:17.1s / 252.3s
  • trigger_min/max:17.1s / 252.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • bonegrinder_frost_1:18.75%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.8 13.9 120.1sec 14.9sec 19.4sec 18.30% 0.00% 1.8 (1.8) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 147.5s
  • trigger_min/max:0.0s / 133.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.89%
  • bound_by_fire_and_blaze_2:4.15%
  • bound_by_fire_and_blaze_3:4.00%
  • bound_by_fire_and_blaze_4:3.51%
  • bound_by_fire_and_blaze_5:2.61%
  • bound_by_fire_and_blaze_6:3.13%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.5sec 120.5sec 44.6sec 43.92% 0.00% 131.1 (131.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 126.7s
  • trigger_min/max:120.0s / 126.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 106.0s

Stack Uptimes

  • breath_of_sindragosa_1:43.92%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Corrupting Rage 6.9 0.0 44.9sec 43.9sec 31.3sec 69.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 291.0s
  • trigger_min/max:15.0s / 282.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 306.1s

Stack Uptimes

  • corrupting_rage_1:69.94%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dragon Games Equipment 3.0 0.0 120.0sec 120.0sec 0.6sec 0.64% 0.00% 6.0 (6.0) 3.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.57
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.1s
  • trigger_min/max:120.0s / 120.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.7s

Stack Uptimes

  • dragon_games_equipment_1:0.64%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 304.1sec 304.1sec 27.1sec 12.87% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 327.8s
  • trigger_min/max:300.0s / 327.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.87%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 83.0sec 82.8sec 19.6sec 25.90% 0.00% 11.6 (11.6) 3.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 279.7s
  • trigger_min/max:0.0s / 279.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.3s

Stack Uptimes

  • empower_rune_weapon_1:25.90%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 8.3 0.0 36.3sec 36.3sec 12.6sec 34.88% 0.00% 0.0 (0.0) 7.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.6s / 55.3s
  • trigger_min/max:26.6s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • enduring_strength_1:34.88%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 8.5 20.6 36.6sec 10.0sec 9.9sec 28.09% 98.80% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.5s / 120.2s
  • trigger_min/max:0.9s / 110.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:10.21%
  • enduring_strength_builder_2:8.63%
  • enduring_strength_builder_3:5.35%
  • enduring_strength_builder_4:2.48%
  • enduring_strength_builder_5:1.00%
  • enduring_strength_builder_6:0.33%
  • enduring_strength_builder_7:0.08%
  • enduring_strength_builder_8:0.01%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storm 12.8 121.9 24.3sec 2.2sec 15.6sec 66.73% 86.72% 69.9 (111.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.8s / 101.7s
  • trigger_min/max:0.9s / 35.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 94.2s

Stack Uptimes

  • gathering_storm_1:2.39%
  • gathering_storm_2:5.71%
  • gathering_storm_3:4.82%
  • gathering_storm_4:3.98%
  • gathering_storm_5:5.16%
  • gathering_storm_6:3.72%
  • gathering_storm_7:3.66%
  • gathering_storm_8:2.86%
  • gathering_storm_9:2.29%
  • gathering_storm_10:32.14%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 1.0 173.8 160.4sec 1.7sec 289.8sec 97.77% 0.00% 171.8 (171.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:117.7s / 243.7s
  • trigger_min/max:1.0s / 12.5s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 354.7s

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.09%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 44.6 24.9 6.7sec 5.1sec 2.3sec 34.40% 52.73% 1.6 (1.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 57.1s
  • trigger_min/max:0.0s / 43.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.3s

Stack Uptimes

  • killing_machine_1:29.34%
  • killing_machine_2:5.06%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Overwhelming Rage 6.2 0.0 44.2sec 44.2sec 14.6sec 30.06% 0.00% 24.1 (24.1) 5.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_overwhelming_rage
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 315.0s
  • trigger_min/max:15.0s / 315.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • overwhelming_rage_1:30.06%

Spelldata

  • id:374037
  • name:Overwhelming Rage
  • tooltip:Suffering {$=}w1% of your maximum health as Frost damage every $t sec.
  • description:
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Pillar of Frost 8.6 0.0 36.3sec 36.3sec 11.8sec 33.81% 35.80% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.6s / 55.3s
  • trigger_min/max:26.6s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:33.81%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 8.6 56.7 36.3sec 4.4sec 11.5sec 32.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.2s / 55.3s
  • trigger_min/max:0.9s / 45.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:2.10%
  • pillar_of_frost_bonus_2:3.11%
  • pillar_of_frost_bonus_3:3.49%
  • pillar_of_frost_bonus_4:2.87%
  • pillar_of_frost_bonus_5:3.27%
  • pillar_of_frost_bonus_6:3.29%
  • pillar_of_frost_bonus_7:2.90%
  • pillar_of_frost_bonus_8:2.65%
  • pillar_of_frost_bonus_9:1.91%
  • pillar_of_frost_bonus_10:1.37%
  • pillar_of_frost_bonus_11:1.15%
  • pillar_of_frost_bonus_12:1.06%
  • pillar_of_frost_bonus_13:0.93%
  • pillar_of_frost_bonus_14:0.84%
  • pillar_of_frost_bonus_15:0.63%
  • pillar_of_frost_bonus_16:0.42%
  • pillar_of_frost_bonus_17:0.28%
  • pillar_of_frost_bonus_18:0.20%
  • pillar_of_frost_bonus_19:0.18%
  • pillar_of_frost_bonus_20:0.13%
  • pillar_of_frost_bonus_21:0.06%
  • pillar_of_frost_bonus_22:0.02%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 12.9 2.3 24.2sec 20.4sec 17.4sec 74.75% 0.00% 219.5 (219.5) 12.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 101.4s
  • trigger_min/max:20.0s / 28.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 95.3s

Stack Uptimes

  • remorseless_winter_1:74.75%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 60.7 11.6 5.0sec 4.2sec 2.0sec 40.72% 100.00% 11.6 (11.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 47.1s
  • trigger_min/max:0.0s / 47.1s
  • trigger_pct:63.10%
  • duration_min/max:0.0s / 32.5s

Stack Uptimes

  • rime_1:40.72%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.5 13.7 22.2sec 10.7sec 11.6sec 52.38% 0.00% 13.7 (13.7) 13.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 160.0s
  • trigger_min/max:0.9s / 137.1s
  • trigger_pct:14.98%
  • duration_min/max:0.0s / 78.9s

Stack Uptimes

  • rune_mastery_1:52.38%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.7 7.4 23.4sec 14.5sec 10.2sec 43.22% 42.27% 7.4 (7.4) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 82.0s
  • trigger_min/max:0.0s / 61.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.2s

Stack Uptimes

  • rune_of_hysteria_1:43.22%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Ground 0.5 0.1 129.7sec 79.2sec 10.1sec 1.74% 0.00% 0.1 (0.1) 0.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 248.2s
  • trigger_min/max:1.2s / 248.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 235.6s

Stack Uptimes

  • unholy_ground_1:1.74%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 11.8 36.0sec 14.4sec 23.6sec 66.34% 0.00% 11.8 (11.8) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 182.8s
  • trigger_min/max:0.0s / 60.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 155.5s

Stack Uptimes

  • unholy_strength_1:66.34%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 1.0 173.8 160.4sec 1.7sec 289.8sec 97.77% 0.00% 171.8 (171.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:117.7s / 243.7s
  • trigger_min/max:1.0s / 12.5s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 354.7s

Stack Uptimes

  • unleashed_frenzy_1:0.34%
  • unleashed_frenzy_2:0.34%
  • unleashed_frenzy_3:97.09%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=10 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.7 10.0 51.0 10.9s 1.3s 143.2s
windfury_totem_extra_attack_oh 22.4 5.0 42.0 13.0s 1.3s 189.5s
Killing Machine spent on Obliterate 55.8 33.0 85.0 5.3s 0.9s 42.1s
Killing Machine: Critical auto attacks 56.2 33.0 85.0 5.6s 1.3s 43.5s
Killing Machine wasted: Critical auto attacks 1.6 0.0 9.0 63.2s 1.3s 337.9s
Rune ready 223.6 161.0 283.0 1.5s 0.0s 13.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 3.32% 0.12% 9.99% 0.8s 0.0s 9.1s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Remorseless Winter0.4300.0008.2106.5372.23618.971
Horn of Winter28.4470.000232.962132.67960.112268.304
Death and Decay122.2860.000317.407283.733121.255359.968
Empower Rune Weapon1.4680.00075.6855.7994.13980.866
Abomination Limb0.3340.0002.4251.0030.0004.212
Pillar of Frost1.6140.00015.21813.9145.76637.097
Breath of Sindragosa2.2360.0006.7316.5894.14112.451
Raise Dead0.8110.0002.7782.4181.3435.557

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=449832)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0761.402 / 1.1053.82827.242
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
16.37446.30784.060 / 82.229127.400222.846

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Breath of SindragosaRune11.1310.744.81%0.970.393.48%
Empower Rune WeaponRunic Power19.2088.702.36%4.627.307.60%
Empower Rune WeaponRune19.2019.058.52%0.990.150.76%
Frost FeverRunic Power32.63154.574.11%4.748.605.27%
Horn of WinterRunic Power3.9699.122.64%25.000.000.00%
Horn of WinterRune7.937.933.55%1.000.000.00%
Murderous EfficiencyRune27.8827.8812.47%1.000.000.00%
Rage of the Frozen ChampionRunic Power60.29473.7912.61%7.868.561.78%
Rune RegenerationRune85.0385.0338.03%1.000.000.00%
Rune of HysteriaRunic Power156.70320.448.53%2.0430.518.69%
Runic AttenuationRunic Power71.45343.119.13%4.8014.163.96%
Runic EmpowermentRune73.5872.9632.63%0.990.620.84%
Arcane TorrentRunic Power1.9939.831.06%20.000.000.00%
Death and DecayRunic Power0.575.750.15%10.000.000.00%
Howling BlastRunic Power60.300.020.00%0.000.000.00%
ObliterateRunic Power105.802088.2255.56%19.7427.691.31%
Remorseless WinterRunic Power15.17144.713.85%9.546.954.58%
pet - ghoul
energy_regenEnergy1111.161928.24100.00%1.74170.288.11%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_tick)Runic Power 131.142360.4864.29%18.0017.961213.83
Death and DecayRune 0.570.570.25%1.001.005702.66
Frost StrikeRunic Power 43.701311.1535.71%30.0030.00768.90
Howling BlastRune 60.300.000.00%0.000.001352397584.12
ObliterateRune 105.80211.5993.08%2.004.2313255.28
Remorseless WinterRune 15.1715.176.67%1.001.00100357.19
pet - ghoul
ClawEnergy 52.722108.83100.00%40.0040.0050.28
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 12.53 12.24 103.8 86.6 0.4 124.0
Rune 6.0 0.75 0.76 0.0 2.3 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 44313.58
Minimum 37198.54
Maximum 51373.92
Spread ( max - min ) 14175.38
Range [ ( max - min ) / 2 * 100% ] 15.99%
Standard Deviation 2127.1189
5th Percentile 40743.71
95th Percentile 47880.73
( 95th Percentile - 5th Percentile ) 7137.01
Mean Distribution
Standard Deviation 24.5635
95.00% Confidence Interval ( 44265.43 - 44361.72 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 89
0.1% Error 8852
0.1 Scale Factor Error with Delta=300 38625
0.05 Scale Factor Error with Delta=300 154500
0.01 Scale Factor Error with Delta=300 3862489
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 44313.58
Minimum 37198.54
Maximum 51373.92
Spread ( max - min ) 14175.38
Range [ ( max - min ) / 2 * 100% ] 15.99%
Standard Deviation 2127.1189
5th Percentile 40743.71
95th Percentile 47880.73
( 95th Percentile - 5th Percentile ) 7137.01
Mean Distribution
Standard Deviation 24.5635
95.00% Confidence Interval ( 44265.43 - 44361.72 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 89
0.1% Error 8852
0.1 Scale Factor Error with Delta=300 38625
0.05 Scale Factor Error with Delta=300 154500
0.01 Scale Factor Error with Delta=300 3862489
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 44313.58
Minimum 37198.54
Maximum 51373.92
Spread ( max - min ) 14175.38
Range [ ( max - min ) / 2 * 100% ] 15.99%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 12952759.41
Minimum 8884623.83
Maximum 16631159.60
Spread ( max - min ) 7746535.77
Range [ ( max - min ) / 2 * 100% ] 29.90%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
B 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
C 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
D 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
E 0.00 variable,name=2h_check,value=main_hand.2h
Default action list Executed every time the actor is available.
# count action,conditions
F 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=3,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
G 7.40 antimagic_shell,if=runic_power.deficit>40
0.00 antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up&cooldown.empower_rune_weapon.charges<2|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up)
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
H 2.82 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
I 0.00 call_action_list,name=trinkets
Choose Action list to run
J 0.00 call_action_list,name=cooldowns
K 0.00 call_action_list,name=racials
L 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
M 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
N 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
O 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
P 0.00 call_action_list,name=aoe,if=active_enemies>=2
Q 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
R 5.86 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Breath Active Rotation
S 36.82 howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
T 3.06 horn_of_winter,if=rune<2&runic_power.deficit>25
U 22.71 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&runic_power>45
V 30.98 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
W 0.57 death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
0.00 remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
X 0.21 howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
Y 6.59 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
Z 0.56 howling_blast,if=buff.rime.react
a 0.92 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
b 1.45 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
c 0.28 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
d 3.67 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
e 0.10 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<12
f 2.89 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
g 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
h 8.29 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
i 2.95 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
j 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.single_target
# count action,conditions
k 9.30 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
l 28.79 frost_strike,if=buff.killing_machine.stack<2&runic_power.deficit<20&!variable.2h_check
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
m 26.82 obliterate,if=buff.killing_machine.react
n 22.70 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
o 4.25 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
p 18.69 obliterate,if=!variable.pooling_runes
q 0.90 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
r 1.08 arcane_torrent,if=runic_power.deficit>20
s 7.85 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
t 2.83 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
u 3.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
0.00 use_item,use_off_gcd=1,slot=main_hand,if=(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFGufjknpnpidhbVSUUVSVSTUVSUSUtYRSYYSUdVUaVVhVUGRUSUVSVUUUSWpqpknHpossmnshmsmGnkHsmnmsmssmmnpHknsmmhlnplnopnufjlkmliSUSGUdVSTVVSUtSVRSUVhSVSUSUVWamnmkmHmnlGmmlmlnhommklmlnplplnlmlmlknlplnplnmlhnlGmpklnoplpopnlpufjmlkliSUYVSTVShVStVGVdVRUUUSppnpsplmlmlklmnlgplopnl

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 4 trinket_1_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 5 trinket_2_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 6 trinket_1_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 7 trinket_2_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat A trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat B trinket_1_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat C trinket_2_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat D rw_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat E 2h_check PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
0:00.000 default F auto_attack Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
corrupting_rage
0:00.000 default G antimagic_shell PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, corrupting_rage
0:00.000 trinkets u use_item_dragon_games_equipment Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, corrupting_rage
0:00.000 cooldowns f abomination_limb Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, dragon_games_equipment, corrupting_rage
0:01.036 cooldowns j raise_dead Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, abomination_limb, rime, corrupting_rage
0:01.036 single_target k remorseless_winter Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, abomination_limb, rime, corrupting_rage
0:02.072 single_target n howling_blast Fluffy_Pillow 10.0/124: 8% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, abomination_limb, remorseless_winter, rime, corrupting_rage
0:03.107 single_target p obliterate Fluffy_Pillow 18.0/124: 15% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, abomination_limb, gathering_storm, remorseless_winter, corrupting_rage
0:04.142 single_target n howling_blast Fluffy_Pillow 43.0/124: 35% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, abomination_limb, gathering_storm(3), remorseless_winter, rime, corrupting_rage
0:05.178 single_target p obliterate Fluffy_Pillow 56.0/124: 45% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, abomination_limb, gathering_storm(4), remorseless_winter, corrupting_rage
0:06.212 cooldowns i breath_of_sindragosa Fluffy_Pillow 76.0/124: 61% runic_power
1.0/6: 17% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, abomination_limb, gathering_storm(6), remorseless_winter, rime, corrupting_rage
0:06.212 cooldowns d empower_rune_weapon Fluffy_Pillow 76.0/124: 61% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(6), remorseless_winter, rime, rune_of_hysteria, corrupting_rage
0:06.212 cooldowns h pillar_of_frost Fluffy_Pillow 82.2/124: 66% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(6), remorseless_winter, rime, rune_of_hysteria, corrupting_rage
0:06.212 cooldowns b potion Fluffy_Pillow 82.2/124: 66% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(6), pillar_of_frost, remorseless_winter, rime, rune_of_hysteria, corrupting_rage
0:06.212 breath V obliterate Fluffy_Pillow 82.2/124: 66% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(6), pillar_of_frost, remorseless_winter, rime, rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:07.112 breath S howling_blast Fluffy_Pillow 113.2/124: 91% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, enduring_strength_builder, rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:08.013 breath U obliterate Fluffy_Pillow 105.1/124: 85% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons, breath_of_sindragosa, gathering_storm(9), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, enduring_strength_builder, unleashed_frenzy, rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:08.912 Waiting     0.199 sec 112.2/124: 90% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(2), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(2), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:09.111 breath U obliterate Fluffy_Pillow 112.2/124: 90% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(2), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(2), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:10.010 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:10.910 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:11.810 Waiting     0.417 sec 104.1/124: 84% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:12.227 breath V obliterate Fluffy_Pillow 86.1/124: 69% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:13.127 breath S howling_blast Fluffy_Pillow 110.9/124: 89% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:14.027 Waiting     0.269 sec 102.8/124: 83% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:14.296 breath T horn_of_winter Fluffy_Pillow 91.0/124: 73% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:15.197 breath U obliterate Fluffy_Pillow 124.0/124: 100% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:16.096 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(5), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:16.995 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(17), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(6), unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:17.895 breath U obliterate Fluffy_Pillow 101.0/124: 81% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(6), unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:18.797 breath S howling_blast Fluffy_Pillow 103.0/124: 83% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:19.698 breath U obliterate Fluffy_Pillow 93.0/124: 75% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:20.063 trinkets t use_item_blazebinders_hoof Fluffy_Pillow 113.0/124: 91% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage, elemental_potion_of_ultimate_power
0:20.598 breath Y obliterate Fluffy_Pillow 95.0/124: 77% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:21.497 breath R remorseless_winter Fluffy_Pillow 102.0/124: 82% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:22.398 breath S howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:23.298 breath Y obliterate Fluffy_Pillow 94.0/124: 76% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:24.198 Waiting     0.108 sec 114.0/124: 92% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:24.306 breath Y obliterate Fluffy_Pillow 96.0/124: 77% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:25.205 breath S howling_blast Fluffy_Pillow 121.0/124: 98% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:26.107 Waiting     0.199 sec 106.0/124: 85% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:26.306 breath U obliterate Fluffy_Pillow 93.0/124: 75% runic_power
2.0/6: 33% rune
bloodlust, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage, elemental_potion_of_ultimate_power
0:27.343 Waiting     1.964 sec 100.0/124: 81% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:29.307 cooldowns d empower_rune_weapon Fluffy_Pillow 64.0/124: 52% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:29.307 breath V obliterate Fluffy_Pillow 70.2/124: 57% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:30.209 Waiting     0.399 sec 95.0/124: 77% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:30.608 breath U obliterate Fluffy_Pillow 77.0/124: 62% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:31.508 Waiting     1.723 sec 83.8/124: 68% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:33.231 breath a arcane_torrent Fluffy_Pillow 47.8/124: 39% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:34.131 breath V obliterate Fluffy_Pillow 78.8/124: 64% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:35.031 Waiting     0.181 sec 91.8/124: 74% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:35.212 breath V obliterate Fluffy_Pillow 73.8/124: 60% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:36.113 cooldowns h pillar_of_frost Fluffy_Pillow 98.6/124: 80% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, corrupting_rage, elemental_potion_of_ultimate_power
0:36.212 breath V obliterate Fluffy_Pillow 80.6/124: 65% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, corrupting_rage
0:37.114 Waiting     2.261 sec 111.6/124: 90% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, corrupting_rage
0:39.375 breath U obliterate Fluffy_Pillow 70.0/124: 56% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, corrupting_rage
0:40.275 default G antimagic_shell PR_Death_Knight_Frost 76.8/124: 62% runic_power
1.0/6: 17% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:40.275 Waiting     0.995 sec 76.8/124: 62% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:41.270 breath R remorseless_winter Fluffy_Pillow 63.8/124: 51% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
0:42.668 breath U obliterate Fluffy_Pillow 60.8/124: 49% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
0:43.840 breath S howling_blast Fluffy_Pillow 62.8/124: 51% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
0:45.010 breath U obliterate Fluffy_Pillow 64.0/124: 52% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:46.183 breath V obliterate Fluffy_Pillow 70.8/124: 57% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:47.355 breath S howling_blast Fluffy_Pillow 65.8/124: 53% runic_power
1.0/6: 17% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(7), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:48.525 breath V obliterate Fluffy_Pillow 57.7/124: 47% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:49.695 Waiting     1.562 sec 70.7/124: 57% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:51.257 breath U obliterate Fluffy_Pillow 40.9/124: 33% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
0:52.601 breath U obliterate Fluffy_Pillow 47.7/124: 38% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), corrupting_rage
0:53.946 breath U obliterate Fluffy_Pillow 54.7/124: 44% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:55.292 breath S howling_blast Fluffy_Pillow 38.7/124: 31% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:56.636 breath W death_and_decay Fluffy_Pillow 28.7/124: 23% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:57.981 Waiting     0.273 sec 20.7/124: 17% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:58.254 single_target p obliterate Fluffy_Pillow 2.7/124: 2% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
0:59.535 single_target q horn_of_winter Fluffy_Pillow 27.7/124: 22% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:00.818 single_target p obliterate Fluffy_Pillow 58.7/124: 47% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:02.100 single_target k remorseless_winter Fluffy_Pillow 83.5/124: 67% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:03.383 single_target n howling_blast Fluffy_Pillow 95.9/124: 77% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:04.664 default H frost_strike Fluffy_Pillow 105.8/124: 85% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:05.945 single_target p obliterate Fluffy_Pillow 75.8/124: 61% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), gathering_storm, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:07.226 single_target o frost_strike Fluffy_Pillow 100.6/124: 81% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:08.571 single_target s frost_strike Fluffy_Pillow 75.6/124: 61% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:09.917 single_target s frost_strike Fluffy_Pillow 45.6/124: 37% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:11.261 single_target m obliterate Fluffy_Pillow 20.6/124: 17% runic_power
2.0/6: 33% rune
icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, unleashed_frenzy(3), corrupting_rage
1:12.606 single_target n howling_blast Fluffy_Pillow 40.6/124: 33% runic_power
0.0/6: 0% rune
icy_talons(3), killing_machine, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:13.950 single_target s frost_strike Fluffy_Pillow 48.6/124: 39% runic_power
1.0/6: 17% rune
icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:15.295 cooldowns h pillar_of_frost Fluffy_Pillow 18.6/124: 15% runic_power
2.0/6: 33% rune
icy_talons(3), killing_machine(2), bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:15.295 single_target m obliterate Fluffy_Pillow 18.6/124: 15% runic_power
2.0/6: 33% rune
icy_talons(3), killing_machine(2), pillar_of_frost, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:16.641 single_target s frost_strike Fluffy_Pillow 43.6/124: 35% runic_power
0.0/6: 0% rune
icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:17.986 Waiting     1.700 sec 13.6/124: 11% runic_power
1.0/6: 17% rune
icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:19.686 single_target m obliterate Fluffy_Pillow 18.6/124: 15% runic_power
2.0/6: 33% rune
icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:21.031 default G antimagic_shell PR_Death_Knight_Frost 38.6/124: 31% runic_power
1.0/6: 17% rune
icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:21.031 single_target n howling_blast Fluffy_Pillow 38.6/124: 31% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage
1:22.375 single_target k remorseless_winter Fluffy_Pillow 51.6/124: 42% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), overwhelming_rage
1:23.720 default H frost_strike Fluffy_Pillow 66.6/124: 54% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), overwhelming_rage
1:25.063 single_target s frost_strike Fluffy_Pillow 36.6/124: 30% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), overwhelming_rage
1:26.409 Waiting     0.215 sec 11.6/124: 9% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), overwhelming_rage
1:26.624 single_target m obliterate Fluffy_Pillow 11.6/124: 9% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), overwhelming_rage
1:27.968 single_target n howling_blast Fluffy_Pillow 31.6/124: 26% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), overwhelming_rage
1:29.313 single_target m obliterate Fluffy_Pillow 49.6/124: 40% runic_power
2.0/6: 33% rune
icy_talons(3), gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), overwhelming_rage
1:30.658 single_target s frost_strike Fluffy_Pillow 69.6/124: 56% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), overwhelming_rage
1:32.005 single_target m obliterate Fluffy_Pillow 39.6/124: 32% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), overwhelming_rage
1:33.349 single_target s frost_strike Fluffy_Pillow 69.6/124: 56% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), overwhelming_rage
1:34.694 single_target s frost_strike Fluffy_Pillow 44.6/124: 36% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), overwhelming_rage
1:36.038 single_target m obliterate Fluffy_Pillow 14.6/124: 12% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), killing_machine(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), overwhelming_rage
1:37.382 single_target m obliterate Fluffy_Pillow 34.6/124: 28% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:38.727 single_target n howling_blast Fluffy_Pillow 54.6/124: 44% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
1:40.072 single_target p obliterate Fluffy_Pillow 62.6/124: 51% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine(2), bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:41.417 default H frost_strike Fluffy_Pillow 87.4/124: 71% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:42.761 single_target k remorseless_winter Fluffy_Pillow 63.6/124: 51% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine(2), rime, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:44.106 single_target n howling_blast Fluffy_Pillow 76.0/124: 61% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine(2), remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:45.452 single_target s frost_strike Fluffy_Pillow 86.0/124: 69% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm, killing_machine(2), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:46.797 single_target m obliterate Fluffy_Pillow 56.0/124: 45% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm, killing_machine(2), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:48.141 single_target m obliterate Fluffy_Pillow 87.0/124: 70% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
1:49.486 cooldowns h pillar_of_frost Fluffy_Pillow 107.0/124: 86% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:49.486 single_target l frost_strike Fluffy_Pillow 107.0/124: 86% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:50.830 single_target n howling_blast Fluffy_Pillow 82.0/124: 66% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:52.175 single_target p obliterate Fluffy_Pillow 90.0/124: 73% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), corrupting_rage
1:53.521 single_target l frost_strike Fluffy_Pillow 115.0/124: 93% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:54.865 single_target n howling_blast Fluffy_Pillow 90.0/124: 73% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
1:56.209 single_target o frost_strike Fluffy_Pillow 103.0/124: 83% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:57.553 single_target p obliterate Fluffy_Pillow 73.0/124: 59% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
1:58.896 single_target n howling_blast Fluffy_Pillow 104.0/124: 84% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:00.000 trinkets u use_item_dragon_games_equipment Fluffy_Pillow 120.1/124: 97% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:00.240 cooldowns f abomination_limb Fluffy_Pillow 120.1/124: 97% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), enduring_strength_builder(2), unleashed_frenzy(3), dragon_games_equipment, rune_of_hysteria, corrupting_rage
2:01.584 cooldowns j raise_dead Fluffy_Pillow 124.0/124: 100% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, icy_talons(3), killing_machine, rime, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:01.584 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, icy_talons(3), killing_machine, rime, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:02.928 single_target k remorseless_winter Fluffy_Pillow 100.2/124: 81% runic_power
5.0/6: 83% rune
unholy_strength, abomination_limb, icy_talons(3), killing_machine, rime, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:04.274 single_target m obliterate Fluffy_Pillow 118.8/124: 96% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, icy_talons(3), killing_machine(2), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:05.618 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
unholy_strength, abomination_limb, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:06.964 cooldowns i breath_of_sindragosa Fluffy_Pillow 94.0/124: 76% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:06.964 breath S howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
6.0/6: 100% rune
unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:08.310 breath U obliterate Fluffy_Pillow 84.0/124: 68% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine(2), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:09.656 breath S howling_blast Fluffy_Pillow 86.0/124: 69% runic_power
4.0/6: 67% rune
rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:11.001 default G antimagic_shell PR_Death_Knight_Frost 58.0/124: 47% runic_power
4.0/6: 67% rune
rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), overwhelming_rage
2:11.001 breath U obliterate Fluffy_Pillow 58.0/124: 47% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), overwhelming_rage
2:11.964 cooldowns d empower_rune_weapon Fluffy_Pillow 65.0/124: 52% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), overwhelming_rage
2:12.344 breath V obliterate Fluffy_Pillow 70.0/124: 56% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), overwhelming_rage
2:13.514 breath S howling_blast Fluffy_Pillow 72.0/124: 58% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
2:14.685 breath T horn_of_winter Fluffy_Pillow 63.9/124: 52% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
2:15.857 breath V obliterate Fluffy_Pillow 76.9/124: 62% runic_power
3.0/6: 50% rune
antimagic_shell, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
2:17.027 breath V obliterate Fluffy_Pillow 78.1/124: 63% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
2:18.196 breath S howling_blast Fluffy_Pillow 84.9/124: 68% runic_power
2.0/6: 33% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
2:19.367 breath U obliterate Fluffy_Pillow 76.8/124: 62% runic_power
2.0/6: 33% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
2:20.063 trinkets t use_item_blazebinders_hoof Fluffy_Pillow 83.6/124: 67% runic_power
0.0/6: 0% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
2:20.538 breath S howling_blast Fluffy_Pillow 83.6/124: 67% runic_power
0.0/6: 0% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, overwhelming_rage
2:21.709 Waiting     0.306 sec 75.6/124: 61% runic_power
1.0/6: 17% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, overwhelming_rage
2:22.015 breath V obliterate Fluffy_Pillow 63.8/124: 51% runic_power
3.0/6: 50% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, overwhelming_rage
2:23.187 breath R remorseless_winter Fluffy_Pillow 75.6/124: 61% runic_power
1.0/6: 17% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze, overwhelming_rage
2:24.358 breath S howling_blast Fluffy_Pillow 67.6/124: 54% runic_power
2.0/6: 33% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze, overwhelming_rage
2:25.527 breath U obliterate Fluffy_Pillow 62.6/124: 50% runic_power
3.0/6: 50% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), bound_by_fire_and_blaze, overwhelming_rage
2:26.698 Waiting     0.292 sec 69.6/124: 56% runic_power
1.0/6: 17% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze, corrupting_rage
2:26.990 breath V obliterate Fluffy_Pillow 56.6/124: 46% runic_power
3.0/6: 50% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:28.160 cooldowns h pillar_of_frost Fluffy_Pillow 58.6/124: 47% runic_power
2.0/6: 33% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:28.160 breath S howling_blast Fluffy_Pillow 58.6/124: 47% runic_power
2.0/6: 33% rune
rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:29.332 breath V obliterate Fluffy_Pillow 53.6/124: 43% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
2:30.501 breath S howling_blast Fluffy_Pillow 60.6/124: 49% runic_power
0.0/6: 0% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:31.674 Waiting     0.478 sec 50.6/124: 41% runic_power
0.0/6: 0% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:32.152 breath U obliterate Fluffy_Pillow 42.6/124: 34% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(9), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
2:33.498 breath S howling_blast Fluffy_Pillow 44.6/124: 36% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:34.842 breath U obliterate Fluffy_Pillow 34.6/124: 28% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:36.188 breath V obliterate Fluffy_Pillow 23.6/124: 19% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:37.532 breath W death_and_decay Fluffy_Pillow 25.6/124: 21% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:38.875 breath a arcane_torrent Fluffy_Pillow 27.6/124: 22% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
2:40.155 single_target m obliterate Fluffy_Pillow 11.6/124: 9% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
2:41.436 single_target n howling_blast Fluffy_Pillow 31.6/124: 25% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:42.718 single_target m obliterate Fluffy_Pillow 44.6/124: 36% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:44.001 single_target k remorseless_winter Fluffy_Pillow 69.6/124: 56% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, icy_talons(3), killing_machine(2), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:45.283 single_target m obliterate Fluffy_Pillow 79.6/124: 64% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), killing_machine(2), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
2:46.564 default H frost_strike Fluffy_Pillow 104.6/124: 84% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), corrupting_rage
2:47.847 single_target m obliterate Fluffy_Pillow 74.6/124: 60% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:49.193 single_target n howling_blast Fluffy_Pillow 99.4/124: 80% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:50.536 single_target l frost_strike Fluffy_Pillow 109.3/124: 88% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:51.878 default G antimagic_shell PR_Death_Knight_Frost 79.3/124: 64% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), gathering_storm(5), killing_machine(2), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:51.878 single_target m obliterate Fluffy_Pillow 79.3/124: 64% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(5), killing_machine(2), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
2:53.224 single_target m obliterate Fluffy_Pillow 110.3/124: 89% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(7), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
2:54.568 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(9), killing_machine, remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
2:55.910 single_target m obliterate Fluffy_Pillow 100.2/124: 81% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(9), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), overwhelming_rage
2:57.254 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), overwhelming_rage
2:58.599 single_target n howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), killing_machine, rime, bonegrinder_frost, unleashed_frenzy(3), overwhelming_rage
2:59.943 cooldowns h pillar_of_frost Fluffy_Pillow 102.0/124: 82% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine(2), bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:00.160 single_target o frost_strike Fluffy_Pillow 102.0/124: 82% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine(2), pillar_of_frost, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:01.505 single_target m obliterate Fluffy_Pillow 72.0/124: 58% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), killing_machine(2), pillar_of_frost, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:02.848 single_target m obliterate Fluffy_Pillow 96.8/124: 78% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:04.192 single_target k remorseless_winter Fluffy_Pillow 124.0/124: 100% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:05.537 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:06.880 single_target m obliterate Fluffy_Pillow 94.0/124: 76% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:08.226 single_target l frost_strike Fluffy_Pillow 118.8/124: 96% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
3:09.571 single_target n howling_blast Fluffy_Pillow 88.8/124: 72% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
3:10.914 single_target p obliterate Fluffy_Pillow 96.8/124: 78% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), corrupting_rage
3:12.259 single_target l frost_strike Fluffy_Pillow 121.8/124: 98% runic_power
1.0/6: 17% rune
icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:13.601 single_target p obliterate Fluffy_Pillow 91.8/124: 74% runic_power
2.0/6: 33% rune
icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:14.946 single_target l frost_strike Fluffy_Pillow 121.8/124: 98% runic_power
0.0/6: 0% rune
icy_talons(3), gathering_storm(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:16.292 single_target n howling_blast Fluffy_Pillow 91.8/124: 74% runic_power
0.0/6: 0% rune
icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:17.637 single_target l frost_strike Fluffy_Pillow 111.0/124: 90% runic_power
0.0/6: 0% rune
icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:18.981 single_target m obliterate Fluffy_Pillow 81.0/124: 65% runic_power
2.0/6: 33% rune
icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:20.324 single_target l frost_strike Fluffy_Pillow 112.0/124: 90% runic_power
1.0/6: 17% rune
icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
3:21.671 single_target m obliterate Fluffy_Pillow 82.0/124: 66% runic_power
3.0/6: 50% rune
icy_talons(3), killing_machine, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:23.014 single_target l frost_strike Fluffy_Pillow 106.8/124: 86% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:24.359 single_target k remorseless_winter Fluffy_Pillow 76.8/124: 62% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:25.704 single_target n howling_blast Fluffy_Pillow 95.4/124: 77% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:27.049 single_target l frost_strike Fluffy_Pillow 111.5/124: 90% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:28.395 single_target p obliterate Fluffy_Pillow 81.5/124: 66% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), gathering_storm, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:29.739 single_target l frost_strike Fluffy_Pillow 118.7/124: 96% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), gathering_storm(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:31.083 single_target n howling_blast Fluffy_Pillow 88.7/124: 72% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), gathering_storm(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:32.428 single_target p obliterate Fluffy_Pillow 98.6/124: 80% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(4), remorseless_winter, unleashed_frenzy(3), overwhelming_rage
3:33.773 single_target l frost_strike Fluffy_Pillow 118.6/124: 96% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(6), remorseless_winter, rime, unleashed_frenzy(3), overwhelming_rage
3:35.117 single_target n howling_blast Fluffy_Pillow 93.6/124: 76% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), gathering_storm(6), killing_machine, remorseless_winter, rime, unleashed_frenzy(3), overwhelming_rage
3:36.461 single_target m obliterate Fluffy_Pillow 101.6/124: 82% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, unleashed_frenzy(3), corrupting_rage
3:37.806 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
3:39.151 cooldowns h pillar_of_frost Fluffy_Pillow 94.0/124: 76% runic_power
5.0/6: 83% rune
icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), overwhelming_rage
3:39.151 single_target n howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
5.0/6: 83% rune
icy_talons(3), pillar_of_frost, rime, bonegrinder_crit, unleashed_frenzy(3), overwhelming_rage
3:40.494 single_target l frost_strike Fluffy_Pillow 107.0/124: 86% runic_power
5.0/6: 83% rune
icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, bonegrinder_crit, unleashed_frenzy(3), overwhelming_rage
3:41.838 default G antimagic_shell PR_Death_Knight_Frost 77.0/124: 62% runic_power
6.0/6: 100% rune
icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, bonegrinder_crit, unleashed_frenzy(3), overwhelming_rage
3:41.838 single_target m obliterate Fluffy_Pillow 77.0/124: 62% runic_power
6.0/6: 100% rune
antimagic_shell, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, bonegrinder_crit, unleashed_frenzy(3), overwhelming_rage
3:43.182 single_target p obliterate Fluffy_Pillow 97.0/124: 78% runic_power
5.0/6: 83% rune
antimagic_shell, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), overwhelming_rage
3:44.526 single_target k remorseless_winter Fluffy_Pillow 123.2/124: 99% runic_power
3.0/6: 50% rune
antimagic_shell, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:45.870 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:47.215 single_target n howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:48.562 single_target o frost_strike Fluffy_Pillow 103.9/124: 84% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), gathering_storm, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:49.905 single_target p obliterate Fluffy_Pillow 73.9/124: 60% runic_power
2.0/6: 33% rune
icy_talons(3), gathering_storm, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
3:51.249 single_target l frost_strike Fluffy_Pillow 111.1/124: 90% runic_power
1.0/6: 17% rune
icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), overwhelming_rage
3:52.594 single_target p obliterate Fluffy_Pillow 81.1/124: 65% runic_power
4.0/6: 67% rune
icy_talons(3), gathering_storm(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), overwhelming_rage
3:53.938 single_target o frost_strike Fluffy_Pillow 101.1/124: 82% runic_power
2.0/6: 33% rune
icy_talons(3), gathering_storm(5), remorseless_winter, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:55.281 single_target p obliterate Fluffy_Pillow 76.1/124: 61% runic_power
3.0/6: 50% rune
icy_talons(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:56.628 single_target n howling_blast Fluffy_Pillow 96.1/124: 78% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), rime, enduring_strength, unleashed_frenzy(3), corrupting_rage
3:57.973 single_target l frost_strike Fluffy_Pillow 104.1/124: 84% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
3:59.320 single_target p obliterate Fluffy_Pillow 79.1/124: 64% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:00.000 trinkets u use_item_dragon_games_equipment Fluffy_Pillow 99.1/124: 80% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), enduring_strength, unleashed_frenzy(3), corrupting_rage
4:00.664 cooldowns f abomination_limb Fluffy_Pillow 99.1/124: 80% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), corrupting_rage
4:02.007 cooldowns j raise_dead Fluffy_Pillow 99.1/124: 80% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons(3), killing_machine, rime, unleashed_frenzy(3), corrupting_rage
4:02.007 single_target m obliterate Fluffy_Pillow 99.1/124: 80% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons(3), killing_machine, rime, unleashed_frenzy(3), corrupting_rage
4:03.351 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:04.697 single_target k remorseless_winter Fluffy_Pillow 99.0/124: 80% runic_power
2.0/6: 33% rune
unholy_strength, abomination_limb, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:06.043 single_target l frost_strike Fluffy_Pillow 109.0/124: 88% runic_power
1.0/6: 17% rune
unholy_strength, abomination_limb, icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:07.386 cooldowns i breath_of_sindragosa Fluffy_Pillow 79.0/124: 64% runic_power
1.0/6: 17% rune
unholy_strength, abomination_limb, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:07.386 breath S howling_blast Fluffy_Pillow 79.0/124: 64% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:08.730 breath U obliterate Fluffy_Pillow 79.0/124: 64% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), corrupting_rage
4:10.075 breath Y obliterate Fluffy_Pillow 86.0/124: 69% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:11.419 breath V obliterate Fluffy_Pillow 74.8/124: 60% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:12.764 breath S howling_blast Fluffy_Pillow 87.8/124: 71% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(7), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:14.108 breath T horn_of_winter Fluffy_Pillow 85.9/124: 69% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:15.452 breath V obliterate Fluffy_Pillow 80.9/124: 65% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:16.797 breath S howling_blast Fluffy_Pillow 87.7/124: 71% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:18.140 cooldowns h pillar_of_frost Fluffy_Pillow 79.6/124: 64% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:18.140 breath V obliterate Fluffy_Pillow 79.6/124: 64% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), corrupting_rage
4:19.484 breath S howling_blast Fluffy_Pillow 63.6/124: 51% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
4:20.063 trinkets t use_item_blazebinders_hoof Fluffy_Pillow 71.6/124: 58% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), corrupting_rage
4:20.827 breath V obliterate Fluffy_Pillow 53.6/124: 43% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:22.172 default G antimagic_shell PR_Death_Knight_Frost 60.6/124: 49% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:22.172 breath V obliterate Fluffy_Pillow 60.6/124: 49% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:22.460 cooldowns d empower_rune_weapon Fluffy_Pillow 62.6/124: 51% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:23.516 breath V obliterate Fluffy_Pillow 54.6/124: 44% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:24.686 breath R remorseless_winter Fluffy_Pillow 56.6/124: 46% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(9), bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:25.867 Waiting     1.674 sec 48.6/124: 39% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), corrupting_rage
4:27.541 breath U obliterate Fluffy_Pillow 27.6/124: 22% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:28.713 Waiting     0.185 sec 29.6/124: 24% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:28.898 breath U obliterate Fluffy_Pillow 29.6/124: 24% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:30.066 breath U obliterate Fluffy_Pillow 36.6/124: 30% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:31.238 breath S howling_blast Fluffy_Pillow 38.6/124: 31% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), corrupting_rage
4:32.408 single_target p obliterate Fluffy_Pillow 10.6/124: 9% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons(3), gathering_storm(7), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:33.579 single_target p obliterate Fluffy_Pillow 35.6/124: 29% runic_power
4.0/6: 67% rune
unholy_strength, empower_rune_weapon, icy_talons(3), gathering_storm(9), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:34.750 single_target n howling_blast Fluffy_Pillow 60.6/124: 49% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), corrupting_rage
4:35.920 single_target p obliterate Fluffy_Pillow 73.6/124: 59% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, corrupting_rage
4:37.091 single_target s frost_strike Fluffy_Pillow 98.4/124: 79% runic_power
1.0/6: 17% rune
unholy_strength, empower_rune_weapon, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, corrupting_rage
4:38.262 single_target p obliterate Fluffy_Pillow 87.0/124: 70% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, corrupting_rage
4:39.434 single_target l frost_strike Fluffy_Pillow 118.0/124: 95% runic_power
0.0/6: 0% rune
unholy_strength, empower_rune_weapon, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, overwhelming_rage
4:40.605 single_target m obliterate Fluffy_Pillow 88.0/124: 71% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
4:41.776 single_target l frost_strike Fluffy_Pillow 119.0/124: 96% runic_power
1.0/6: 17% rune
unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
4:42.946 single_target m obliterate Fluffy_Pillow 95.2/124: 77% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
4:44.291 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), overwhelming_rage
4:45.635 single_target k remorseless_winter Fluffy_Pillow 99.0/124: 80% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), overwhelming_rage
4:46.979 single_target l frost_strike Fluffy_Pillow 109.0/124: 88% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), overwhelming_rage
4:48.324 single_target m obliterate Fluffy_Pillow 79.0/124: 64% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), overwhelming_rage
4:49.668 single_target n howling_blast Fluffy_Pillow 104.0/124: 84% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), overwhelming_rage
4:51.012 single_target l frost_strike Fluffy_Pillow 117.0/124: 94% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
4:52.358 cooldowns g pillar_of_frost Fluffy_Pillow 93.2/124: 75% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
4:52.358 single_target p obliterate Fluffy_Pillow 93.2/124: 75% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), gathering_storm(3), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
4:53.702 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, overwhelming_rage
4:55.046 single_target o frost_strike Fluffy_Pillow 100.2/124: 81% runic_power
5.0/6: 83% rune
rune_mastery, icy_talons(3), gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:56.390 single_target p obliterate Fluffy_Pillow 70.2/124: 57% runic_power
5.0/6: 83% rune
rune_mastery, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:57.735 single_target n howling_blast Fluffy_Pillow 95.0/124: 77% runic_power
4.0/6: 67% rune
icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, corrupting_rage
4:59.079 single_target l frost_strike Fluffy_Pillow 104.9/124: 85% runic_power
5.0/6: 83% rune
icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), corrupting_rage

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5770 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3848 0 13616 12968 6959
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 272320 259360 0
Runic Power 124 124 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 30.85% 24.64% 2995
Haste 11.86% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 6058 5598 0
Mastery 45.29% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +687 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +111 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +386 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA
dragonflight.player.ominous_chromatic_essence_dragonflight=obsidian
dragonflight.player.ashkandur_humanoid=

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=3,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
actions+=/invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
actions+=/antimagic_shell,if=runic_power.deficit>40
actions+=/antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up&cooldown.empower_rune_weapon.charges<2|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up)
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/howling_blast,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&buff.rime.react
actions.obliteration+=/frost_strike,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd
actions.obliteration+=/glacial_advance,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!death_knight.runeforge.razorice&!buff.killing_machine.react&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(rune<2|variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&!buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frost_strike,if=buff.killing_machine.stack<2&runic_power.deficit<20&!variable.2h_check
actions.single_target+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

actions.trinkets=use_item,use_off_gcd=1,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=6959
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 50498 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
50497.7 50497.7 46.6 / 0.092% 7645.9 / 15.1% 3212.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.8 7.9 Runic Power 1.80% 54.6 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 50498
Apocalypse 218 0.4% 6.9 46.08sec 9541 7840 Direct 6.9 7966 15946 9541 19.7%

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.85 6.85 0.00 0.00 0.00 1.2171 0.0000 65399.99 65399.99 0.00% 7839.85 7839.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.26% 5.50 1 8 7965.60 6078 10593 7964.24 6686 9108 43827 43827 0.00%
crit 19.74% 1.35 0 6 15946.31 13093 21187 12354.95 0 21187 21573 21573 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for each burst Festering Wound. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [T]:5.86
  • if_expr:variable.st_planning&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [X]:1.00
  • if_expr:debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<21|!talent.commander_of_the_dead)
auto_attack_mh 2855 5.7% 154.5 2.34sec 5541 2385 Direct 154.5 4627 9253 5541 19.8%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 154.47 154.47 0.00 0.00 0.00 2.3236 0.0000 855920.36 1222774.55 30.00% 2384.65 2384.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.24% 123.95 86 164 4627.11 3725 6467 4626.57 4391 4840 573547 819373 30.00%
crit 19.76% 30.52 12 54 9252.55 7451 12934 9251.52 8462 10141 282374 403401 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 91 0.2% 2.0 0.00sec 13483 0 Direct 2.0 11252 22313 13483 20.2%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 26966.85 26966.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.82% 1.60 0 2 11251.50 10112 14636 10828.63 0 14419 17963 17963 0.00%
crit 20.18% 0.40 0 2 22313.34 20224 29271 8143.13 0 29271 9004 9004 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}
Clawing Shadows 5917 11.8% 73.5 3.94sec 24136 21274 Direct 73.5 20179 40359 24136 19.6%

Stats Details: Clawing Shadows

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 73.48 73.48 0.00 0.00 0.00 1.1346 0.0000 1773652.00 1773652.00 0.00% 21273.95 21273.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.39% 59.07 37 83 20179.05 10357 36711 20197.37 17393 23059 1192057 1192057 0.00%
crit 19.61% 14.41 2 30 40358.91 20714 73423 40394.22 28616 56570 581595 581595 0.00%

Action Details: Clawing Shadows

  • id:207311
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207311
  • name:Clawing Shadows
  • school:shadow
  • tooltip:
  • description:Deals {$s2=0} Shadow damage and causes 1 Festering Wound to burst.

Action Priority List

    generic
    [g]:73.49
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
Dark Transformation 204 0.4% 6.9 46.11sec 8814 6948 Direct 6.9 7356 14708 8814 19.8%

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.95 6.95 0.00 0.00 0.00 1.2686 0.0000 61236.05 61236.05 0.00% 6948.38 6948.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.17% 5.57 1 8 7355.74 5764 9720 7351.95 5981 8470 40968 40968 0.00%
crit 19.83% 1.38 0 6 14707.77 11963 19146 11508.66 0 19146 20268 20268 0.00%

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [S]:5.95
  • if_expr:cooldown.apocalypse.remains<5
    garg_setup
    [b]:1.00
  • if_expr:talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
Death and Decay 236 0.5% 8.4 37.29sec 8419 7562 Direct 91.0 650 1299 778 19.8%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.41 91.03 0.00 0.00 0.00 1.1133 0.0000 70837.27 70837.27 0.00% 7562.43 7562.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.25% 73.05 44 106 649.87 457 970 650.41 601 704 47473 47473 0.00%
crit 19.75% 17.98 4 38 1299.21 942 1939 1300.33 1126 1486 23364 23364 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    garg_setup
    [c]:1.00
  • if_expr:!death_and_decay.ticking&debuff.festering_wound.stack>0
    generic
    [f]:7.41
  • if_expr:!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=10|pet.gargoyle.active&pet.gargoyle.remains>5|pet.army_ghoul.active&pet.army_ghoul.remains>5))&death_knight.fwounded_targets=active_enemies
Death Coil 5641 (7304) 11.2% (14.5%) 99.5 2.99sec 21992 19039 Direct 99.4 (235.4) 14204 28388 16993 19.7% (19.7%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 99.47 99.43 0.00 0.00 0.00 1.1551 0.0000 1689595.30 1689595.30 0.00% 19038.84 19038.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.34% 79.88 50 106 14204.33 8993 22473 14214.26 13357 15234 1134599 1134599 0.00%
crit 19.66% 19.55 5 36 28387.78 19151 44315 28404.14 24180 33396 554997 554997 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Priority List

    generic
    [e]:92.41
  • if_expr:!variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
    high_prio_actions
    [k]:7.07
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
    Coil of Devastation 1663 3.3% 0.0 0.00sec 0 0 Periodic 135.9 3664 0 3664 0.0% 90.6%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 135.93 135.93 84.39 0.0000 2.0000 498082.17 498082.17 0.00% 1832.18 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 135.93 106 168 3664.35 1349 15585 3671.01 3118 4372 498082 498082 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 938 1.9% 7.0 47.15sec 39895 0 Direct 7.0 33373 66746 39923 19.6%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.04 7.04 0.00 0.00 0.00 0.0000 0.0000 280945.33 401360.70 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.37% 5.66 0 9 33373.08 33373 33373 33364.18 0 33373 188752 269653 29.99%
crit 19.63% 1.38 0 7 66746.15 66746 66746 51196.68 0 66746 92193 131708 23.01%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1098 2.2% 25.0 11.96sec 13192 11007 Direct 25.0 11008 22000 13192 19.9%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.97 24.97 0.00 0.00 0.00 1.1985 0.0000 329457.69 470665.84 30.00% 11007.24 11007.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.13% 20.01 9 32 11008.13 8211 18050 10997.20 9884 12289 220294 314713 30.00%
crit 19.87% 4.96 0 15 21999.57 16421 35571 21895.43 0 32579 109164 155953 29.88%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [d]:1.59
  • if_expr:debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40
    generic
    [h]:23.38
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
Festering Wound 1895 3.8% 100.9 3.65sec 5629 0 Direct 100.9 4701 9407 5629 19.7%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 100.90 100.90 0.00 0.00 0.00 0.0000 0.0000 567981.77 567981.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.29% 81.02 51 113 4701.41 3322 7559 4702.58 4413 4952 380898 380898 0.00%
crit 19.71% 19.89 8 41 9407.45 6643 15118 9410.63 8104 11323 187083 187083 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}
Outbreak 79 0.2% 11.6 27.05sec 2046 1731 Direct 11.6 1710 3404 2046 19.9%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.1821 0.0000 23787.94 23787.94 0.00% 1731.17 1731.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.13% 9.31 2 14 1709.76 1313 2591 1710.53 1415 1951 15925 15925 0.00%
crit 19.87% 2.31 0 11 3403.56 2674 5182 3131.77 0 5182 7863 7863 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    high_prio_actions
    [l]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
Soul Reaper 576 (3349) 1.1% (6.7%) 15.6 6.86sec 64384 52874 Direct 15.6 (31.3) 9261 18514 11075 19.6% (19.5%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.63 15.63 0.00 0.00 0.00 1.2177 0.0000 173130.27 173130.27 0.00% 52874.36 52874.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.39% 12.57 4 20 9260.86 5751 13066 9268.60 8258 10320 116384 116384 0.00%
crit 19.61% 3.06 0 10 18514.47 11503 25399 17783.86 0 25031 56746 56746 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [W]:15.63
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
    Soul Reaper (_execute) 2773 5.5% 15.6 6.87sec 53332 0 Direct 15.6 44643 89385 53333 19.4%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.63 15.63 0.00 0.00 0.00 0.0000 0.0000 833333.11 833333.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 12.59 4 20 44642.88 35454 59531 44686.29 40733 49124 562081 562081 0.00%
crit 19.42% 3.03 0 10 89385.12 72220 120727 85823.79 0 117388 271252 271252 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}
Unholy Assault 197 0.4% 3.6 91.69sec 16283 13952 Direct 3.6 13568 27181 16282 19.9%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.64 3.64 0.00 0.00 0.00 1.1672 0.0000 59196.76 59196.76 0.00% 13951.63 13951.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.06% 2.91 0 4 13568.10 11318 16466 13506.94 0 16466 39490 39490 0.00%
crit 19.94% 0.73 0 4 27180.88 22636 32932 15034.78 0 32932 19707 19707 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [V]:3.53
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [a]:0.11
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=21
Virulent Plague 844 1.7% 11.6 27.05sec 21773 0 Periodic 99.5 2123 4247 2544 19.8% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.50 99.50 10.62 0.0000 3.0000 253099.57 253099.57 0.00% 847.94 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.21% 79.80 52 106 2123.45 1520 3505 2123.63 2021 2263 169461 169461 0.00%
crit 19.79% 19.69 6 41 4247.36 3069 7011 4248.45 3833 4835 83639 83639 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.125000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.
pet - ghoul 6346 / 6346
auto_attack 4553 9.0% 195.4 1.53sec 6973 4554 Direct 195.4 5825 11656 6973 19.7%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 195.40 195.40 0.00 0.00 0.00 1.5312 0.0000 1362598.69 1946619.19 30.00% 4554.32 4554.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.31% 156.92 109 203 5825.23 2022 12720 5834.76 5183 6572 914107 1305901 30.00%
crit 19.69% 38.48 14 66 11655.77 4044 25439 11673.18 7951 16677 448491 640718 30.00%

Action Details: Auto Attack

  • id:0
  • school:none
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:1.00
Claw 336 0.7% 38.1 8.01sec 2651 2639 Direct 38.1 2216 4427 2651 19.7%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.12 38.12 0.00 0.00 0.00 1.0045 0.0000 101054.61 144367.41 30.00% 2639.40 2639.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.30% 30.61 16 45 2215.56 1820 7485 2213.17 2013 2433 67808 96871 30.00%
crit 19.70% 7.51 0 20 4426.53 3639 14258 4420.47 0 5960 33246 47496 29.99%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:38.12
  • if_expr:energy>70
Gnaw 1 0.0% 3.7 90.14sec 95 95 Direct 3.7 79 159 95 20.1%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0045 0.0000 355.55 507.94 30.00% 94.91 94.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.85% 2.98 0 4 79.36 64 103 79.12 0 100 236 338 29.91%
crit 20.15% 0.75 0 4 158.61 129 206 89.82 0 200 119 170 17.00%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:3.73
Sweeping Claws 1456 2.9% 69.2 4.23sec 6293 6265 Direct 69.2 5256 10526 6293 19.7%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 69.22 69.22 0.00 0.00 0.00 1.0045 0.0000 435566.01 435566.01 0.00% 6264.79 6264.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.33% 55.60 36 78 5256.35 3899 8177 5260.02 4905 5699 292252 292252 0.00%
crit 19.67% 13.62 3 29 10525.90 7798 16354 10531.94 9071 12947 143314 143314 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:69.22
pet - gargoyle 28099 / 4744
Gargoyle Strike 28099 9.3% 32.0 6.62sec 43907 32905 Direct 32.0 36681 73183 43907 19.8%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.00 32.00 0.00 0.00 0.00 1.3344 0.0000 1404966.31 1404966.31 0.00% 32904.73 32904.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.20% 25.66 14 32 36680.82 9667 81210 36682.38 30042 44771 941359 941359 0.00%
crit 19.80% 6.33 0 18 73182.98 20586 157910 73153.80 0 130611 463607 463607 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.
pet - army_ghoul 26937 / 5956
auto_attack 22523 9.8% 367.8 0.82sec 4011 3650 Direct 367.8 3350 6697 4011 19.7%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 367.81 367.81 0.00 0.00 0.00 1.0990 0.0000 1475219.85 2107510.67 30.00% 3649.68 3649.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.26% 295.18 239 327 3350.06 1587 4494 3349.63 2867 3569 988887 1412732 30.00%
crit 19.74% 72.62 43 109 6696.79 3175 8989 6694.54 5466 7296 486333 694779 30.00%

Action Details: Auto Attack

  • id:0
  • school:none
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:2.00
Claw 4414 1.9% 221.7 1.44sec 1304 1304 Direct 221.7 1089 2174 1304 19.8%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 221.73 221.73 0.00 0.00 0.00 1.0000 0.0000 289084.48 412988.36 30.00% 1303.75 1303.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.18% 177.79 150 202 1088.74 530 1502 1088.61 920 1170 193564 276528 30.00%
crit 19.82% 43.95 22 69 2173.54 1061 3004 2173.34 1797 2416 95520 136461 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:27.82
    default
    [ ]:27.84
    default
    [ ]:28.86
    default
    [ ]:28.82
    default
    [ ]:27.08
    default
    [ ]:27.30
    default
    [ ]:27.08
    default
    [ ]:26.94
pet - magus_of_the_dead 7626 / 3862
Frostbolt 1509 1.5% 27.9 10.79sec 8179 5641 Direct 27.9 6844 13667 8182 19.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.91 27.90 0.00 0.00 0.00 1.4499 0.0000 228261.89 228261.89 0.00% 5641.11 5641.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.39% 22.43 13 31 6844.24 3697 10180 6846.76 6213 7444 153485 153485 0.00%
crit 19.61% 5.47 0 16 13667.23 7752 20360 13646.05 0 19796 74777 74777 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:14.01
    default
    [ ]:13.99
Shadow Bolt 6117 6.1% 112.3 2.60sec 8220 6503 Direct 112.3 6869 13735 8223 19.7%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.32 112.29 0.00 0.00 0.00 1.2642 0.0000 923316.81 923316.81 0.00% 6502.55 6502.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.28% 90.15 67 117 6869.14 3477 9839 6872.34 6314 7501 619253 619253 0.00%
crit 19.72% 22.14 6 40 13734.83 6953 19678 13737.92 11960 16032 304063 304063 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:60.57
    default
    [ ]:60.50
pet - apoc_ghoul 9874 / 4362
auto_attack 8068 7.1% 290.9 3.84sec 3668 2706 Direct 290.9 3066 6129 3668 19.7%

Stats Details: Auto Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 290.89 290.89 0.00 0.00 0.00 1.3553 0.0000 1066929.90 1524224.44 30.00% 2706.15 2706.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.35% 233.73 169 301 3065.74 1764 4494 3069.12 2793 3297 716563 1023687 30.00%
crit 19.65% 57.16 18 98 6129.29 3529 8989 6135.58 5401 6847 350367 500537 30.00%

Action Details: Auto Attack

  • id:0
  • school:none
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [ ]:6.77
Claw 1807 1.6% 198.4 5.68sec 1204 1204 Direct 198.4 1006 2013 1204 19.7%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 198.43 198.43 0.00 0.00 0.00 1.0000 0.0000 238954.77 341372.67 30.00% 1204.23 1204.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.34% 159.42 108 208 1006.36 591 1502 1007.49 924 1086 160439 229204 30.00%
crit 19.66% 39.01 14 70 2012.96 1240 3004 2015.15 1782 2294 78516 112169 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:49.61
    default
    [ ]:49.61
    default
    [ ]:49.61
    default
    [ ]:49.61
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Algeth'ar Puzzle (_box_channel) 2.0 0.00sec

Stats Details: Algethar Puzzle Box Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 2.00 0.00 0.00 1.5585 1.5585 0.00 0.00 0.00% 0.00 0.00

Action Details: Algethar Puzzle Box Channel

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
Anti-Magic Shell 7.1 44.53sec

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 7.08 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    default
    [G]:7.08
  • if_expr:runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
Army of the Dead 2.0 0.00sec

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6620 0.4688 0.00 0.00 0.00% 0.00 0.00

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    high_prio_actions
    [j]:1.00
  • if_expr:talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 184.36sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [m]:2.00
  • if_expr:(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
Empower Rune Weapon 2.4 169.33sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.38 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [U]:2.27
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=21|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
    garg_setup
    [Z]:0.11
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=21
Iced Phial of Corrupting Rage 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Outbreak (_aoe) 11.6 27.05sec

Stats Details: Outbreak Aoe

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Outbreak Aoe

  • id:196780
  • school:shadow
  • range:200.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196780
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:{$@spelldesc77575=Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}}
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    high_prio_actions
    [i]:1.50
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Raise Dead 1.0 0.00sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
Summon Gargoyle 2.0 185.38sec

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [R]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead
    garg_setup
    [Y]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
Unholy Strength 21.8 13.39sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 21.83 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 181.8sec 181.8sec 30.0sec 20.27% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2015.79
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2015.79

Trigger Details

  • interval_min/max:181.8s / 182.2s
  • trigger_min/max:181.8s / 182.2s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • algethar_puzzle_1:20.27%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1089} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Anti-Magic Shell 7.1 0.0 44.5sec 44.5sec 6.9sec 16.40% 0.00% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 110.8s
  • trigger_min/max:40.0s / 110.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s

Stack Uptimes

  • antimagic_shell_1:16.40%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Berserking 2.0 0.0 184.4sec 184.4sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 189.6s
  • trigger_min/max:180.0s / 189.6s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Commander of the Dead 6.9 0.0 46.1sec 46.1sec 28.6sec 66.19% 89.65% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 60.1s
  • trigger_min/max:45.0s / 60.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:66.19%

Spelldata

  • id:390260
  • name:Commander of the Dead
  • tooltip:Your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead ghouls deal {$390264s1=35}% increased damage.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Corrupting Rage 6.9 0.0 45.0sec 44.0sec 31.3sec 69.89% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 312.0s
  • trigger_min/max:15.0s / 271.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 297.0s

Stack Uptimes

  • corrupting_rage_1:69.89%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Transformation 6.9 0.0 46.1sec 46.1sec 22.5sec 52.28% 58.45% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 60.1s
  • trigger_min/max:45.0s / 60.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.0s

Stack Uptimes

  • dark_transformation_1:52.28%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Dragon Games Equipment 2.8 0.0 120.0sec 120.0sec 0.8sec 0.71% 0.00% 7.0 (7.0) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.62
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.0s
  • trigger_min/max:120.0s / 120.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.9s

Stack Uptimes

  • dragon_games_equipment_1:0.71%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 300.3sec 0.0sec 27.5sec 13.46% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 327.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.46%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 169.4sec 169.4sec 19.3sec 15.22% 0.00% 6.9 (6.9) 2.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 189.7s
  • trigger_min/max:120.0s / 189.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:15.22%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Festermight 13.1 67.2 23.2sec 3.7sec 19.3sec 84.35% 0.00% 0.0 (0.0) 12.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 41.6s
  • trigger_min/max:0.8s / 26.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • festermight_1:7.84%
  • festermight_2:8.14%
  • festermight_3:8.69%
  • festermight_4:15.80%
  • festermight_5:10.88%
  • festermight_6:9.91%
  • festermight_7:7.84%
  • festermight_8:5.52%
  • festermight_9:4.21%
  • festermight_10:2.55%
  • festermight_11:1.26%
  • festermight_12:0.79%
  • festermight_13:0.50%
  • festermight_14:0.34%
  • festermight_15:0.07%
  • festermight_16:0.00%
  • festermight_17:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 98.5 157.2sec 3.0sec 292.6sec 98.53% 0.00% 96.4 (96.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:46.4s / 321.6s
  • trigger_min/max:0.8s / 15.6s
  • trigger_pct:100.00%
  • duration_min/max:24.0s / 355.6s

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.85%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Overwhelming Rage 6.2 0.0 44.2sec 44.2sec 14.6sec 30.11% 0.00% 24.1 (24.1) 5.9

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_overwhelming_rage
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 300.0s
  • trigger_min/max:15.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • overwhelming_rage_1:30.11%

Spelldata

  • id:374037
  • name:Overwhelming Rage
  • tooltip:Suffering {$=}w1% of your maximum health as Frost damage every $t sec.
  • description:
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Rune Mastery 12.1 8.3 24.6sec 14.2sec 10.7sec 42.94% 0.00% 8.3 (8.3) 11.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 172.6s
  • trigger_min/max:0.8s / 172.6s
  • trigger_pct:14.99%
  • duration_min/max:0.0s / 63.6s

Stack Uptimes

  • rune_mastery_1:42.94%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 41.8 6.0 7.1sec 6.2sec 2.6sec 36.21% 0.00% 6.0 (6.0) 41.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 65.7s
  • trigger_min/max:0.8s / 65.7s
  • trigger_pct:48.05%
  • duration_min/max:0.0s / 21.6s

Stack Uptimes

  • runic_corruption_1:36.21%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 21.1 0.2 13.8sec 13.7sec 1.0sec 7.11% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.3s / 57.0s
  • trigger_min/max:1.3s / 57.0s
  • trigger_pct:14.20%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • sudden_doom_1:7.11%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.6 0.0 91.7sec 91.7sec 19.5sec 23.66% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.8s
  • trigger_min/max:90.0s / 97.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • unholy_assault_1:23.66%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Ground 8.4 0.0 37.3sec 37.3sec 9.8sec 27.55% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 92.7s
  • trigger_min/max:10.0s / 92.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.7s

Stack Uptimes

  • unholy_ground_1:27.55%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 13.4 36.1sec 13.4sec 24.7sec 69.58% 0.00% 13.4 (13.4) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 169.0s
  • trigger_min/max:0.0s / 59.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 160.6s

Stack Uptimes

  • unholy_strength_1:69.58%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 184.4sec 184.4sec 24.5sec 98.05% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.3s / 189.0s
  • trigger_min/max:181.3s / 189.0s
  • trigger_pct:100.00%
  • duration_min/max:24.0s / 25.0s

Stack Uptimes

  • dark_empowerment_1:98.05%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 25.8 5.0 46.0 11.4s 1.3s 115.4s
Rune ready 158.2 119.0 199.0 2.0s 0.0s 12.7s
Runic Corruption from Runic Power Spent 47.8 25.0 75.0 6.2s 0.8s 65.7s
Festering Wound from Festering Strike 62.4 43.0 92.0 12.0s 1.2s 74.0s
Festering Wound from Infected Claws 32.2 13.0 56.0 9.2s 1.0s 103.1s
Festering Wound from Unholy Assault 14.5 12.0 16.0 91.7s 90.0s 97.8s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.95% 0.00% 13.31% 2.0s 0.0s 20.4s
ghoul - Energy Cap 0.53% 0.04% 1.52% 0.2s 0.0s 1.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Raise Dead0.0000.0000.000300.000240.015359.992
Army of the Dead3.7700.000140.0237.5410.000140.023
Summon Gargoyle4.3792.2269.9868.7585.58013.339
Apocalypse2.1420.00015.12914.7368.46426.798
Unholy Assault3.7310.0009.24513.5688.91220.262
Dark Transformation1.4380.00015.08810.0034.77421.481
Empower Rune Weapon32.4400.00069.72577.15770.333100.947
Death and Decay6.9360.00062.70260.43234.462111.072
Soul Reaper13.0480.000232.171206.293157.631252.120

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=316517)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1111.870 / 1.1096.33725.326
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
38.09455.60978.913 / 77.742106.221153.388

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
ApocalypseRune13.7112.587.95%0.921.138.23%
Empower Rune WeaponRunic Power11.4056.642.38%4.970.350.62%
Empower Rune WeaponRune11.4010.136.40%0.891.2711.15%
Festering WoundRunic Power100.91295.1812.41%2.937.542.49%
Rune RegenerationRune135.52135.5285.65%1.000.000.00%
Runic AttenuationRunic Power75.42366.7315.42%4.8610.362.75%
Army of the DeadRunic Power2.0019.810.83%9.900.190.97%
Clawing ShadowsRunic Power73.49718.6830.23%9.7816.182.20%
Death and DecayRunic Power8.4182.863.48%9.851.281.52%
Festering StrikeRunic Power24.97483.0120.31%19.3416.453.29%
OutbreakRunic Power11.62113.144.76%9.733.112.67%
Soul ReaperRunic Power15.63149.496.29%9.566.834.37%
Summon GargoyleRunic Power2.0092.083.87%46.047.927.92%
pet - ghoul
Dark TransformationEnergy6.95337.527.99%48.58357.2451.42%
energy_regenEnergy1334.773888.1592.01%2.9129.280.75%
pet - army_ghoul
energy_regenEnergy921.567581.23100.00%8.23725.088.73%
pet - apoc_ghoul
energy_regenEnergy730.005817.44100.00%7.971758.0523.21%
Usage Type Count Total Tot% Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.24%1.001.000.00
Clawing ShadowsRune 73.4973.4945.61%1.001.0024135.94
Death and DecayRune 8.418.415.22%1.001.008419.30
Death CoilRunic Power 99.472351.99100.00%23.6423.64930.14
Festering StrikeRune 24.9749.9531.00%2.002.006596.22
OutbreakRune 11.6211.627.22%1.001.002046.39
Soul ReaperRune 15.6315.639.70%1.001.0064383.51
pet - ghoul
ClawEnergy 38.121524.6435.51%40.0040.0066.28
Sweeping ClawsEnergy 69.222768.6364.49%40.0040.00157.32
pet - army_ghoul
ClawEnergy 221.738869.31100.00%40.0040.0032.59
pet - apoc_ghoul
ClawEnergy 198.437937.27100.00%40.0040.0030.11
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 8.0 7.93 7.85 70.2 23.6 0.0 75.0
Rune 5.0 0.53 0.54 0.0 3.1 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 50497.72
Minimum 44864.55
Maximum 56884.30
Spread ( max - min ) 12019.75
Range [ ( max - min ) / 2 * 100% ] 11.90%
Standard Deviation 2059.5358
5th Percentile 47438.66
95th Percentile 54116.85
( 95th Percentile - 5th Percentile ) 6678.19
Mean Distribution
Standard Deviation 23.7831
95.00% Confidence Interval ( 50451.11 - 50544.34 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6390
0.1 Scale Factor Error with Delta=300 36210
0.05 Scale Factor Error with Delta=300 144838
0.01 Scale Factor Error with Delta=300 3620949
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 50497.72
Minimum 44864.55
Maximum 56884.30
Spread ( max - min ) 12019.75
Range [ ( max - min ) / 2 * 100% ] 11.90%
Standard Deviation 2059.5358
5th Percentile 47438.66
95th Percentile 54116.85
( 95th Percentile - 5th Percentile ) 6678.19
Mean Distribution
Standard Deviation 23.7831
95.00% Confidence Interval ( 50451.11 - 50544.34 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6390
0.1 Scale Factor Error with Delta=300 36210
0.05 Scale Factor Error with Delta=300 144838
0.01 Scale Factor Error with Delta=300 3620949
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 50497.72
Minimum 44864.55
Maximum 56884.30
Spread ( max - min ) 12019.75
Range [ ( max - min ) / 2 * 100% ] 11.90%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 7562622.41
Minimum 5626042.85
Maximum 9422236.33
Spread ( max - min ) 3796193.48
Range [ ( max - min ) / 2 * 100% ] 25.10%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2
6 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
7 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
A 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
B 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
C 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
D 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
E 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Default action list Executed every time the actor is available.
# count action,conditions
F 1.00 auto_attack
0.00 mind_freeze,if=target.debuff.casting.react
G 7.08 antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
0.00 antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle)
0.00 variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
Variables
0.00 variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle|time>20
0.00 variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
0.00 variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
0.00 variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4)|fight_remains<5&debuff.festering_wound.stack>=1
0.00 variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
0.00 variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
0.00 variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
0.00 invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=20|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))|fight_remains<=21
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
H 0.00 call_action_list,name=high_prio_actions
Call Action Lists
I 0.00 call_action_list,name=trinkets
J 0.00 run_action_list,name=garg_setup,if=variable.garg_setup=0
K 0.00 call_action_list,name=cooldowns,if=variable.st_planning
L 0.00 call_action_list,name=aoe_cooldowns,if=variable.adds_remain
M 0.00 call_action_list,name=racials
N 0.00 call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
O 0.00 call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
P 0.00 call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
Q 0.00 call_action_list,name=generic,if=active_enemies<=3
actions.cooldowns
# count action,conditions
R 1.00 summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
ST/Cleave Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
S 5.95 dark_transformation,if=cooldown.apocalypse.remains<5
T 5.86 apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
U 2.27 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=21|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 abomination_limb,if=rune<3&variable.st_planning
V 3.53 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
W 15.63 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.garg_setup
# count action,conditions
X 1.00 apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<21|!talent.commander_of_the_dead)
Garg Setup
0.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
0.00 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
Y 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
Z 0.11 empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=21
a 0.11 unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=21
0.00 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
b 1.00 dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
c 1.00 any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>0
d 1.59 festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40
0.00 death_coil,if=rune<=1
actions.generic
# count action,conditions
e 92.41 death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
Generic
0.00 epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
f 7.41 any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=10|pet.gargoyle.active&pet.gargoyle.remains>5|pet.army_ghoul.active&pet.army_ghoul.remains>5))&death_knight.fwounded_targets=active_enemies
g 73.49 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
h 23.38 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 death_coil
actions.high_prio_actions
# count action,conditions
i 1.50 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Priority Actions
j 1.00 army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
k 7.07 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
l 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
m 2.00 berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.trinkets
# count action,conditions
n 2.00 use_item,use_off_gcd=1,name=algethar_puzzle_box,use_off_gcd=1,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain
Trinkets
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
o 2.82 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
0.00 use_item,use_off_gcd=1,slot=main_hand,if=(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

Sample Sequence

012456789ABCDEFilncdbYkkGkdXUVegefgeggemggeleegogeghegegheggegeeggeghegehGleSgeeTfggehegeheggeglegehegegeGgeghegSehelTVfggegegegheeggeggeeeGlgegheohSkhTfgegelgegheegegegeghegegghnjlkeSRkkGkTUVWefeggmeWgeegeglWegeehgWegghWeeegWeeGhSlWeTfgWeheeWgeggWeegoelWegWeGhegeeSWeTVfWleeeeWeggeig

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 4 raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 5 army_of_the_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
corrupting_rage
Pre precombat 6 trinket_1_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat 7 trinket_2_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat A trinket_1_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat B trinket_2_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat C trinket_1_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat D trinket_2_manual PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
Pre precombat E trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
0:00.000 default F auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
corrupting_rage
0:00.000 high_prio_actions i potion Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, corrupting_rage
0:00.000 high_prio_actions l outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, corrupting_rage, elemental_potion_of_ultimate_power
0:00.000 trinkets n use_item_algethar_puzzle_box Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, corrupting_rage, elemental_potion_of_ultimate_power
0:01.360 garg_setup c death_and_decay Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:02.380 garg_setup d festering_strike Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune
bloodlust, unholy_ground, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:03.352 garg_setup b dark_transformation Fluffy_Pillow 48.0/100: 48% runic_power
1.0/6: 17% rune
bloodlust, unholy_ground, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:03.352 garg_setup Y summon_gargoyle Fluffy_Pillow 48.0/100: 48% runic_power
1.0/6: 17% rune
bloodlust, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:04.323 high_prio_actions k death_coil Fluffy_Pillow 98.0/100: 98% runic_power
1.0/6: 17% rune
bloodlust, unholy_ground, dark_transformation, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:05.295 high_prio_actions k death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune
bloodlust, unholy_ground, icy_talons, dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.266 default G antimagic_shell PR_Death_Knight_Unholy 38.0/100: 38% runic_power
4.0/6: 67% rune
bloodlust, unholy_ground, icy_talons(2), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:06.266 high_prio_actions k death_coil Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, unholy_ground, icy_talons(2), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:07.238 garg_setup d festering_strike Fluffy_Pillow 13.0/100: 13% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:08.210 garg_setup X apocalypse Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.183 cooldowns U empower_rune_weapon Fluffy_Pillow 45.0/100: 45% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:09.183 cooldowns V unholy_assault Fluffy_Pillow 50.0/100: 50% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:10.029 generic e death_coil Fluffy_Pillow 50.0/100: 50% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:10.782 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:11.537 generic e death_coil Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:12.292 generic f death_and_decay Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.047 generic g clawing_shadows Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:13.803 generic e death_coil Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:14.557 generic g clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:15.311 generic g clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:16.065 generic e death_coil Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:16.819 racials m berserking Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:16.819 generic g clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage, elemental_potion_of_ultimate_power
0:17.573 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:18.327 generic e death_coil Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:19.080 high_prio_actions l outbreak Fluffy_Pillow 13.0/100: 13% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:19.833 generic e death_coil Fluffy_Pillow 28.0/100: 28% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:20.587 generic e death_coil Fluffy_Pillow 33.0/100: 33% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:21.341 generic g clawing_shadows Fluffy_Pillow 3.0/100: 3% runic_power
6.0/6: 100% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:21.434 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 16.0/100: 16% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:22.096 generic g clawing_shadows Fluffy_Pillow 16.0/100: 16% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:22.851 generic e death_coil Fluffy_Pillow 34.0/100: 34% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:23.607 generic g clawing_shadows Fluffy_Pillow 4.0/100: 4% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:24.363 generic h festering_strike Fluffy_Pillow 22.0/100: 22% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:25.117 generic e death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:25.871 generic g clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:26.625 generic e death_coil Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:27.379 generic g clawing_shadows Fluffy_Pillow 5.0/100: 5% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:28.134 generic h festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(15), commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:28.890 generic e death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:29.644 generic g clawing_shadows Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, overwhelming_rage, elemental_potion_of_ultimate_power
0:30.664 generic g clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
bloodlust, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, algethar_puzzle, overwhelming_rage
0:31.686 generic e death_coil Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune
bloodlust, icy_talons(3), dark_transformation, festermight(2), commander_of_the_dead, overwhelming_rage
0:32.708 generic g clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
1.0/6: 17% rune
bloodlust, icy_talons(3), dark_transformation, festermight(2), commander_of_the_dead, corrupting_rage
0:33.727 generic e death_coil Fluffy_Pillow 32.0/100: 32% runic_power
1.0/6: 17% rune
bloodlust, icy_talons(3), sudden_doom, festermight(3), corrupting_rage
0:34.748 generic e death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
bloodlust, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
0:35.769 generic g clawing_shadows Fluffy_Pillow 2.0/100: 2% runic_power
3.0/6: 50% rune
bloodlust, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
0:36.790 generic g clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(4), corrupting_rage
0:37.810 generic e death_coil Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
0:38.832 generic g clawing_shadows Fluffy_Pillow 8.0/100: 8% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
0:39.850 generic h festering_strike Fluffy_Pillow 21.0/100: 21% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
0:40.869 generic e death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(6), corrupting_rage
0:42.196 generic g clawing_shadows Fluffy_Pillow 11.0/100: 11% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(6), corrupting_rage
0:43.520 generic e death_coil Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(7), corrupting_rage
0:44.847 generic h festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), corrupting_rage
0:46.172 default G antimagic_shell PR_Death_Knight_Unholy 44.0/100: 44% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), corrupting_rage
0:46.266 high_prio_actions l outbreak Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(7), corrupting_rage
0:47.593 generic e death_coil Fluffy_Pillow 54.0/100: 54% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(7), corrupting_rage
0:48.920 cooldowns S dark_transformation Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(7), corrupting_rage
0:50.246 generic g clawing_shadows Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
0:51.572 generic e death_coil Fluffy_Pillow 47.0/100: 47% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), dark_transformation, sudden_doom, festermight, commander_of_the_dead, corrupting_rage
0:52.899 generic e death_coil Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, corrupting_rage
0:54.223 cooldowns T apocalypse Fluffy_Pillow 17.0/100: 17% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, overwhelming_rage
0:55.548 generic f death_and_decay Fluffy_Pillow 29.0/100: 29% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(5), commander_of_the_dead, overwhelming_rage
0:56.873 generic g clawing_shadows Fluffy_Pillow 44.0/100: 44% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, overwhelming_rage
0:58.136 generic g clawing_shadows Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, overwhelming_rage
0:59.398 generic e death_coil Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, overwhelming_rage
1:00.660 generic h festering_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead, overwhelming_rage
1:01.921 generic e death_coil Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, overwhelming_rage
1:03.181 generic g clawing_shadows Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, overwhelming_rage
1:04.443 generic e death_coil Fluffy_Pillow 48.0/100: 48% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, overwhelming_rage
1:05.706 generic h festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(8), commander_of_the_dead, overwhelming_rage
1:07.032 generic e death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(8), commander_of_the_dead, overwhelming_rage
1:08.357 generic g clawing_shadows Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(8), commander_of_the_dead, overwhelming_rage
1:09.683 generic g clawing_shadows Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, corrupting_rage
1:11.008 generic e death_coil Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), commander_of_the_dead, corrupting_rage
1:12.334 generic g clawing_shadows Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, commander_of_the_dead, corrupting_rage
1:13.660 high_prio_actions l outbreak Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
1:14.988 generic e death_coil Fluffy_Pillow 72.0/100: 72% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
1:16.314 generic g clawing_shadows Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
1:17.639 generic e death_coil Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), commander_of_the_dead, corrupting_rage
1:18.965 generic h festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
1:20.290 generic e death_coil Fluffy_Pillow 50.0/100: 50% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
1:21.615 generic g clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), corrupting_rage
1:22.942 generic e death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
1:24.269 generic g clawing_shadows Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
1:25.593 generic e death_coil Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(4), corrupting_rage
1:26.917 default G antimagic_shell PR_Death_Knight_Unholy 26.0/100: 26% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(4), corrupting_rage
1:26.917 generic g clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), festermight(4), corrupting_rage
1:28.242 generic e death_coil Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), festermight(5), corrupting_rage
1:29.567 generic g clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
3.0/6: 50% rune
antimagic_shell, icy_talons(3), runic_corruption, festermight(5), corrupting_rage
1:30.893 generic h festering_strike Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune
antimagic_shell, icy_talons(3), festermight(6), overwhelming_rage
1:32.219 generic e death_coil Fluffy_Pillow 52.0/100: 52% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), festermight(6), overwhelming_rage
1:33.548 generic g clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), runic_corruption, overwhelming_rage
1:34.874 cooldowns S dark_transformation Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune
icy_talons(3), festermight, overwhelming_rage
1:36.200 generic e death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, festermight, commander_of_the_dead, overwhelming_rage
1:37.525 generic h festering_strike Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, festermight, commander_of_the_dead, overwhelming_rage
1:38.850 generic e death_coil Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, overwhelming_rage
1:40.176 high_prio_actions l outbreak Fluffy_Pillow 5.0/100: 5% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, overwhelming_rage
1:41.503 cooldowns T apocalypse Fluffy_Pillow 15.0/100: 15% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, overwhelming_rage
1:42.829 cooldowns V unholy_assault Fluffy_Pillow 27.0/100: 27% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, overwhelming_rage
1:44.154 generic f death_and_decay Fluffy_Pillow 27.0/100: 27% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, overwhelming_rage
1:45.262 generic g clawing_shadows Fluffy_Pillow 37.0/100: 37% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, corrupting_rage
1:46.315 generic g clawing_shadows Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, corrupting_rage
1:47.367 generic e death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:48.420 generic g clawing_shadows Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, corrupting_rage
1:49.472 generic e death_coil Fluffy_Pillow 51.0/100: 51% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, corrupting_rage
1:50.526 generic g clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, corrupting_rage
1:51.579 generic e death_coil Fluffy_Pillow 39.0/100: 39% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, corrupting_rage
1:52.633 generic g clawing_shadows Fluffy_Pillow 9.0/100: 9% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, corrupting_rage
1:53.687 generic h festering_strike Fluffy_Pillow 22.0/100: 22% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, overwhelming_rage
1:54.739 generic e death_coil Fluffy_Pillow 42.0/100: 42% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, commander_of_the_dead, overwhelming_rage
1:55.845 generic e death_coil Fluffy_Pillow 42.0/100: 42% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, overwhelming_rage
1:56.951 generic g clawing_shadows Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, commander_of_the_dead, overwhelming_rage
1:58.058 Waiting     0.306 sec 25.0/100: 25% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight, commander_of_the_dead, overwhelming_rage
1:58.364 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight, commander_of_the_dead, overwhelming_rage
1:59.471 generic e death_coil Fluffy_Pillow 43.0/100: 43% runic_power
0.0/6: 0% rune
icy_talons(3), unholy_assault, festermight(2), commander_of_the_dead, overwhelming_rage
2:00.576 generic g clawing_shadows Fluffy_Pillow 13.0/100: 13% runic_power
1.0/6: 17% rune
icy_talons(3), unholy_assault, festermight(2), commander_of_the_dead, overwhelming_rage
2:01.681 Waiting     0.093 sec 26.0/100: 26% runic_power
0.0/6: 0% rune
icy_talons(3), unholy_assault, festermight(3), commander_of_the_dead, overwhelming_rage
2:01.774 generic g clawing_shadows Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune
icy_talons(3), unholy_assault, festermight(3), commander_of_the_dead, overwhelming_rage
2:02.879 generic e death_coil Fluffy_Pillow 39.0/100: 39% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(4), commander_of_the_dead, overwhelming_rage
2:04.206 generic e death_coil Fluffy_Pillow 9.0/100: 9% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(4), commander_of_the_dead, overwhelming_rage
2:05.532 Waiting     0.691 sec 9.0/100: 9% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(4), overwhelming_rage
2:06.223 generic e death_coil Fluffy_Pillow 14.0/100: 14% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(4), overwhelming_rage
2:07.549 default G antimagic_shell PR_Death_Knight_Unholy 14.0/100: 14% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), overwhelming_rage
2:07.549 high_prio_actions l outbreak Fluffy_Pillow 14.0/100: 14% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(4), overwhelming_rage
2:08.874 generic g clawing_shadows Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(4), corrupting_rage
2:10.200 generic e death_coil Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
2:11.526 generic g clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(5), corrupting_rage
2:12.852 Waiting     1.018 sec 25.0/100: 25% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(6), overwhelming_rage
2:13.870 generic h festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(6), overwhelming_rage
2:15.195 generic e death_coil Fluffy_Pillow 50.0/100: 50% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(6), overwhelming_rage
2:16.521 Waiting     4.727 sec 20.0/100: 20% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(6), overwhelming_rage
2:21.248 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
icy_talons(3), overwhelming_rage
2:21.434 generic h festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
icy_talons(3), dragon_games_equipment, overwhelming_rage
2:22.760 cooldowns S dark_transformation Fluffy_Pillow 50.0/100: 50% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), overwhelming_rage
2:24.085 high_prio_actions k death_coil Fluffy_Pillow 50.0/100: 50% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, overwhelming_rage
2:25.412 generic h festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, overwhelming_rage
2:26.739 cooldowns T apocalypse Fluffy_Pillow 45.0/100: 45% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, overwhelming_rage
2:28.065 generic f death_and_decay Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
2:29.392 generic g clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
2:30.654 generic e death_coil Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
2:31.916 generic g clawing_shadows Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(5), commander_of_the_dead, corrupting_rage
2:33.178 generic e death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:34.440 high_prio_actions l outbreak Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:35.701 generic g clawing_shadows Fluffy_Pillow 48.0/100: 48% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
2:36.962 generic e death_coil Fluffy_Pillow 61.0/100: 61% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, corrupting_rage
2:38.225 generic g clawing_shadows Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead, corrupting_rage
2:39.551 generic h festering_strike Fluffy_Pillow 49.0/100: 49% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, corrupting_rage
2:40.876 generic e death_coil Fluffy_Pillow 74.0/100: 74% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, corrupting_rage
2:42.201 generic e death_coil Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, overwhelming_rage
2:43.525 generic g clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(8), commander_of_the_dead, overwhelming_rage
2:44.850 generic e death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(9), commander_of_the_dead, overwhelming_rage
2:46.175 generic g clawing_shadows Fluffy_Pillow 2.0/100: 2% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(9), commander_of_the_dead, overwhelming_rage
2:47.501 generic e death_coil Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, commander_of_the_dead, overwhelming_rage
2:48.828 generic g clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, commander_of_the_dead, overwhelming_rage
2:50.155 generic e death_coil Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight, commander_of_the_dead, overwhelming_rage
2:51.480 generic g clawing_shadows Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, commander_of_the_dead, overwhelming_rage
2:52.805 generic h festering_strike Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), overwhelming_rage
2:54.130 generic e death_coil Fluffy_Pillow 66.0/100: 66% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(2), overwhelming_rage
2:55.456 generic g clawing_shadows Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(2), overwhelming_rage
2:56.782 generic e death_coil Fluffy_Pillow 54.0/100: 54% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), sudden_doom, festermight(3), corrupting_rage
2:58.107 generic g clawing_shadows Fluffy_Pillow 54.0/100: 54% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(3), corrupting_rage
2:59.433 generic g clawing_shadows Fluffy_Pillow 72.0/100: 72% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), festermight(4), corrupting_rage
3:00.759 generic h festering_strike Fluffy_Pillow 85.0/100: 85% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(5), corrupting_rage
3:01.402 trinkets n use_item_algethar_puzzle_box Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(5), corrupting_rage
3:03.169 high_prio_actions j army_of_the_dead Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(5), algethar_puzzle, corrupting_rage
3:04.493 high_prio_actions l outbreak Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(5), algethar_puzzle, overwhelming_rage
3:05.818 high_prio_actions k death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), sudden_doom, festermight(5), algethar_puzzle, overwhelming_rage
3:07.143 generic e death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(5), algethar_puzzle, overwhelming_rage
3:08.468 cooldowns S dark_transformation Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, festermight(5), algethar_puzzle, overwhelming_rage
3:09.795 cooldowns R summon_gargoyle Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:09.795 high_prio_actions k death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:11.120 high_prio_actions k death_coil Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:12.446 default G antimagic_shell PR_Death_Knight_Unholy 45.0/100: 45% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:12.446 high_prio_actions k death_coil Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
antimagic_shell, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:13.771 cooldowns T apocalypse Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune
antimagic_shell, icy_talons(3), dark_transformation, commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:15.096 cooldowns U empower_rune_weapon Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune
antimagic_shell, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:15.096 cooldowns V unholy_assault Fluffy_Pillow 37.0/100: 37% runic_power
6.0/6: 100% rune
antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:16.250 cooldowns W soul_reaper Fluffy_Pillow 42.0/100: 42% runic_power
6.0/6: 100% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:17.212 generic e death_coil Fluffy_Pillow 52.0/100: 52% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:18.175 generic f death_and_decay Fluffy_Pillow 22.0/100: 22% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:19.135 generic e death_coil Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:20.051 generic g clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:20.968 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:21.884 racials m berserking Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:21.884 generic e death_coil Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:22.717 cooldowns W soul_reaper Fluffy_Pillow 8.0/100: 8% runic_power
4.0/6: 67% rune
berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:23.552 generic g clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:24.387 generic e death_coil Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:25.220 generic e death_coil Fluffy_Pillow 16.0/100: 16% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:26.054 generic g clawing_shadows Fluffy_Pillow 16.0/100: 16% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:26.888 generic e death_coil Fluffy_Pillow 34.0/100: 34% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:27.720 generic g clawing_shadows Fluffy_Pillow 4.0/100: 4% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:28.553 high_prio_actions l outbreak Fluffy_Pillow 17.0/100: 17% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:29.428 cooldowns W soul_reaper Fluffy_Pillow 27.0/100: 27% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, corrupting_rage
3:30.301 generic e death_coil Fluffy_Pillow 47.0/100: 47% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:31.175 generic g clawing_shadows Fluffy_Pillow 17.0/100: 17% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:32.049 generic e death_coil Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:32.924 generic e death_coil Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, overwhelming_rage
3:33.798 generic h festering_strike Fluffy_Pillow 5.0/100: 5% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, overwhelming_rage
3:34.673 generic g clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, overwhelming_rage
3:35.635 cooldowns W soul_reaper Fluffy_Pillow 48.0/100: 48% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, overwhelming_rage
3:36.959 generic e death_coil Fluffy_Pillow 58.0/100: 58% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, overwhelming_rage
3:38.283 generic g clawing_shadows Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), runic_corruption, festermight, commander_of_the_dead, overwhelming_rage
3:39.610 generic g clawing_shadows Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(2), overwhelming_rage
3:40.936 generic h festering_strike Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), overwhelming_rage
3:42.260 cooldowns W soul_reaper Fluffy_Pillow 84.0/100: 84% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), overwhelming_rage
3:43.587 generic e death_coil Fluffy_Pillow 94.0/100: 94% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(3), overwhelming_rage
3:44.912 generic e death_coil Fluffy_Pillow 64.0/100: 64% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(3), overwhelming_rage
3:46.237 generic e death_coil Fluffy_Pillow 39.0/100: 39% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3), overwhelming_rage
3:47.563 generic g clawing_shadows Fluffy_Pillow 9.0/100: 9% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(3), overwhelming_rage
3:48.888 cooldowns W soul_reaper Fluffy_Pillow 22.0/100: 22% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(4), overwhelming_rage
3:50.215 generic e death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), overwhelming_rage
3:51.539 generic e death_coil Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(4), overwhelming_rage
3:52.865 default G antimagic_shell PR_Death_Knight_Unholy 7.0/100: 7% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), overwhelming_rage
3:52.865 generic h festering_strike Fluffy_Pillow 7.0/100: 7% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(4), overwhelming_rage
3:54.190 cooldowns S dark_transformation Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(4), overwhelming_rage
3:55.515 high_prio_actions l outbreak Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, overwhelming_rage
3:56.841 cooldowns W soul_reaper Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, overwhelming_rage
3:58.167 generic e death_coil Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, overwhelming_rage
3:59.492 cooldowns T apocalypse Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, overwhelming_rage
4:00.816 generic f death_and_decay Fluffy_Pillow 39.0/100: 39% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:02.143 generic g clawing_shadows Fluffy_Pillow 49.0/100: 49% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(4), commander_of_the_dead, corrupting_rage
4:03.406 cooldowns W soul_reaper Fluffy_Pillow 62.0/100: 62% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(5), commander_of_the_dead, corrupting_rage
4:04.669 generic e death_coil Fluffy_Pillow 77.0/100: 77% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(5), commander_of_the_dead, corrupting_rage
4:05.933 generic h festering_strike Fluffy_Pillow 77.0/100: 77% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:07.195 generic e death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, corrupting_rage
4:08.457 generic e death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(5), commander_of_the_dead, corrupting_rage
4:09.720 cooldowns W soul_reaper Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(5), commander_of_the_dead, corrupting_rage
4:10.983 generic g clawing_shadows Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, runic_corruption, festermight(5), commander_of_the_dead, corrupting_rage
4:12.308 generic e death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
4:13.635 generic g clawing_shadows Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, corrupting_rage
4:14.961 generic g clawing_shadows Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(7), commander_of_the_dead, corrupting_rage
4:16.287 cooldowns W soul_reaper Fluffy_Pillow 69.0/100: 69% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(8), commander_of_the_dead, corrupting_rage
4:17.612 generic e death_coil Fluffy_Pillow 79.0/100: 79% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(8), commander_of_the_dead, corrupting_rage
4:18.937 generic e death_coil Fluffy_Pillow 49.0/100: 49% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(8), commander_of_the_dead, corrupting_rage
4:20.264 generic g clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), commander_of_the_dead, corrupting_rage
4:21.434 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
4:21.591 generic e death_coil Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight, commander_of_the_dead, dragon_games_equipment, corrupting_rage
4:22.915 high_prio_actions l outbreak Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight, commander_of_the_dead, corrupting_rage
4:24.242 cooldowns W soul_reaper Fluffy_Pillow 22.0/100: 22% runic_power
2.0/6: 33% rune
icy_talons(3), festermight, corrupting_rage
4:25.569 generic e death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
icy_talons(3), festermight, corrupting_rage
4:26.894 generic g clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune
icy_talons(3), festermight, corrupting_rage
4:28.220 Waiting     1.825 sec 20.0/100: 20% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(2), corrupting_rage
4:30.045 cooldowns W soul_reaper Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(2), corrupting_rage
4:31.568 generic e death_coil Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(2), corrupting_rage
4:32.894 default G antimagic_shell PR_Death_Knight_Unholy 5.0/100: 5% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(2), corrupting_rage
4:32.894 generic h festering_strike Fluffy_Pillow 5.0/100: 5% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), festermight(2), corrupting_rage
4:34.220 generic e death_coil Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), festermight(2), corrupting_rage
4:35.545 generic g clawing_shadows Fluffy_Pillow 0.0/100: 0% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), festermight(2), corrupting_rage
4:36.870 generic e death_coil Fluffy_Pillow 13.0/100: 13% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), sudden_doom, festermight(3), corrupting_rage
4:38.195 Waiting     0.954 sec 13.0/100: 13% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(3), corrupting_rage
4:39.149 generic e death_coil Fluffy_Pillow 13.0/100: 13% runic_power
0.0/6: 0% rune
antimagic_shell, unholy_strength, icy_talons(3), sudden_doom, festermight(3), corrupting_rage
4:40.475 cooldowns S dark_transformation Fluffy_Pillow 13.0/100: 13% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), corrupting_rage
4:41.799 cooldowns W soul_reaper Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, corrupting_rage
4:43.124 generic e death_coil Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, corrupting_rage
4:44.448 cooldowns T apocalypse Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, corrupting_rage
4:45.819 cooldowns V unholy_assault Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, corrupting_rage
4:47.145 generic f death_and_decay Fluffy_Pillow 40.0/100: 40% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, overwhelming_rage
4:48.250 cooldowns W soul_reaper Fluffy_Pillow 50.0/100: 50% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, overwhelming_rage
4:49.303 high_prio_actions l outbreak Fluffy_Pillow 65.0/100: 65% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, overwhelming_rage
4:50.356 generic e death_coil Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, overwhelming_rage
4:51.407 generic e death_coil Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, overwhelming_rage
4:52.462 generic e death_coil Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, overwhelming_rage
4:53.513 generic e death_coil Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, overwhelming_rage
4:54.566 cooldowns W soul_reaper Fluffy_Pillow 25.0/100: 25% runic_power
5.0/6: 83% rune
unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, overwhelming_rage
4:55.620 generic e death_coil Fluffy_Pillow 35.0/100: 35% runic_power
5.0/6: 83% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, overwhelming_rage
4:56.671 generic g clawing_shadows Fluffy_Pillow 5.0/100: 5% runic_power
5.0/6: 83% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, overwhelming_rage
4:57.723 generic g clawing_shadows Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, overwhelming_rage
4:58.827 generic e death_coil Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, overwhelming_rage
4:59.932 high_prio_actions i potion Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, overwhelming_rage
5:00.000 generic g clawing_shadows Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, overwhelming_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6095 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3848 0 13478 12836 6849
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 269560 256720 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 21.57% 15.36% 1504
Haste 13.49% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6400 5922 0
Mastery 44.26% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +687 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +111 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +687 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA
dragonflight.player.ominous_chromatic_essence_dragonflight=obsidian
dragonflight.player.ashkandur_humanoid=

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze,if=target.debuff.casting.react
actions+=/antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
actions+=/antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle)
# Variables
actions+=/variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
actions+=/variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle|time>20
actions+=/variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
actions+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
actions+=/variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4)|fight_remains<5&debuff.festering_wound.stack>=1
actions+=/variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions+=/variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
actions+=/variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
actions+=/invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=20|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))|fight_remains<=21
# Call Action Lists
actions+=/call_action_list,name=high_prio_actions
actions+=/call_action_list,name=trinkets
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup=0
actions+=/call_action_list,name=cooldowns,if=variable.st_planning
actions+=/call_action_list,name=aoe_cooldowns,if=variable.adds_remain
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
actions+=/call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
actions+=/call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
actions+=/call_action_list,name=generic,if=active_enemies<=3

# Generic AoE
actions.aoe=epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# AoE Burst
actions.aoe_burst=epidemic,if=(!talent.bursting_sores|rune<1|talent.bursting_sores&debuff.festering_wound.stack=0)&!variable.pooling_runic_power&(active_enemies>=6|runic_power.deficit<30|buff.festermight.stack=20)
actions.aoe_burst+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=1
actions.aoe_burst+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_burst+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe_burst+=/wound_spender

# AoE Cooldowns
actions.aoe_cooldowns=vile_contagion,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.aoe_cooldowns+=/summon_gargoyle
actions.aoe_cooldowns+=/abomination_limb,if=rune<2|buff.festermight.stack>10|!talent.festermight|buff.festermight.up&buff.festermight.remains<12
actions.aoe_cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=talent.bursting_sores&debuff.festering_wound.up&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)|!talent.bursting_sores&debuff.festering_wound.stack>=4
actions.aoe_cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.stack<=2|buff.dark_transformation.up
actions.aoe_cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.aoe_cooldowns+=/dark_transformation,if=(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.aoe_cooldowns+=/empower_rune_weapon,if=buff.dark_transformation.up
actions.aoe_cooldowns+=/sacrificial_pact,if=!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# AoE Setup
actions.aoe_setup=any_dnd,if=(!talent.bursting_sores|death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets>=8|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5)
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies&talent.bursting_sores
actions.aoe_setup+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies
actions.aoe_setup+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=cooldown.apocalypse.remains<variable.apoc_timing&debuff.festering_wound.stack<4
actions.aoe_setup+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# ST/Cleave Cooldowns
actions.cooldowns=summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=cooldown.apocalypse.remains<5
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=21|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)

# Garg Setup
actions.garg_setup=apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<21|!talent.commander_of_the_dead)
actions.garg_setup+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
actions.garg_setup+=/empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=21
actions.garg_setup+=/unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=21
actions.garg_setup+=/potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
actions.garg_setup+=/any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>0
actions.garg_setup+=/festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse|runic_power<40
actions.garg_setup+=/death_coil,if=rune<=1

# Generic
actions.generic=death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
actions.generic+=/epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
actions.generic+=/any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=10|pet.gargoyle.active&pet.gargoyle.remains>5|pet.army_ghoul.active&pet.army_ghoul.remains>5))&death_knight.fwounded_targets=active_enemies
actions.generic+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.generic+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.generic+=/death_coil

# Priority Actions
actions.high_prio_actions=potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
actions.high_prio_actions+=/army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
actions.high_prio_actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
actions.high_prio_actions+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
actions.high_prio_actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
actions.racials+=/berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Trinkets
actions.trinkets=use_item,use_off_gcd=1,name=algethar_puzzle_box,use_off_gcd=1,if=cooldown.summon_gargoyle.remains<5&rune<=4|!talent.summon_gargoyle&pet.army_ghoul.active|active_enemies>3&variable.adds_remain
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_manual&!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_manual&!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=main_hand,if=(!variable.trinket_1_buffs|trinket.1.cooldown.remains)&(!variable.trinket_2_buffs|trinket.2.cooldown.remains)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=6849
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 12986 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
12985.7 12985.7 8.4 / 0.065% 1433.8 / 11.0% 474.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
26.4 25.9 Mana 0.00% 51.9 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 12986
Mind Blast 1888 14.5% 34.8 8.47sec 16276 13902 Direct 34.8 14364 28773 16277 13.3%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.77 34.77 0.00 0.00 0.00 1.1708 0.0000 565887.83 565887.83 0.00% 13902.17 13902.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.73% 30.15 19 42 14363.85 12820 20028 14364.46 13870 15096 433116 433116 0.00%
crit 13.27% 4.61 0 13 28772.71 25639 40056 28531.11 0 37657 132772 132772 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.52

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s2=0}/100} Insanity.|r][]

Action Priority List

    main
    [S]:34.78
  • if_expr:variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
Mind Spike 5479 42.2% 181.2 1.64sec 9066 7755 Direct 181.2 7998 16023 9066 13.3%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 181.17 181.17 0.00 0.00 0.00 1.1690 0.0000 1642424.52 1642424.52 0.00% 7755.00 7755.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.70% 157.08 115 204 7998.41 7084 11068 8000.39 7782 8321 1256365 1256365 0.00%
crit 13.30% 24.09 8 44 16023.34 14169 22136 16027.65 15158 17229 386060 386060 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.656374
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage. |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity.|r

Action Priority List

    filler
    [L]:182.01
  • if_expr:(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&!talent.idol_of_cthun
Shadow Weaving 122 0.9% 32.0 6.40sec 1130 0 Direct 32.0 1130 0 1130 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.00 32.00 0.00 0.00 0.00 0.0000 0.0000 36169.20 36169.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 32.00 32 32 1130.27 652 2290 1130.29 978 1459 36169 36169 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1090.67
  • base_dd_max:1090.67
  • base_dd_mult:1.00

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}
Shadow Word: Death 500 3.8% 6.3 10.13sec 23659 19515 Direct 6.3 20734 41609 23660 14.0%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.33 6.33 0.00 0.00 0.00 1.2124 0.0000 149717.48 149717.48 0.00% 19514.79 19514.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.99% 5.44 1 8 20733.99 17383 27158 20755.82 18784 25184 112820 112820 0.00%
crit 14.01% 0.89 0 5 41608.66 34766 54315 25415.51 0 54315 36898 36898 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.76

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to the target. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target.{$?=}A364675[ Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][ Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$s4=0}/100} Insanity.|r][]

Action Priority List

    main
    [R]:6.35
  • target_if_expr:(target.health.pct<20&spell_targets.mind_sear<4)&(talent.inescapable_torment.rank<2|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up
Shadow Word: Pain 1705 13.1% 18.4 16.05sec 27813 23683 Direct 18.4 2829 5658 3199 13.1%
Periodic 189.6 2107 4218 2387 13.3% 98.0%

Stats Details: Shadow Word Pain

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.38 18.38 189.55 189.55 17.38 1.1745 1.5503 511190.17 511190.17 0.00% 1620.51 23682.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.93% 15.98 8 22 2829.23 2551 3717 2829.29 2718 2971 45203 45203 0.00%
crit 13.07% 2.40 0 9 5658.21 5101 7435 5192.29 0 6762 13591 13591 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.74% 164.43 119 211 2106.81 56 2934 2107.15 2048 2204 346418 346418 0.00%
crit 13.26% 25.13 8 51 4217.83 111 5869 4218.51 3885 4563 105977 105977 0.00%

Action Details: Shadow Word Pain

  • id:589
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:3.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.095880
  • base_td:0.00
  • base_td_mult:1.81
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=2} sec.
  • description:A word of darkness that causes {$?a390707=false}[{$=}{{$s1=0}*(1+{$390707s1=15}/100)}][{$s1=0}] Shadow damage instantly, and an additional {$?a390707=false}[{$=}{{$=}o2*(1+{$390707s1=15}/100)}][{$=}o2] Shadow damage over {$d=16 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m3=300}/100} Insanity.|r][]

Action Priority List

    main
    [Q]:18.38
  • if_expr:refreshable&target.time_to_die>=18&!talent.misery.enabled
  • target_if_expr:remains
Soulseeker Arrow 1027 7.9% 7.0 38.13sec 43986 0 Periodic 79.5 3876 0 3876 0.0% 37.5%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.00 0.00 79.47 79.47 2.34 0.0000 1.4169 308013.55 308013.55 0.00% 2735.37 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 79.47 24 165 3875.80 119 4407 3873.79 3800 4060 308014 308014 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3629.20
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1730}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 1791 13.8% 12.1 23.12sec 44547 37236 Periodic 120.2 3941 7895 4465 13.3% 90.4%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.05 0.00 120.21 120.21 0.00 1.1964 2.2551 536792.40 536792.40 0.00% 1880.18 37235.88
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.74% 104.27 70 133 3940.99 344 5619 3942.33 3807 4121 410923 410923 0.00%
crit 13.26% 15.94 1 32 7895.13 688 11238 7898.79 6515 8808 125870 125870 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.50
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [P]:12.05
  • if_expr:refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash)
  • target_if_expr:remains
pet - shadowfiend 4014 / 475
melee 4014 3.6% 32.0 6.40sec 4390 4082 Direct 32.0 3881 7762 4390 13.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.00 32.00 0.00 0.00 0.00 1.0755 0.0000 140473.71 140473.71 0.00% 4081.76 4081.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.90% 27.81 18 32 3881.28 3706 4356 3881.35 3771 4256 107927 107927 0.00%
crit 13.10% 4.19 0 14 7762.02 7413 8711 7677.88 0 8711 32547 32547 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 1.0 0.00sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    cds
    [I]:1.00
  • if_expr:buff.power_infusion.up|fight_remains<=15
Desperate Prayer 1.0 0.00sec

Stats Details: Desperate Prayer

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Desperate Prayer

  • id:19236
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19236
  • name:Desperate Prayer
  • school:holy
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=false}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.

Action Priority List

    cds
    [K]:1.00
  • if_expr:health.pct<=75
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [H]:1.00
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Shadowfiend 2.0 180.00sec

Stats Details: Shadowfiend

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0800 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowfiend

  • id:34433
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:343726
  • description:Summons a shadowy fiend to attack the target for {$d=15 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$262485s1=200}/100} Insanity each time the Shadowfiend attacks.|r][ |cFFFFFFFFGenerates {$=}{{$s4=5}/10}.1% Mana each time the Shadowfiend attacks.|r]

Action Priority List

    main
    [O]:2.00
  • if_expr:variable.dots_up&(fight_remains<30|time_to_die>15)
Shadowform 1.0 0.00sec

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 1.0 0.00sec

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 120.2 2.46sec

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 120.21 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 1.0 0.0 0.0sec 0.0sec 14.4sec 4.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.5s / 15.0s

Stack Uptimes

  • blood_fury_1:4.86%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Desperate Prayer 1.0 0.0 0.0sec 0.0sec 10.0sec 3.38% 0.00% 9.0 (9.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_desperate_prayer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.7s / 10.0s

Stack Uptimes

  • desperate_prayer_1:3.38%

Spelldata

  • id:19236
  • name:Desperate Prayer
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=false}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Devoured Pride 1.0 0.0 0.0sec 0.0sec 15.0sec 5.07% 6.25% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • devoured_pride_1:5.07%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning Mindbender causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your Mindbender deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your Mindbender deal {$373319s1=5}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0sec 0.0sec 29.4sec 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.5s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.2sec 45.7sec 16.5sec 23.69% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 199.3s
  • trigger_min/max:0.0s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 73.0s

Stack Uptimes

  • sophic_devotion_1:23.69%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.2 0.0 0.0sec 0.0sec 19.4sec 1.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:1.62%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.2 0.0 0.0sec 0.0sec 19.4sec 1.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.6s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:1.60%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.3 0.0 0.0sec 0.0sec 19.4sec 1.66% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:1.66%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.3 0.0 0.0sec 0.0sec 19.4sec 1.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.6s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:1.67%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:Primary stat is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Idol of Y'Shaarj Devoured Violence procs 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 95.87% 93.78% 97.65% 45.5s 8.8s 287.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mind Blast0.330-0.0003.93616.2216.93030.452
Shadowfiend0.4700.0000.9430.9400.9350.943
Shadow Word: Death38.1630.000288.370241.495193.136288.603

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
ShadowfiendInsanity32.0032.0032.00%1.0032.0050.00%
mana_regenMana641.167759.54100.00%12.10471372.5898.38%
Mind BlastInsanity34.7714.0014.00%0.40194.6093.29%
Mind SpikeInsanity181.1744.0044.00%0.24680.6893.93%
Shadow Word: PainInsanity18.386.006.00%0.3349.1489.12%
Vampiric TouchInsanity13.054.004.00%0.3148.2092.34%
Usage Type Count Total Tot% Avg RPE APR
PR_Priest_Shadow
Shadow Word: DeathMana 6.337909.95100.00%1250.001249.9818.93
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 224640.0 338.36 542.25 129727.1 152930.4 7414.7 215703.9
Mana 49999.0 25.87 26.37 471372.6 49848.6 48749.0 49999.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 12985.73
Minimum 11883.00
Maximum 14639.72
Spread ( max - min ) 2756.73
Range [ ( max - min ) / 2 * 100% ] 10.61%
Standard Deviation 371.6278
5th Percentile 12404.83
95th Percentile 13619.37
( 95th Percentile - 5th Percentile ) 1214.54
Mean Distribution
Standard Deviation 4.2915
95.00% Confidence Interval ( 12977.32 - 12994.15 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3147
0.1 Scale Factor Error with Delta=300 1179
0.05 Scale Factor Error with Delta=300 4716
0.01 Scale Factor Error with Delta=300 117897
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 12985.73
Minimum 11883.00
Maximum 14639.72
Spread ( max - min ) 2756.73
Range [ ( max - min ) / 2 * 100% ] 10.61%
Standard Deviation 371.6278
5th Percentile 12404.83
95th Percentile 13619.37
( 95th Percentile - 5th Percentile ) 1214.54
Mean Distribution
Standard Deviation 4.2915
95.00% Confidence Interval ( 12977.32 - 12994.15 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3147
0.1 Scale Factor Error with Delta=300 1179
0.05 Scale Factor Error with Delta=300 4716
0.01 Scale Factor Error with Delta=300 117897
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 12985.73
Minimum 11883.00
Maximum 14639.72
Spread ( max - min ) 2756.73
Range [ ( max - min ) / 2 * 100% ] 10.61%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 3750195.16
Minimum 2864214.08
Maximum 4730662.55
Spread ( max - min ) 1866448.48
Range [ ( max - min ) / 2 * 100% ] 24.88%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 543.26
Minimum 359.63
Maximum 1096.14
Spread ( max - min ) 736.51
Range [ ( max - min ) / 2 * 100% ] 67.79%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 341.68
Minimum 274.89
Maximum 426.51
Spread ( max - min ) 151.62
Range [ ( max - min ) / 2 * 100% ] 22.19%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
otion=elemental_potion_of_ultimate_power_ lask=phial_of_tepid_versatility_ ood=fated_fortune_cooki ugmentation=draconic_augment_run emporary_enchant=main_hand:howling_rune_
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 shadowform,if=!buff.shadowform.up
5 0.00 arcane_torrent
6 0.00 variable,name=mind_sear_cutoff,op=set,value=2
7 0.00 variable,name=pool_amount,op=set,value=60
8 0.00 shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice
9 0.00 mind_blast,if=talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in>=25&spell_targets.shadow_crash<=8|fight_style.dungeonslice)
A 0.00 vampiric_touch,if=!talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice)
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
0.00 variable,name=holding_crash,op=set,value=raid_event.adds.in<20
B 0.00 run_action_list,name=aoe,if=spell_targets.mind_sear>2|spell_targets.vampiric_touch>3
C 0.00 run_action_list,name=main
actions.cds
# count action,conditions
H 1.00 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Todo Check VE/DA enter conditions based on dots
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
I 1.00 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
Sync Power Infusion with Voidform or Dark Ascension
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
0.00 dark_ascension,if=pet.fiend.active|!talent.mindbender&!cooldown.fiend.up|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2
Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
J 0.00 call_action_list,name=trinkets
K 1.00 desperate_prayer,if=health.pct<=75
Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.filler
# count action,conditions
0.00 mind_flay,if=buff.mind_flay_insanity.up&dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
0.00 vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
0.00 mind_spike,if=buff.surge_of_darkness.up
0.00 lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75|spell_targets.lights_judgment>1
0.00 halo,if=raid_event.adds.in>20
Save up to 20s if adds are coming soon.
0.00 shadow_word_death,target_if=min:target.time_to_die,if=target.health.pct<20&(spell_targets.mind_sear<4|talent.inescapable_torment.rank=2&pet.fiend.active)
0.00 divine_star,if=raid_event.adds.in>10
Save up to 10s if adds are coming soon.
L 182.01 mind_spike,if=(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&!talent.idol_of_cthun
0.00 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 shadow_crash,if=raid_event.adds.in>30
Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 divine_star
Use Divine Star while moving as a low-priority action
0.00 shadow_word_death
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain,target_if=min:remains
Use Shadow Word: Pain while moving as a low-priority action
actions.main
# count action,conditions
M 0.00 call_action_list,name=main_variables
N 0.00 call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|spell_targets.mind_sear>2)
O 2.00 mindbender,if=variable.dots_up&(fight_remains<30|time_to_die>15)
0.00 mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
High priority Mind Blast action when using Inescapable Torment
0.00 damnation,target_if=dot.vampiric_touch.refreshable|dot.shadow_word_pain.refreshable
0.00 void_bolt,if=variable.dots_up&insanity<=85
0.00 mind_sear,target_if=spell_targets.mind_sear>1&buff.mind_devourer.up
Use Mind Devourer Procs on Mind Sear when facing 2 or more targets
0.00 devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
P 12.05 vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash)
Q 18.38 shadow_word_pain,target_if=min:remains,if=refreshable&target.time_to_die>=18&!talent.misery.enabled
0.00 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
R 6.35 shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(talent.inescapable_torment.rank<2|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up
S 34.78 mind_blast,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
0.00 mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
TODO: Dont use if add events are coming soon when talented into PL
0.00 shadow_crash,if=!variable.holding_crash
0.00 dark_void,if=raid_event.adds.in>20
0.00 devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
0.00 void_torrent,if=insanity<=35&!variable.holding_crash,target_if=variable.all_dots_up
TODO: Dont use if add events are coming soon when talented into PL
T 0.00 call_action_list,name=filler
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance
U 1.00 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex,if=fight_remains<20|!talent.ancient_madness|(cooldown.dark_ascension.remains>10&talent.dark_ascension)|(cooldown.void_eruption.remains>10&talent.void_eruption)|(!talent.void_eruption&!talent.dark_ascension)
Sync with cooldowns for Ancient Madness or use when the fight will end soon or at full stacks

Sample Sequence

012467AQOSLLLLLLSLLQLLLSLLLLLLPSLLLLQLSLLLLLLSLLLLLLSPQLLLLSLLLLLLQSLLLLPLSLLLLQLSLLLLLLSLLPQLLSLLLLLLSLLQLLLSPLLLLLSLQLLLLSLLLLLPSQLLLLLSLLLLLLSQLLPLLSLLLLLLQSLLLLLOSPLLLQLSLLLLLLSLLLQLPSLLLLLLSLLQLLLSLLLPLLSLQLLLRSLLLLLLRKQPSLLLLRLSLLLQLHRSLLPLLLURSLLILLLLRLLLLLLL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 4 shadowform PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 6 mind_sear_cutoff PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment
Pre precombat 7 pool_amount PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment
Pre precombat A vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment
0:00.000 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity
bloodlust, shadowform, static_empowerment
0:00.939 main O shadowfiend Fluffy_Pillow 49999.0/49999: 100% mana
7.0/100: 7% insanity
bloodlust, shadowform, static_empowerment
0:01.877 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(2)
0:02.818 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(3)
0:03.757 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(4)
0:04.696 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:05.635 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:06.575 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:07.514 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:08.454 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:09.394 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:10.333 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:11.271 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:12.209 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:13.148 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:14.087 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:15.026 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
96.0/100: 96% insanity
bloodlust, shadowform, devoured_pride, static_empowerment(5)
0:15.965 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:16.905 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:17.844 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:18.785 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:19.725 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:20.665 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:21.606 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:22.545 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:23.484 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:24.421 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:25.359 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:26.298 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:27.236 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:28.176 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:29.116 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:30.054 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:30.994 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:31.932 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:32.871 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:33.811 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:34.750 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:35.688 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:36.626 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:37.565 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:38.504 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:39.444 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, sophic_devotion, static_empowerment(5)
0:40.385 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:41.608 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
0:42.827 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:44.127 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:45.345 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:46.567 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:47.786 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:49.008 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:50.230 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:51.450 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:52.671 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:53.891 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:55.113 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:56.334 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:57.554 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:58.775 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:59.996 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:01.216 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:02.436 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:03.656 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:04.874 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:06.093 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:07.313 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:08.534 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:09.754 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:10.975 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:12.196 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:13.417 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:14.638 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:15.859 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:17.079 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:18.300 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:19.521 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:20.740 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:21.961 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:23.182 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:24.403 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:25.624 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:26.845 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:28.066 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:29.287 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:30.510 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:31.732 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:32.952 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:34.172 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:35.392 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:36.612 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:37.831 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:39.052 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:40.271 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:41.492 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:42.711 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:43.930 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:45.149 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:46.370 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:47.590 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:48.811 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:50.033 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:51.256 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:52.477 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:53.698 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:54.917 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:56.135 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:57.356 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:58.576 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:59.795 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:01.015 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:02.236 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:03.456 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:04.676 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:05.896 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:07.116 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:08.337 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:09.559 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:10.779 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:11.998 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:13.219 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:14.438 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:15.658 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:16.878 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:18.098 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:19.318 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:20.539 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:21.758 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:22.979 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:24.200 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:25.422 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:26.642 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:27.864 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:29.085 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:30.304 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:31.525 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:32.746 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:33.967 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:35.188 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:36.409 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:37.629 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:38.848 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:40.068 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:41.288 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:42.508 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:43.727 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:44.947 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:46.167 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:47.387 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:48.607 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:49.829 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:51.050 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
2:52.271 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:53.493 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:54.713 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:55.933 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:57.155 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:58.376 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:59.596 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:00.816 main O shadowfiend Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:02.160 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:03.380 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:04.600 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:05.820 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:07.040 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:08.262 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:09.483 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:10.702 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:11.923 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:13.145 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:14.367 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:15.588 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:16.810 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:18.029 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:19.250 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:20.471 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:21.693 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:22.915 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:24.135 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:25.356 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:26.577 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:27.799 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:29.020 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:30.242 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:31.463 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:32.685 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:33.906 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:35.125 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:36.346 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:37.565 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:38.787 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:40.007 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:41.226 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:42.447 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:43.667 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:44.889 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:46.110 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:47.331 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:48.552 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:49.772 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:50.991 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:52.213 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:53.433 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:54.655 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:55.877 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:57.097 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:58.318 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:59.539 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:00.760 main R shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:01.979 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:03.199 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:04.419 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:05.640 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:06.861 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:08.084 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:09.303 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:10.524 main R shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:11.980 cds K desperate_prayer PR_Priest_Shadow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:11.980 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5)
4:13.200 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5)
4:14.422 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5)
4:15.644 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5)
4:16.866 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5)
4:18.084 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5)
4:19.304 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5)
4:20.522 main R shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, static_empowerment(5)
4:21.981 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:23.201 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:24.421 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:25.640 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:26.861 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:28.081 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:29.302 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:30.521 cds H potion Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:30.521 main R shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:31.980 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:33.201 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:34.420 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:35.640 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:36.863 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:38.084 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:39.303 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.524 trinkets U use_items Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.524 main R shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:41.980 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:43.201 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:44.422 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.644 cds I blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:45.644 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:46.865 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:48.088 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:49.308 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:50.529 main R shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:51.978 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:53.198 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:54.418 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:55.637 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
4:56.857 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:58.077 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
4:59.297 filler L mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3848 1 11232 10698 6849
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 224640 213960 0
Mana 49999 49999 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 1600 1600 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +687 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +515 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +687 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +687 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +111 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +515 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +386 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +386 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +687 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Talents

RowPriest Talents [1]
1
2
3
4
5
6
7
8
9
10
RowShadow Talents [2]
1
2
3
4
5
6
7
8
9
10

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA
dragonflight.player.ominous_chromatic_essence_dragonflight=obsidian
dragonflight.player.ashkandur_humanoid=

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
# otion=elemental_potion_of_ultimate_power_ lask=phial_of_tepid_versatility_ ood=fated_fortune_cooki ugmentation=draconic_augment_run emporary_enchant=main_hand:howling_rune_
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/variable,name=mind_sear_cutoff,op=set,value=2
actions.precombat+=/variable,name=pool_amount,op=set,value=60
actions.precombat+=/shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice
actions.precombat+=/mind_blast,if=talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in>=25&spell_targets.shadow_crash<=8|fight_style.dungeonslice)
actions.precombat+=/vampiric_touch,if=!talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice)

# Executed every time the actor is available.
actions=variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
actions+=/variable,name=holding_crash,op=set,value=raid_event.adds.in<20
actions+=/run_action_list,name=aoe,if=spell_targets.mind_sear>2|spell_targets.vampiric_touch>3
actions+=/run_action_list,name=main

actions.aoe=call_action_list,name=aoe_variables
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied),if=variable.max_vts>0&!variable.manual_vts_applied&!action.shadow_crash.in_flight
actions.aoe+=/shadow_crash,if=!variable.holding_crash
actions.aoe+=/call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|spell_targets.mind_sear>2)
actions.aoe+=/dark_void,if=raid_event.adds.in>10
actions.aoe+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)&(fight_remains<30|time_to_die>15)
# actions.aoe+=/run_action_list,name=aoe_pl_ire,if=talent.psychic_link.rank=2&talent.insidious_ire.rank=2 Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
actions.aoe+=/mind_blast,if=cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time&talent.mind_devourer.rank=2&spell_targets.mind_sear>=3&!buff.mind_devourer.up&spell_targets.mind_sear<=7
actions.aoe+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7&!buff.mind_devourer.up
actions.aoe+=/void_bolt,if=insanity<=85
# Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks, or mind devourer is up on 2+ targets. If Mind Devourer is up do not cancel mind sear.
actions.aoe+=/mind_sear,target_if=max:spell_targets.mind_sear,if=buff.mind_devourer.up&spell_targets.mind_sear>1|spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3))&!variable.pool_for_cds,early_chain_if=ticks>=2&!buff.mind_devourer_ms_active.up,interrupt_immediate=1,interrupt_if=ticks>=2&!buff.mind_devourer_ms_active.up
actions.aoe+=/call_action_list,name=pl_torrent,if=talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=3&(!variable.holding_crash|raid_event.adds.count%(active_dot.vampiric_touch+raid_event.adds.count)<1.5)&((insanity>=50|dot.devouring_plague.ticking|buff.dark_reveries.up)|buff.voidform.up|buff.dark_ascension.up)
actions.aoe+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75&(!buff.mind_flay_insanity.up&talent.mind_flay_insanity|!talent.psychic_link))&variable.dp_cutoff
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied),if=variable.max_vts>0&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash)&!action.shadow_crash.in_flight
actions.aoe+=/shadow_word_pain,if=refreshable&target.time_to_die>=18&!talent.misery.enabled
# TODO: Check Yshaarj Gains for pressing this during Inescapable Torment.
actions.aoe+=/shadow_word_death,target_if=min:target.time_to_die,if=target.time_to_die<=5&insanity<=80&talent.death_and_madness
actions.aoe+=/damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
actions.aoe+=/mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
actions.aoe+=/mindgames,if=spell_targets.mind_sear<5&dot.devouring_plague.ticking|talent.psychic_link
actions.aoe+=/void_torrent,if=insanity<=35&!talent.psychic_link,target_if=variable.dots_up
# High priority action for Mind Flay: Insanity to fish for Idol of C'Thun procs
actions.aoe+=/mind_flay,if=buff.mind_flay_insanity.up&buff.surge_of_darkness.remains>=5&talent.idol_of_cthun&buff.surge_of_darkness.stack<=2,interrupt_if=ticks>=2,interrupt_immediate=1
actions.aoe+=/call_action_list,name=filler


actions.aoe_variables=variable,name=max_vts,op=set,default=12,value=spell_targets.vampiric_touch>?12
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
# Todo Revamp to fix undesired behaviour with unstacked fights
actions.aoe_variables+=/variable,name=vts_applied,op=set,value=(active_dot.vampiric_touch+8*action.shadow_crash.in_flight)>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=holding_crash,op=set,value=(variable.max_vts-active_dot.vampiric_touch)<4|raid_event.adds.in<10&raid_event.adds.count>(variable.max_vts-active_dot.vampiric_touch),if=variable.holding_crash
actions.aoe_variables+=/variable,name=manual_vts_applied,op=set,value=(active_dot.vampiric_touch+8*!variable.holding_crash)>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up

# Todo Check VE/DA enter conditions based on dots
actions.cds=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
actions.cds+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions.cds+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions.cds+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions.cds+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
# Sync Power Infusion with Voidform or Dark Ascension
actions.cds+=/power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
# Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
# Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
actions.cds+=/dark_ascension,if=pet.fiend.active|!talent.mindbender&!cooldown.fiend.up|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2
actions.cds+=/call_action_list,name=trinkets
# Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.cds+=/desperate_prayer,if=health.pct<=75

actions.filler=mind_flay,if=buff.mind_flay_insanity.up&dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
actions.filler+=/vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
actions.filler+=/mind_spike,if=buff.surge_of_darkness.up
actions.filler+=/lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75|spell_targets.lights_judgment>1
# Save up to 20s if adds are coming soon.
actions.filler+=/halo,if=raid_event.adds.in>20
actions.filler+=/shadow_word_death,target_if=min:target.time_to_die,if=target.health.pct<20&(spell_targets.mind_sear<4|talent.inescapable_torment.rank=2&pet.fiend.active)
# Save up to 10s if adds are coming soon.
actions.filler+=/divine_star,if=raid_event.adds.in>10
actions.filler+=/mind_spike,if=(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&!talent.idol_of_cthun
actions.filler+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
# Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
actions.filler+=/shadow_crash,if=raid_event.adds.in>30
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.filler+=/shadow_word_death,target_if=target.health.pct<20
# Use Divine Star while moving as a low-priority action
actions.filler+=/divine_star
# Use Shadow Word: Death while moving as a low-priority action
actions.filler+=/shadow_word_death
# Use Shadow Word: Pain while moving as a low-priority action
actions.filler+=/shadow_word_pain,target_if=min:remains

actions.main=call_action_list,name=main_variables
actions.main+=/call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|spell_targets.mind_sear>2)
actions.main+=/mindbender,if=variable.dots_up&(fight_remains<30|time_to_die>15)
# High priority Mind Blast action when using Inescapable Torment
actions.main+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
actions.main+=/damnation,target_if=dot.vampiric_touch.refreshable|dot.shadow_word_pain.refreshable
actions.main+=/void_bolt,if=variable.dots_up&insanity<=85
# Use Mind Devourer Procs on Mind Sear when facing 2 or more targets
actions.main+=/mind_sear,target_if=spell_targets.mind_sear>1&buff.mind_devourer.up
actions.main+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
actions.main+=/vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash)
actions.main+=/shadow_word_pain,target_if=min:remains,if=refreshable&target.time_to_die>=18&!talent.misery.enabled
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
actions.main+=/shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(talent.inescapable_torment.rank<2|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up
actions.main+=/mind_blast,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# TODO: Dont use if add events are coming soon when talented into PL
actions.main+=/mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
actions.main+=/shadow_crash,if=!variable.holding_crash
actions.main+=/dark_void,if=raid_event.adds.in>20
actions.main+=/devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
# TODO: Dont use if add events are coming soon when talented into PL
actions.main+=/void_torrent,if=insanity<=35&!variable.holding_crash,target_if=variable.all_dots_up
actions.main+=/call_action_list,name=filler

actions.main_variables=variable,name=dots_up,op=set,value=(dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking)|action.shadow_crash.in_flight
actions.main_variables+=/variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
actions.main_variables+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up

actions.pl_torrent=void_bolt
actions.pl_torrent+=/vampiric_touch,if=remains<=6&cooldown.void_torrent.remains<gcd*2
# Use Devouring Plague before Void Torrent cast if Voidform is not active and Mind Devourer is not active and fighting 4 or less targets or less not talented into Mind Sear
actions.pl_torrent+=/devouring_plague,if=remains<=4&cooldown.void_torrent.remains<gcd*2&!buff.voidform.up&(!talent.mind_sear|spell_targets.mind_sear<=4|!talent.surge_of_darkness&cooldown.mind_blast.full_recharge_time>=3)&!buff.mind_devourer.up
actions.pl_torrent+=/mind_sear,if=!variable.dp_cutoff|buff.mind_devourer.up
actions.pl_torrent+=/mind_blast,if=!talent.mindgames|cooldown.mindgames.remains>=3&!prev_gcd.1.mind_blast
actions.pl_torrent+=/void_torrent,if=dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking|buff.voidform.up
actions.pl_torrent+=/mindgames,if=dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&dot.devouring_plague.ticking|buff.voidform.up

actions.trinkets=use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
# Sync with cooldowns for Ancient Madness or use when the fight will end soon or at full stacks
actions.trinkets+=/use_item,name=desperate_invokers_codex,if=fight_remains<20|!talent.ancient_madness|(cooldown.dark_ascension.remains>10&talent.dark_ascension)|(cooldown.void_eruption.remains>10&talent.void_eruption)|(!talent.void_eruption&!talent.dark_ascension)

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=6849
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 48919 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
48919.0 48919.0 47.5 / 0.097% 8162.0 / 16.7% 66.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
706.0 704.0 Mana 0.65% 52.5 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAKRIJkgiAJtkkCiQQIBC

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 48919
Elemental Blast 8509 17.4% 20.9 14.25sec 121916 104910 Direct 20.9 100444 202462 121985 21.1% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.92 20.91 0.00 0.00 0.00 1.1621 0.0000 2550787.71 2550787.71 0.00% 104910.25 104910.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.89% 16.50 7 27 100444.00 48192 216641 100483.99 78522 123242 1656990 1656990 0.00%
crit 21.11% 4.41 0 13 202462.48 96384 420418 200883.16 0 409792 893798 893798 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.97

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:10.40
  • if_expr:talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
    single
    [O]:1.24
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
    single
    [S]:9.28
  • if_expr:talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
Flame Shock 5568 11.4% 84.0 3.57sec 19875 152188 Direct 84.0 6943 13952 8442 21.4% 0.0%
Periodic 192.4 4104 8247 4992 21.4% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 83.99 83.99 192.35 192.35 82.99 0.1306 1.5497 1669196.88 1669196.88 0.00% 5400.78 152187.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.61% 66.02 38 100 6942.82 3909 14851 6942.44 5780 8319 458364 458364 0.00%
crit 21.39% 17.97 4 36 13951.50 7817 29362 13951.50 11261 18030 250653 250653 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 78.58% 151.15 108 195 4104.17 2067 8733 4104.54 3547 4745 620336 620336 0.00%
crit 21.42% 41.21 16 71 8247.19 4071 17467 8248.82 6950 9997 339845 339845 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:1.02
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Fire damage and knocking them into the air.]

Action Priority List

    single
    [X]:9.15
Flametongue Weapon 0 (1053) 0.0% (2.2%) 1.0 0.00sec 315571 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1053 2.2% 677.3 0.71sec 466 0 Direct 677.3 396 796 466 17.4% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 677.35 677.35 0.00 0.00 0.00 0.0000 0.0000 315570.98 315570.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 559.49 407 730 396.32 306 903 396.40 355 468 221736 221736 0.00%
crit 17.40% 117.86 67 179 796.19 612 1786 796.35 695 959 93835 93835 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.23

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }
Forgestorm Ignited (_damage) 1092 2.2% 28.4 7.72sec 11537 0 Direct 28.4 9807 19717 11537 17.5% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.39 28.39 0.00 0.00 0.00 0.0000 0.0000 327560.95 327560.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.54% 23.44 2 63 9806.76 9732 10030 9806.81 9732 10030 229838 229838 0.00%
crit 17.46% 4.96 0 19 19716.58 19463 20059 19321.82 0 20059 97723 97723 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 5572 11.4% 39.8 7.51sec 41923 36181 Direct 39.8 35586 71585 41923 17.6% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.83 39.83 0.00 0.00 0.00 1.1587 0.0000 1669811.86 1669811.86 0.00% 36180.70 36180.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.40% 32.82 19 48 35586.36 8101 114374 35653.53 27707 47010 1167956 1167956 0.00%
crit 17.60% 7.01 0 19 71584.56 16202 226266 71651.11 0 176711 501855 501855 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [N]:35.42
  • if_expr:buff.hailstorm.up
    single
    [V]:4.41
Ice Strike 1996 4.1% 24.5 12.33sec 24383 20996 Direct 24.5 20737 41667 24383 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.54 24.54 0.00 0.00 0.00 1.1613 0.0000 598419.87 598419.87 0.00% 20996.45 20996.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 20.27 11 29 20736.69 15876 45946 20738.55 17922 24559 420260 420260 0.00%
crit 17.42% 4.28 0 14 41667.32 31752 87248 41215.51 0 72436 178160 178160 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:24.54
  • if_expr:talent.hailstorm.enabled
Lava Lash 9738 19.9% 67.9 4.37sec 42984 36955 Direct 67.9 (67.9) 36559 73393 42984 17.4% (17.4%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.90 67.90 0.00 0.00 0.00 1.1632 0.0000 2918734.21 2918734.21 0.00% 36954.89 36954.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 56.06 26 88 36559.18 18726 114296 36576.65 31216 45202 2049435 2049435 0.00%
crit 17.44% 11.84 2 29 73393.13 37452 217168 73442.13 54187 104332 869299 869299 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [I]:50.03
  • if_expr:buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
    single
    [R]:17.87
Lightning Bolt 3518 7.2% 16.3 18.71sec 64832 54419 Direct 16.3 53383 106858 64833 21.4% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.26 16.26 0.00 0.00 0.00 1.1914 0.0000 1053985.81 1053985.81 0.00% 54418.93 54418.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.59% 12.78 4 23 53383.39 30479 138795 53545.93 41269 75165 682059 682059 0.00%
crit 21.41% 3.48 0 11 106857.71 60959 274422 104012.66 0 239032 371927 371927 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [K]:7.00
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [P]:0.28
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [T]:8.98
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1734 3.5% 193.6 1.81sec 2686 1510 Direct 193.6 2655 5334 2686 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.56 193.56 0.00 0.00 0.00 1.7786 0.0000 519898.15 742730.58 30.00% 1510.16 1510.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.17% 128.07 82 173 2654.66 2257 4339 2654.82 2449 2993 339988 485709 30.00%
crit 17.42% 33.73 13 64 5334.34 4513 8580 5334.22 4758 6171 179910 257021 30.00%
miss 16.41% 31.76 10 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 868 1.8% 193.7 1.80sec 1344 755 Direct 193.7 1329 2670 1344 17.4% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.65 193.65 0.00 0.00 0.00 1.7790 0.0000 260251.69 371797.61 30.00% 755.43 755.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.23% 128.26 85 178 1328.52 1128 2169 1328.57 1217 1500 170391 243422 30.00%
crit 17.38% 33.66 12 61 2669.86 2257 4290 2669.96 2371 3073 89861 128376 30.00%
miss 16.39% 31.74 13 58 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 163 (3015) 0.3% (6.2%) 7.0 45.72sec 128393 107891 Direct 7.0 (14.0) 5896 11856 6929 17.3% (19.2%) 0.0%

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.00 1.1901 0.0000 48696.13 48696.13 0.00% 107890.56 107890.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.68% 5.81 1 8 5896.13 4707 9207 5898.17 4707 7562 34263 34263 0.00%
crit 17.32% 1.22 0 6 11856.38 9413 18203 8697.16 0 18203 14433 14433 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [J]:7.03
  • if_expr:buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
    Lightning Bolt (_pw) 2852 5.8% 7.0 45.90sec 122071 0 Direct 7.0 100549 202335 122073 21.1% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.00 0.0000 0.0000 854024.22 854024.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.86% 5.52 0 8 100548.98 71118 208193 100581.37 0 146484 554712 554712 0.00%
crit 21.14% 1.48 0 6 202335.09 142237 411633 163695.41 0 411633 299312 299312 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
Stormstrike 0 (2074) 0.0% (4.2%) 51.7 5.73sec 12020 10285

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.72 0.00 0.00 0.00 0.00 1.1688 0.0000 0.00 0.00 0.00% 10284.67 10284.67

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [Q]:51.72
    Stormstrike (_mh) 1382 2.8% 51.7 5.73sec 8012 0 Direct 51.7 6814 13704 8012 17.4% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.72 51.72 0.00 0.00 0.00 0.0000 0.0000 414412.08 592032.36 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 42.73 22 66 6813.83 5781 11308 6813.58 6153 7838 291154 415944 30.00%
crit 17.39% 8.99 0 22 13704.42 11562 22616 13705.78 0 19093 123259 176088 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 692 1.4% 51.7 5.73sec 4008 0 Direct 51.7 3406 6857 4008 17.4% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.72 51.72 0.00 0.00 0.00 0.0000 0.0000 207316.80 296174.41 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 42.70 24 67 3406.32 2890 5654 3406.33 3091 3961 145461 207807 30.00%
crit 17.44% 9.02 0 22 6857.18 5781 11308 6853.49 0 8796 61856 88367 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Sundering 825 1.7% 5.7 53.64sec 43129 37137 Direct 5.7 36545 73651 43128 17.7% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.74 5.74 0.00 0.00 0.00 1.1614 0.0000 247442.35 247442.35 0.00% 37136.78 37136.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.26% 4.72 0 8 36545.32 28224 77417 36530.51 0 61683 172473 172473 0.00%
crit 17.74% 1.02 0 5 73651.02 56449 147595 48930.91 0 142557 74970 74970 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [U]:5.74
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (1137) 0.0% (2.3%) 1.0 0.00sec 340730 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 1137 2.3% 152.0 4.06sec 2242 0 Direct 152.0 1907 3831 2242 17.4% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 152.00 152.00 0.00 0.00 0.00 0.0000 0.0000 340729.97 486769.51 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 125.56 65 188 1906.91 1612 3154 1907.02 1722 2193 239434 342057 30.00%
crit 17.40% 26.44 8 53 3830.84 3225 6308 3830.37 3342 4686 101296 144713 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}
pet - greater_earth_elemental 437 / 91
melee 437 0.2% 40.1 2.30sec 676 444 Direct 40.1 577 1153 676 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.08 40.08 0.00 0.00 0.00 1.5220 0.0000 27116.63 38739.03 30.00% 444.47 444.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 33.15 20 65 576.84 503 961 575.84 503 732 19122 27318 30.00%
crit 17.30% 6.93 0 20 1152.83 1005 1865 1149.73 0 1519 7995 11421 29.97%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2431 / 712
melee 2431 1.5% 89.8 3.41sec 2376 2112 Direct 89.8 2023 4040 2376 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.77 89.77 0.00 0.00 0.00 1.1251 0.0000 213257.59 304661.47 30.00% 2111.57 2111.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.53% 74.08 6 172 2023.42 1680 3248 2021.00 1680 2629 149901 214150 30.00%
crit 17.47% 15.68 0 42 4040.46 3359 6454 4035.55 0 6056 63356 90511 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2429 / 709
melee 2429 1.4% 89.3 3.42sec 2377 2112 Direct 89.3 2023 4045 2377 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.32 89.32 0.00 0.00 0.00 1.1254 0.0000 212317.30 303318.16 30.00% 2112.04 2112.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.51% 73.71 3 166 2023.49 1680 3248 2021.20 1680 2875 149143 213067 30.00%
crit 17.49% 15.62 0 47 4044.73 3359 6496 4037.40 0 5840 63174 90251 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2435 / 708
melee 2435 1.4% 89.0 3.42sec 2379 2115 Direct 89.0 2025 4048 2379 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.01 89.01 0.00 0.00 0.00 1.1245 0.0000 211732.72 302483.03 30.00% 2115.40 2115.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.49% 73.43 0 185 2024.57 1680 3248 2021.75 0 2747 148657 212373 30.00%
crit 17.51% 15.58 0 45 4048.00 3359 6496 4041.58 0 6347 63075 90110 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 310.57sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.12 0.00 0.00 0.00 0.00 1.0205 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [W]:1.12
Feral Spirit 10.7 30.06sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.73 0.00 0.00 0.00 0.00 1.1795 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:10.73
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 302.28sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.49
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 67.5 124.9 4.4sec 1.6sec 3.6sec 81.48% 98.20% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 15.3s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.4s

Stack Uptimes

  • ashen_catalyst_1:31.49%
  • ashen_catalyst_2:16.74%
  • ashen_catalyst_3:12.09%
  • ashen_catalyst_4:9.87%
  • ashen_catalyst_5:6.16%
  • ashen_catalyst_6:3.09%
  • ashen_catalyst_7:1.59%
  • ashen_catalyst_8:0.45%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crackling Surge 6.0 0.0 48.3sec 48.3sec 14.7sec 29.17% 32.78% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.2s / 287.8s
  • trigger_min/max:13.2s / 287.8s
  • trigger_pct:85.06%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crackling_surge_1:23.33%
  • crackling_surge_2:5.84%
  • crackling_surge_3:0.00%
  • crackling_surge_4:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.5sec 12.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.3s
  • trigger_min/max:0.0s / 165.0s
  • trigger_pct:100.00%
  • duration_min/max:16.2s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.33%
  • crumbling_power_2:0.35%
  • crumbling_power_3:0.58%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.67%
  • crumbling_power_7:0.66%
  • crumbling_power_8:0.66%
  • crumbling_power_9:0.65%
  • crumbling_power_10:0.63%
  • crumbling_power_11:0.63%
  • crumbling_power_12:0.63%
  • crumbling_power_13:0.63%
  • crumbling_power_14:0.64%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.73%
  • crumbling_power_17:0.78%
  • crumbling_power_18:0.83%
  • crumbling_power_19:1.00%
  • crumbling_power_20:0.01%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Elemental Blast: Critical Strike 7.0 0.0 40.8sec 40.8sec 9.8sec 22.86% 0.00% 0.0 (0.0) 6.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 284.4s
  • trigger_min/max:10.0s / 284.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_critical_strike_1:22.86%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.0 0.0 40.6sec 40.6sec 9.8sec 22.97% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 236.6s
  • trigger_min/max:10.0s / 236.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_haste_1:22.97%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 6.9 0.0 40.9sec 40.9sec 9.8sec 22.78% 0.00% 0.0 (0.0) 6.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 285.8s
  • trigger_min/max:10.0s / 285.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_mastery_1:22.78%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.0sec 98.9sec 58.0sec 25.07% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:25.07%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:Grants Haste and movement speed is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 125.1sec 100.8sec 58.1sec 24.84% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.8s

Stack Uptimes

  • elemental_chaos_earth_1:24.84%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:Grants Mastery and damage taken reduced.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 121.8sec 97.6sec 57.9sec 25.01% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:25.01%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:Grants Critical Strike and damage dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 125.6sec 100.8sec 57.8sec 25.07% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:25.07%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:Grants Versatility and healing dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.3sec 302.3sec 27.5sec 13.37% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 324.7s
  • trigger_min/max:300.0s / 324.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.37%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 10.7 0.0 29.2sec 30.1sec 14.7sec 52.54% 0.00% 42.0 (42.0) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 48.8s
  • trigger_min/max:15.2s / 46.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • feral_spirit_1:52.54%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 49.3 235.4 6.1sec 1.1sec 4.8sec 79.51% 88.14% 235.4 (509.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 59.3s
  • trigger_min/max:0.0s / 19.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.6s

Stack Uptimes

  • flurry_1:21.70%
  • flurry_2:34.44%
  • flurry_3:23.37%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.5sec 46.3sec 13.0sec 19.41% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 208.1s
  • trigger_min/max:0.1s / 202.4s
  • trigger_pct:98.87%
  • duration_min/max:0.0s / 62.1s

Stack Uptimes

  • forgestorm_ignited_1:19.41%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 35.7 1.5 8.4sec 8.1sec 2.2sec 26.01% 89.04% 1.5 (10.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 34.4s
  • trigger_min/max:1.2s / 34.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.8s

Stack Uptimes

  • hailstorm_5:4.80%
  • hailstorm_6:3.41%
  • hailstorm_7:2.68%
  • hailstorm_8:4.35%
  • hailstorm_9:2.58%
  • hailstorm_10:8.19%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.6 5.6 27.6sec 17.6sec 9.9sec 35.03% 88.58% 5.6 (5.6) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 205.2s
  • trigger_min/max:0.0s / 205.2s
  • trigger_pct:4.99%
  • duration_min/max:0.0s / 71.6s

Stack Uptimes

  • hot_hand_1:35.03%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.5 0.0 12.4sec 12.3sec 4.0sec 32.29% 60.30% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 29.3s
  • trigger_min/max:7.7s / 26.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.1s

Stack Uptimes

  • ice_strike_1:32.29%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 6.0 0.0 48.3sec 48.3sec 14.7sec 29.27% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 308.8s
  • trigger_min/max:14.0s / 308.8s
  • trigger_pct:84.90%
  • duration_min/max:0.0s / 29.5s

Stack Uptimes

  • icy_edge_1:23.37%
  • icy_edge_2:5.90%
  • icy_edge_3:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 38.0 227.4 8.0sec 1.1sec 6.9sec 87.40% 100.00% 16.9 (36.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.1s / 35.6s
  • trigger_min/max:0.0s / 14.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 33.2s

Stack Uptimes

  • maelstrom_weapon_1:11.15%
  • maelstrom_weapon_2:12.87%
  • maelstrom_weapon_3:13.22%
  • maelstrom_weapon_4:13.19%
  • maelstrom_weapon_5:10.11%
  • maelstrom_weapon_6:8.04%
  • maelstrom_weapon_7:6.21%
  • maelstrom_weapon_8:4.08%
  • maelstrom_weapon_9:2.28%
  • maelstrom_weapon_10:6.25%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 5.9 0.0 48.6sec 48.6sec 14.7sec 29.07% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.1s / 289.5s
  • trigger_min/max:13.1s / 289.5s
  • trigger_pct:84.85%
  • duration_min/max:0.0s / 29.7s

Stack Uptimes

  • molten_weapon_1:23.25%
  • molten_weapon_2:5.83%
  • molten_weapon_4:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Wave 7.0 0.0 45.7sec 45.7sec 2.0sec 4.59% 43.59% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 52.3s
  • trigger_min/max:45.0s / 52.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.9s

Stack Uptimes

  • primordial_wave_1:4.59%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.2 60.9sec 45.6sec 16.5sec 23.65% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 199.1s
  • trigger_min/max:0.1s / 196.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.4s

Stack Uptimes

  • sophic_devotion_1:23.65%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.0sec 45.6sec 32.2sec 38.17% 0.00% 25.7 (25.7) 3.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 237.6s
  • trigger_min/max:0.0s / 214.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 186.5s

Stack Uptimes

  • spiraling_winds_1:2.34%
  • spiraling_winds_2:2.31%
  • spiraling_winds_3:2.30%
  • spiraling_winds_4:2.28%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.22%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.77%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 7.0 0.0 45.9sec 45.9sec 11.8sec 27.59% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:39.0s / 54.8s
  • trigger_min/max:39.0s / 54.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • splintered_elements_1:27.59%

Spelldata

  • id:354648
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc354647=Each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave increases your Haste by {$s1=10}% for {$354648d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 30.7 8.7 9.6sec 7.4sec 2.8sec 29.13% 58.31% 8.7 (8.7) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 116.6s
  • trigger_min/max:0.0s / 113.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • stormbringer_1:29.13%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.9 8.0 51.0 10.9s 1.1s 147.3s
windfury_totem_extra_attack_oh 26.9 8.0 46.0 10.9s 1.1s 133.1s
Elemental Blast: Critical Strike 7.0 0.0 15.0 40.8s 10.0s 284.4s
Elemental Blast: Haste 7.0 0.0 15.0 40.6s 10.0s 236.6s
Elemental Blast: Mastery 6.9 1.0 15.0 40.9s 10.0s 285.8s
Maelstrom Weapon: Feral Spirit 63.0 48.0 80.0 4.8s 0.0s 31.7s
Maelstrom Weapon: Swirling Maelstrom 60.0 44.0 77.0 5.0s 0.8s 24.2s
Maelstrom Weapon: Primordial Wave 70.3 60.0 80.0 45.7s 45.0s 52.3s
Maelstrom Weapon: Windfury Attack 30.4 9.0 60.0 10.8s 0.0s 113.9s
Maelstrom Weapon: main_hand 32.4 13.0 55.0 9.4s 1.1s 109.2s
Maelstrom Weapon: offhand 32.4 12.0 59.0 9.4s 1.1s 92.7s
Maelstrom Weapon: Lava Lash 13.6 1.0 31.0 20.6s 0.8s 208.6s
Maelstrom Weapon: Sundering 1.1 0.0 6.0 104.7s 40.0s 331.9s
Maelstrom Weapon: Ice Strike 4.9 0.0 14.0 50.4s 7.7s 307.0s
Maelstrom Weapon: Stormstrike 10.3 0.0 24.0 26.7s 0.8s 258.0s
Maelstrom Weapon: Stormstrike Off-Hand 10.3 1.0 25.0 26.6s 0.8s 268.8s
Flametongue: Windfury Attack 152.0 82.0 230.0 4.1s 0.0s 49.7s
Stormbringer: Windfury Attack 17.0 3.0 36.0 17.9s 0.0s 212.3s
Flametongue: main_hand 161.8 112.0 217.0 2.2s 1.1s 15.9s
Hot Hand: main_hand 8.1 0.0 21.0 33.2s 1.1s 287.9s
Windfury: main_hand 50.4 24.0 89.0 6.2s 1.1s 74.0s
Flametongue: offhand 161.9 110.0 217.0 2.2s 1.1s 20.5s
Hot Hand: offhand 8.1 0.0 21.0 32.7s 1.1s 291.2s
Flametongue: Lava Lash 67.9 33.0 107.0 4.4s 0.8s 15.5s
Stormbringer: Lava Lash 7.6 0.0 21.0 34.3s 0.8s 292.5s
Flametongue: Sundering 5.7 3.0 8.0 53.7s 40.0s 195.6s
Stormbringer: Sundering 0.6 0.0 4.0 113.8s 40.0s 335.7s
Windfury: Sundering 1.8 0.0 7.0 97.3s 40.0s 341.9s
Flametongue: Ice Strike 24.5 19.0 30.0 12.3s 7.7s 26.8s
Stormbringer: Ice Strike 2.7 0.0 10.0 70.5s 7.8s 333.1s
Windfury: Ice Strike 7.6 0.0 21.0 36.1s 7.7s 274.2s
Flametongue: Stormstrike 51.7 31.0 75.0 5.7s 0.8s 39.6s
Stormbringer: Stormstrike 5.8 0.0 22.0 41.5s 0.8s 314.6s
Windfury: Stormstrike 16.1 4.0 32.0 17.7s 0.8s 188.5s
Flametongue: Stormstrike Off-Hand 51.7 31.0 75.0 5.7s 0.8s 39.6s
Stormbringer: Stormstrike Off-Hand 5.8 0.0 17.0 41.3s 0.8s 314.2s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 24.09% 14.02% 30.37% 0.5s 0.0s 4.5s
Hot Hand 35.03% 6.01% 62.88% 9.9s 0.0s 71.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7060.0001.5267.5911.74613.094
Lava Lash0.9070.00011.62761.90829.847106.394
Primordial Wave0.7590.0007.2925.3411.05813.922
Elemental Blast2.6350.00041.00755.98811.478124.528
Sundering14.1720.000155.61585.17032.409213.892
Windstrike
Stormstrike
1.8930.00024.83398.78242.185163.758
Ice Strike0.7780.00014.04619.1645.20645.919
Frost Shock2.8850.00026.359116.05065.166180.080
Flame Shock25.4180.000293.815256.257167.628344.936
Earth Elemental30.5900.000268.05736.2627.319268.057

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack29.01.49.93%3.89%
main_hand30.41.910.42%5.26%
offhand30.61.810.48%4.97%
Feral Spirit58.84.220.15%11.33%
Lava Lash12.90.74.41%1.99%
Primordial Wave43.826.515.00%72.00%
Sundering1.10.00.39%0.00%
Ice Strike29.30.210.03%0.47%
Frost Shock35.40.012.13%0.01%
Stormstrike (_mh)10.30.03.53%0.00%
Stormstrike Off-Hand10.30.03.53%0.08%
Overflow Stacks0.036.90.00%11.21%
Actual Stacks291.80.088.79%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt130.245.19%
Elemental Blast157.954.81%
Total Spent288.1100.00%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
mana_regenMana625.15211210.12100.00%337.85268171.9355.94%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 704.03 706.03 268172.3 49400.3 47000.0 50000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.001000.000.47%1000.001000.000.00
Elemental BlastMana 20.9228768.5013.58%1375.001375.0088.67
Flame ShockMana 9.156858.893.24%750.0081.67243.36
Frost ShockMana 39.8319915.619.40%500.00500.0183.84
Ice StrikeMana 24.5440495.0619.12%1650.001650.0014.78
Lava LashMana 67.9027160.8112.82%400.00399.99107.46
Lightning BoltMana 16.268128.783.84%500.00500.01129.66
Primordial WaveMana 7.0310546.394.98%1500.001500.0085.60
StormstrikeMana 51.7251723.6424.42%1000.001000.0012.02
SunderingMana 5.7417212.118.13%3000.003000.0414.38

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 48918.97
Minimum 42215.51
Maximum 60673.90
Spread ( max - min ) 18458.39
Range [ ( max - min ) / 2 * 100% ] 18.87%
Standard Deviation 2100.5215
5th Percentile 45641.37
95th Percentile 52543.78
( 95th Percentile - 5th Percentile ) 6902.40
Mean Distribution
Standard Deviation 24.2563
95.00% Confidence Interval ( 48871.43 - 48966.51 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7083
0.1 Scale Factor Error with Delta=300 37665
0.05 Scale Factor Error with Delta=300 150660
0.01 Scale Factor Error with Delta=300 3766500
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 48918.97
Minimum 42215.51
Maximum 60673.90
Spread ( max - min ) 18458.39
Range [ ( max - min ) / 2 * 100% ] 18.87%
Standard Deviation 2100.5215
5th Percentile 45641.37
95th Percentile 52543.78
( 95th Percentile - 5th Percentile ) 6902.40
Mean Distribution
Standard Deviation 24.2563
95.00% Confidence Interval ( 48871.43 - 48966.51 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7083
0.1 Scale Factor Error with Delta=300 37665
0.05 Scale Factor Error with Delta=300 150660
0.01 Scale Factor Error with Delta=300 3766500
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 48918.97
Minimum 42215.51
Maximum 60673.90
Spread ( max - min ) 18458.39
Range [ ( max - min ) / 2 * 100% ] 18.87%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 13996839.66
Minimum 10199564.23
Maximum 18460520.34
Spread ( max - min ) 8260956.10
Range [ ( max - min ) / 2 * 100% ] 29.51%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.49 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 invoke_external_buff,name=power_infusion,if=(talent.ascendance.enabled&talent.thorims_invocation.enabled&buff.ascendance.up)|(!talent.thorims_invocation.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.thorims_invocation.enabled&!talent.feral_spirit.enabled)|fight_remains<=20
F 10.73 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
0.00 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
G 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
H 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
I 50.03 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
0.00 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
0.00 ice_strike,if=buff.doom_winds.up
0.00 sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
J 7.03 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking
K 7.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
L 10.40 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
M 24.54 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
N 35.42 frost_shock,if=buff.hailstorm.up
0.00 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
0.00 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
0.00 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
O 1.24 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
P 0.28 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
Q 51.72 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
0.00 ice_strike
R 17.87 lava_lash
S 9.28 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
T 8.98 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
U 5.74 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
V 4.41 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
W 1.12 earth_elemental
X 9.15 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

0123478ACDEFBJKIMINIQIQILNMQRUTNQQQQMQISINFIQIMSNQRWSNQXMRTNJKQNRXMQFSNRQUQQMLNQQIQITIMINQTXNRQFMJKNQRSNXQMRTNQUXIVIFIMQLNRQQQLNMRQVXJKNQMFIQSNUXQRMLNQXRQITIIMINILINQXMDEFJKNIQIUIMIQLINIQITMNQQFRSNQSMNQRQITIINIJIKMFNQRSNUQQMQLNIXQQTNMQRTNFQSNRMQSNJKINIQIMIQFLNQRSNMQPNRT

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 2 augmentation PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_fire
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
0:00.000 default C auto_attack Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, elemental_chaos_fire
0:00.000 default D use_items Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, maelstrom_weapon, elemental_chaos_fire
0:00.000 default E berserking Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(3), stormbringer, maelstrom_weapon, crumbling_power(20), elemental_chaos_fire
0:00.000 default F feral_spirit Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, berserking, flurry(3), stormbringer, maelstrom_weapon, crumbling_power(20), elemental_chaos_fire
0:00.895 default B potion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, molten_weapon, crackling_surge, stormbringer, maelstrom_weapon(2), crumbling_power(19), elemental_chaos_fire
0:00.895 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, molten_weapon, crackling_surge, stormbringer, maelstrom_weapon(2), crumbling_power(19), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:01.790 single K lightning_bolt Fluffy_Pillow 49932.0/50000: 100% mana bloodlust, berserking, flurry(2), primordial_wave, feral_spirit, molten_weapon, crackling_surge, stormbringer, maelstrom_weapon(10), crumbling_power(19), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:02.684 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, hailstorm(10), crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:03.498 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), crumbling_power(17), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:04.311 single I lava_lash Fluffy_Pillow 49650.8/50000: 99% mana bloodlust, berserking, flurry(3), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, crumbling_power(16), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:05.123 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, crumbling_power(15), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:05.935 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), crumbling_power(14), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:06.749 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), crumbling_power(13), spiraling_winds, forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:07.562 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), crumbling_power(12), spiraling_winds, forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:08.375 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), crumbling_power(11), spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:09.190 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(8), crumbling_power(10), spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:10.002 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(8), crumbling_power(9), spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:10.815 single N frost_shock Fluffy_Pillow 49925.8/50000: 100% mana bloodlust, berserking, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hailstorm(8), crumbling_power(8), spiraling_winds(3), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:11.628 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon, crumbling_power(7), spiraling_winds(3), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:12.441 single Q stormstrike Fluffy_Pillow 49650.8/50000: 99% mana bloodlust, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), ice_strike, crumbling_power(6), spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:13.358 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), ice_strike, crumbling_power(5), spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:14.252 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(4), ice_strike, crumbling_power(4), spiraling_winds(5), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:15.236 single T lightning_bolt Fluffy_Pillow 48574.4/50000: 97% mana bloodlust, flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(5), ice_strike, crumbling_power(3), spiraling_winds(5), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:16.219 single N frost_shock Fluffy_Pillow 49647.2/50000: 99% mana bloodlust, flurry(2), elemental_blast_mastery, ashen_catalyst(2), hailstorm(5), ice_strike, crumbling_power(2), spiraling_winds(5), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:17.203 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(2), crumbling_power, spiraling_winds(6), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:18.207 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, ashen_catalyst(4), stormbringer, maelstrom_weapon(2), spiraling_winds(6), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:19.190 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, ashen_catalyst(4), stormbringer, maelstrom_weapon(2), spiraling_winds(7), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:20.173 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), ashen_catalyst(5), stormbringer, maelstrom_weapon(3), spiraling_winds(7), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:21.157 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), ashen_catalyst(6), stormbringer, maelstrom_weapon(4), spiraling_winds(8), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:22.145 single Q stormstrike Fluffy_Pillow 49922.8/50000: 100% mana bloodlust, flurry(2), ashen_catalyst(7), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(8), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:23.130 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), ashen_catalyst(7), hot_hand, maelstrom_weapon(7), ice_strike, spiraling_winds(9), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:24.112 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), ice_strike, spiraling_winds(9), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:25.097 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, hailstorm(7), ice_strike, spiraling_winds(10), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:26.081 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst, hot_hand, hailstorm(7), ice_strike, spiraling_winds(10), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:27.066 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon, spiraling_winds(10), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:28.050 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:29.033 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:30.018 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:31.001 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), maelstrom_weapon(3), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
0:31.984 single S elemental_blast Fluffy_Pillow 49922.8/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(5), ice_strike, forgestorm_ignited, elemental_chaos_fire
0:32.967 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst(2), hailstorm(5), ice_strike, forgestorm_ignited, elemental_chaos_fire
0:33.923 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_fire
0:34.878 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
0:35.833 single W earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_fire
0:36.789 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_fire
0:37.742 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon, hailstorm(5), forgestorm_ignited, elemental_chaos_fire
0:38.695 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_fire
0:39.649 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
0:40.604 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
0:41.934 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(6), maelstrom_weapon(5), ice_strike, forgestorm_ignited, elemental_chaos_fire
0:43.175 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, maelstrom_weapon(6), ice_strike, forgestorm_ignited, elemental_chaos_fire
0:44.451 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, hailstorm(6), ice_strike, forgestorm_ignited, elemental_chaos_fire
0:45.730 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon, forgestorm_ignited, elemental_chaos_fire
0:47.171 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, ashen_catalyst(3), maelstrom_weapon(10), forgestorm_ignited, elemental_chaos_fire
0:48.447 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(4), maelstrom_weapon, hailstorm(10), elemental_chaos_fire
0:49.608 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(4), maelstrom_weapon(2), hailstorm(10), elemental_chaos_fire
0:50.769 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(5), maelstrom_weapon(3), elemental_chaos_fire
0:51.929 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst, maelstrom_weapon(3), elemental_chaos_fire
0:53.090 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(2), maelstrom_weapon(3), elemental_chaos_fire
0:54.252 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), ice_strike, elemental_chaos_fire
0:55.413 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(3), maelstrom_weapon(6), ice_strike, elemental_chaos_fire
0:56.575 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(7), ice_strike, elemental_chaos_fire
0:57.737 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), hailstorm(7), ice_strike, elemental_chaos_fire
0:58.898 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(2), elemental_chaos_fire
1:00.059 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(2), elemental_chaos_air
1:01.356 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), elemental_chaos_air
1:02.592 single Q stormstrike Fluffy_Pillow 48977.6/50000: 98% mana flurry(3), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(3), elemental_chaos_air
1:03.829 single Q stormstrike Fluffy_Pillow 49956.8/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(5), elemental_chaos_air
1:05.067 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(7), elemental_chaos_air
1:06.304 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_air
1:07.541 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), stormbringer, maelstrom_weapon, hailstorm(8), ice_strike, forgestorm_ignited, elemental_chaos_air
1:08.742 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), stormbringer, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_air
1:09.944 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(7), stormbringer, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_air
1:11.145 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(8), hot_hand, stormbringer, maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_air
1:12.346 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_air
1:13.548 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_air
1:14.749 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_air
1:15.948 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(2), hot_hand, hailstorm(8), forgestorm_ignited, elemental_chaos_air
1:17.150 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(8), forgestorm_ignited, elemental_chaos_air
1:18.388 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(8), ice_strike, forgestorm_ignited, elemental_chaos_air
1:19.626 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(4), hailstorm(8), ice_strike, forgestorm_ignited, elemental_chaos_air
1:20.861 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_air
1:22.099 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(3), maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_air
1:23.335 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), hailstorm(7), forgestorm_ignited, elemental_chaos_air
1:24.571 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), hailstorm(7), forgestorm_ignited, elemental_chaos_air
1:25.808 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon, forgestorm_ignited, elemental_chaos_air
1:27.045 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon, sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:28.282 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, stormbringer, maelstrom_weapon(5), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:29.519 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:30.755 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(8), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:32.131 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_air
1:33.365 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, sophic_devotion, elemental_chaos_air
1:34.490 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(3), sophic_devotion, elemental_chaos_air
1:35.615 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(5), sophic_devotion, elemental_chaos_air
1:36.741 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(5), sophic_devotion, elemental_chaos_air
1:37.866 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon, hailstorm(5), sophic_devotion, elemental_chaos_air
1:38.990 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), sophic_devotion, elemental_chaos_air
1:40.115 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), sophic_devotion, elemental_chaos_air
1:41.239 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), elemental_chaos_air
1:42.364 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(6), ice_strike, elemental_chaos_air
1:43.590 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, maelstrom_weapon(8), ice_strike, elemental_chaos_air
1:44.715 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst, hailstorm(8), ice_strike, elemental_chaos_air
1:45.950 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon, elemental_chaos_air
1:47.185 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_air
1:48.422 single X flame_shock Fluffy_Pillow 48979.2/50000: 98% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_air
1:49.659 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(4), hot_hand, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_air
1:50.896 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_air
1:52.133 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_air
1:53.371 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), hot_hand, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_air
1:54.608 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_air
1:55.843 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_air
1:57.081 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(7), ice_strike, forgestorm_ignited, elemental_chaos_air
1:58.319 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(8), ice_strike, forgestorm_ignited, elemental_chaos_air
1:59.555 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon, hailstorm(8), ice_strike, forgestorm_ignited, elemental_chaos_air
2:00.791 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(2), elemental_chaos_fire
2:02.067 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
2:03.344 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_fire
2:04.622 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_fire
2:05.899 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_fire
2:07.175 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(4), hailstorm(8), forgestorm_ignited, elemental_chaos_fire
2:08.450 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_fire
2:09.726 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(5), maelstrom_weapon(3), ice_strike, forgestorm_ignited, elemental_chaos_fire
2:11.002 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(3), ice_strike, forgestorm_ignited, elemental_chaos_fire
2:12.278 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(4), ice_strike, forgestorm_ignited, elemental_chaos_fire
2:13.555 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(4), elemental_chaos_fire
2:14.830 Waiting     0.854 sec 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(4), elemental_chaos_fire
2:15.684 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(4), elemental_chaos_fire
2:17.172 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), primordial_wave, ashen_catalyst(4), maelstrom_weapon(10), elemental_chaos_fire
2:18.450 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(5), hailstorm(10), elemental_chaos_fire
2:19.612 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(6), maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
2:20.774 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst(7), stormbringer, maelstrom_weapon(2), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:21.975 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(8), stormbringer, maelstrom_weapon(4), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:23.136 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(8), stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:24.297 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:25.458 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(6), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:26.618 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hailstorm(6), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:27.779 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:28.940 single X flame_shock Fluffy_Pillow 48857.6/50000: 98% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:30.101 single Q stormstrike Fluffy_Pillow 49965.2/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:31.451 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), maelstrom_weapon(5), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:32.728 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, stormbringer, maelstrom_weapon(5), sophic_devotion, elemental_chaos_fire
2:34.003 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_fire
2:35.278 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, hailstorm(8), ice_strike, elemental_chaos_fire
2:36.520 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(2), elemental_chaos_fire
2:37.760 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(3), elemental_chaos_fire
2:38.999 Waiting     0.271 sec 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(3), elemental_chaos_fire
2:39.270 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(3), elemental_chaos_fire
2:40.665 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst, stormbringer, maelstrom_weapon(3), elemental_chaos_fire
2:41.905 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), elemental_chaos_fire
2:43.143 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(5), elemental_chaos_fire
2:44.382 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, hailstorm(5), elemental_chaos_fire
2:45.660 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5), elemental_chaos_fire
2:46.937 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5), elemental_chaos_fire
2:48.214 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(5), ice_strike, sophic_devotion, elemental_chaos_fire
2:49.490 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(5), ice_strike, sophic_devotion, elemental_chaos_fire
2:50.767 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), sophic_devotion, elemental_chaos_fire
2:52.045 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), sophic_devotion, elemental_chaos_fire
2:53.322 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(2), hot_hand, stormbringer, hailstorm(8), sophic_devotion, elemental_chaos_fire
2:54.562 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, stormbringer, hailstorm(8), sophic_devotion, elemental_chaos_fire
2:55.802 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, stormbringer, maelstrom_weapon, sophic_devotion, elemental_chaos_fire
2:57.043 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
2:58.281 Waiting     0.967 sec 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
2:59.248 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
3:00.684 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(3), ice_strike, sophic_devotion, elemental_chaos_fire
3:00.684 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(3), ice_strike, crumbling_power(20), sophic_devotion, elemental_chaos_fire
3:00.684 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(3), ice_strike, crumbling_power(20), sophic_devotion, elemental_chaos_fire
3:01.811 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(4), ice_strike, crumbling_power(19), sophic_devotion, elemental_chaos_fire
3:02.938 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(10), ice_strike, crumbling_power(19), elemental_chaos_fire
3:04.099 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon, hailstorm(10), ice_strike, crumbling_power(18), elemental_chaos_fire
3:05.155 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), hot_hand, maelstrom_weapon(2), crumbling_power(17), elemental_chaos_fire
3:06.212 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(2), crumbling_power(16), elemental_chaos_fire
3:07.268 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), crumbling_power(15), elemental_chaos_fire
3:08.325 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, hot_hand, maelstrom_weapon(3), crumbling_power(14), elemental_chaos_fire
3:09.381 single I lava_lash Fluffy_Pillow 48689.6/50000: 97% mana berserking, flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), crumbling_power(13), elemental_chaos_fire
3:10.438 single M ice_strike Fluffy_Pillow 49980.8/50000: 100% mana berserking, flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(4), crumbling_power(12), elemental_chaos_fire
3:11.494 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), ice_strike, crumbling_power(11), elemental_chaos_fire
3:12.551 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(6), ice_strike, crumbling_power(10), elemental_chaos_fire
3:13.607 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(8), ice_strike, crumbling_power(9), elemental_chaos_fire
3:14.769 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, hailstorm(8), ice_strike, crumbling_power(8), elemental_chaos_fire
3:15.895 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(8), ice_strike, crumbling_power(7), elemental_chaos_fire
3:17.133 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), crumbling_power(6), elemental_chaos_fire
3:18.370 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), crumbling_power(5), elemental_chaos_fire
3:19.609 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon(9), crumbling_power(4), elemental_chaos_fire
3:20.849 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(9), elemental_chaos_fire
3:22.087 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hailstorm(9), elemental_chaos_fire
3:23.445 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(3), hailstorm(9), ice_strike, elemental_chaos_fire
3:24.685 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(3), maelstrom_weapon(4), elemental_chaos_fire
3:25.961 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(4), stormbringer, maelstrom_weapon(4), elemental_chaos_fire
3:27.238 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(4), maelstrom_weapon(5), elemental_chaos_fire
3:28.513 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(6), elemental_chaos_fire
3:29.789 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(6), elemental_chaos_fire
3:31.065 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon, hailstorm(6), spiraling_winds, elemental_chaos_fire
3:32.342 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), spiraling_winds, elemental_chaos_fire
3:33.618 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(6), spiraling_winds(2), elemental_chaos_fire
3:34.894 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon, hailstorm(6), spiraling_winds(3), forgestorm_ignited, elemental_chaos_fire
3:36.170 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(2), hailstorm(6), ice_strike, spiraling_winds(3), forgestorm_ignited, elemental_chaos_fire
3:37.446 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(4), spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire
3:38.723 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), maelstrom_weapon(6), spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire
3:39.999 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(8), spiraling_winds(5), forgestorm_ignited, elemental_chaos_fire
3:41.277 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(8), spiraling_winds(6), forgestorm_ignited, elemental_chaos_fire
3:42.554 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, hot_hand, maelstrom_weapon(9), spiraling_winds(6), forgestorm_ignited, elemental_chaos_fire
3:43.830 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, hailstorm(9), spiraling_winds(7), forgestorm_ignited, elemental_chaos_fire
3:45.107 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(9), spiraling_winds(8), forgestorm_ignited, elemental_chaos_fire
3:46.384 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(9), spiraling_winds(8), forgestorm_ignited, elemental_chaos_fire
3:47.662 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(9), forgestorm_ignited, elemental_chaos_fire
3:48.938 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:50.215 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:51.493 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:52.770 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst, stormbringer, hailstorm(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:53.932 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:55.092 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:56.254 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), stormbringer, maelstrom_weapon(6), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:57.415 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon(7), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:58.577 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_fire
3:59.740 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon, hailstorm(7), spiraling_winds(10), elemental_chaos_fire
4:00.902 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_air
4:02.027 single Q stormstrike Fluffy_Pillow 48800.0/50000: 98% mana flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_air
4:03.152 single Q stormstrike Fluffy_Pillow 49600.0/50000: 99% mana flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), stormbringer, maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_air
4:04.276 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), stormbringer, maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_air
4:05.513 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(6), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_air
4:06.750 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(6), maelstrom_weapon(8), ice_strike, spiraling_winds(10), elemental_chaos_air
4:07.985 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(7), hailstorm(8), ice_strike, spiraling_winds(10), elemental_chaos_air
4:09.221 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(8), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_air
4:10.458 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_air
4:11.694 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_air
4:12.930 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_air
4:14.167 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_air
4:15.405 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(2), hailstorm(7), spiraling_winds(10), elemental_chaos_air
4:16.640 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_air
4:17.877 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(5), stormbringer, maelstrom_weapon(6), ice_strike, spiraling_winds(10), elemental_chaos_air
4:19.113 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(6), maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_air
4:20.349 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, maelstrom_weapon(8), ice_strike, spiraling_winds(10), elemental_chaos_air
4:21.585 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, maelstrom_weapon, hailstorm(8), ice_strike, elemental_chaos_air
4:22.821 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), maelstrom_weapon(5), elemental_chaos_air
4:24.060 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(6), elemental_chaos_air
4:25.297 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_air
4:26.534 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon, hailstorm(7), forgestorm_ignited, elemental_chaos_air
4:27.770 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_air
4:29.008 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(3), spiraling_winds, forgestorm_ignited, elemental_chaos_air
4:30.245 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(4), ice_strike, spiraling_winds(2), forgestorm_ignited, elemental_chaos_air
4:31.482 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(7), ice_strike, spiraling_winds(2), forgestorm_ignited, elemental_chaos_air
4:32.719 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(2), hailstorm(7), ice_strike, spiraling_winds(3), forgestorm_ignited, elemental_chaos_air
4:33.921 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds(4), forgestorm_ignited, elemental_chaos_air
4:35.139 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(10), spiraling_winds(4), forgestorm_ignited, elemental_chaos_air
4:36.340 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(6), hot_hand, hailstorm(10), spiraling_winds(5), elemental_chaos_air
4:37.431 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), hot_hand, hailstorm(10), spiraling_winds(5), elemental_chaos_air
4:38.524 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(2), spiraling_winds(6), elemental_chaos_air
4:39.617 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(3), spiraling_winds(6), elemental_chaos_air
4:40.708 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), spiraling_winds(7), elemental_chaos_air
4:41.802 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, hot_hand, maelstrom_weapon(4), spiraling_winds(8), elemental_chaos_air
4:42.928 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(8), elemental_chaos_air
4:44.052 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(9), elemental_chaos_air
4:45.177 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(9), elemental_chaos_air
4:46.303 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_air
4:47.428 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), stormbringer, hailstorm(10), ice_strike, spiraling_winds(10), elemental_chaos_air
4:48.666 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_air
4:49.902 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_air
4:51.138 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_air
4:52.373 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(3), hailstorm(6), spiraling_winds(10), elemental_chaos_air
4:53.607 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(4), elemental_chaos_air
4:54.845 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(8), ice_strike, elemental_chaos_air
4:56.083 single P lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(10), ice_strike, elemental_chaos_air
4:57.320 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon, hailstorm(10), ice_strike, elemental_chaos_air
4:58.558 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon(3), sophic_devotion, elemental_chaos_air
4:59.796 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(5), sophic_devotion, elemental_chaos_air

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 11114 10585 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 222280 211700 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.82% 15.82% 1047
Haste 17.84% 17.84% 3032
Versatility 7.11% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 58.69% 58.69% 3842
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +386 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAKRIJkgiAJtkkCiQQIBC
dragonflight.player.ominous_chromatic_essence_dragonflight=obsidian
dragonflight.player.ashkandur_humanoid=

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/invoke_external_buff,name=power_infusion,if=(talent.ascendance.enabled&talent.thorims_invocation.enabled&buff.ascendance.up)|(!talent.thorims_invocation.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.thorims_invocation.enabled&!talent.feral_spirit.enabled)|fight_remains<=20
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1047
# gear_haste_rating=3032
# gear_mastery_rating=3842
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Gamba : 51582 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
51581.8 51581.8 90.9 / 0.176% 15893.8 / 30.8% 58.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
820.5 817.8 Mana 1.29% 52.4 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAoEhkQCKCk0SSaICQikCC

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Gamba 51582
Ascendance (_dre) 0 (1069) 0.0% (2.1%) 8.2 31.51sec 39052 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.20 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
    Ascendance (_damage_dre) 1069 2.1% 8.2 31.51sec 39052 0 Direct 8.2 32594 65467 39052 19.6% 0.0%

Stats Details: Ascendance Damage Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.20 8.20 0.00 0.00 0.00 0.0000 0.0000 320250.64 320250.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.35% 6.59 0 21 32593.76 26756 54404 32549.48 0 51589 214772 214772 0.00%
crit 19.65% 1.61 0 7 65466.86 53513 109153 52119.78 0 107907 105479 105479 0.00%

Action Details: Ascendance Damage Dre

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 83 0.2% 3.7 90.41sec 6619 6054 Direct 3.7 6619 0 6619 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0936 0.0000 24707.90 35297.90 30.00% 6054.37 6054.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.73 3 4 6619.43 3882 13945 6634.93 5140 9425 24708 35298 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [G]:3.73
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 7558 14.7% 25.4 11.66sec 89346 76120 Direct 25.4 73871 148352 89379 20.8% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.37 25.36 0.00 0.00 0.00 1.1738 0.0000 2266842.26 2266842.26 0.00% 76119.62 76119.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.18% 20.08 9 30 73870.61 46178 146519 73853.99 59418 87508 1483348 1483348 0.00%
crit 20.82% 5.28 0 14 148352.28 92355 289111 148020.38 0 239271 783494 783494 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.97

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [R]:25.37
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
Flame Shock 1645 3.2% 29.2 10.13sec 16895 41136 Direct 29.2 2893 5807 3517 21.4% 0.0%
Periodic 187.4 1714 3443 2085 21.5% 0.0% 97.1%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.21 29.21 187.37 187.37 28.02 0.4107 1.5545 493427.11 493427.11 0.00% 1627.08 41136.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.59% 22.95 9 42 2893.37 2403 4958 2893.04 2591 3429 66415 66415 0.00%
crit 21.41% 6.25 0 18 5807.10 4805 9915 5798.53 0 8717 36305 36305 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 78.53% 147.14 102 191 1713.93 1 2949 1713.53 1550 1908 252191 252191 0.00%
crit 21.47% 40.23 17 67 3442.92 5 5831 3442.73 3032 3968 138516 138516 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:1.02
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Fire damage and knocking them into the air.]

Action Priority List

    single
    [N]:1.19
  • if_expr:!ticking
    single
    [Z]:9.22
Flametongue Weapon 0 (1575) 0.0% (3.1%) 1.0 0.00sec 471826 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1575 3.1% 1118.7 0.67sec 422 0 Direct 1118.7 359 721 422 17.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1118.69 1118.69 0.00 0.00 0.00 0.0000 0.0000 471826.02 471826.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 925.00 632 1235 359.15 293 603 359.19 325 396 332216 332216 0.00%
crit 17.31% 193.69 112 296 720.78 587 1206 720.94 650 803 139610 139610 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.23

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }
Forgestorm Ignited (_damage) 1118 2.2% 29.0 7.57sec 11549 0 Direct 29.0 9807 19716 11549 17.6% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.03 29.03 0.00 0.00 0.00 0.0000 0.0000 335297.69 335297.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.42% 23.93 2 66 9807.13 9732 10030 9806.79 9732 10030 234675 234675 0.00%
crit 17.58% 5.10 0 21 19715.95 19463 20059 19380.97 0 20059 100622 100622 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1009 2.0% 15.4 18.11sec 19648 16789 Direct 15.4 16727 33586 19648 17.3% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.42 15.42 0.00 0.00 0.00 1.1703 0.0000 302961.17 302961.17 0.00% 16789.20 16789.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 12.75 3 27 16726.65 7763 32034 16794.44 11996 21506 213228 213228 0.00%
crit 17.33% 2.67 0 11 33586.07 15525 62486 31442.59 0 60738 89733 89733 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [X]:15.42
Ice Strike 1499 2.9% 20.6 14.68sec 21808 18838 Direct 20.6 18536 37238 21808 17.5% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.60 20.60 0.00 0.00 0.00 1.1577 0.0000 449319.81 449319.81 0.00% 18837.83 18837.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.50% 17.00 7 26 18536.10 15213 31389 18536.93 16265 21697 315089 315089 0.00%
crit 17.50% 3.60 0 12 37237.93 30425 60527 36429.64 0 59516 134231 134231 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:2.63
  • if_expr:buff.doom_winds.up
    single
    [T]:17.98
Lava Lash 1416 2.7% 18.8 15.59sec 22608 19283 Direct 18.8 19231 38518 22607 17.5% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.80 18.80 0.00 0.00 0.00 1.1725 0.0000 424947.82 424947.82 0.00% 19283.38 19283.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.49% 15.51 6 25 19231.03 16021 33057 19223.52 17072 22132 298191 298191 0.00%
crit 17.51% 3.29 0 10 38517.78 32042 65152 37186.75 0 59435 126757 126757 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [O]:4.32
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [U]:14.48
Lightning Bolt 4518 8.8% 20.7 13.65sec 65499 55781 Direct 20.7 53827 107935 65499 21.6% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.69 20.69 0.00 0.00 0.00 1.1742 0.0000 1355423.98 1355423.98 0.00% 55781.06 55781.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.43% 16.23 6 28 53827.00 35046 112489 53826.21 42776 67355 873594 873594 0.00%
crit 21.57% 4.46 0 15 107934.59 70092 224977 106819.83 0 170249 481830 481830 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [S]:6.82
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [V]:13.87
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1466 2.8% 163.8 2.13sec 2684 1582 Direct 163.8 2651 5328 2684 17.4% 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 163.80 163.80 0.00 0.00 0.00 1.6964 0.0000 439612.70 628034.16 30.00% 1582.08 1582.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.28% 108.56 60 166 2650.58 2257 4339 2650.26 2424 2987 287761 411098 30.00%
crit 17.40% 28.50 10 57 5328.45 4513 8677 5326.73 4652 6169 151851 216936 30.00%
miss 16.32% 26.73 8 52 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 751 1.5% 167.4 2.08sec 1345 793 Direct 167.4 1328 2671 1345 17.4% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 167.43 167.43 0.00 0.00 0.00 1.6969 0.0000 225204.51 321728.93 30.00% 792.68 792.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.21% 110.86 61 161 1327.82 1128 2169 1327.64 1215 1498 147200 210291 30.00%
crit 17.44% 29.21 9 56 2670.78 2257 4298 2670.06 2374 3090 78004 111438 30.00%
miss 16.35% 27.37 9 61 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (8203) 0.0% (15.9%) 92.9 3.22sec 26469 22777

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.90 0.00 0.00 0.00 0.00 1.1621 0.0000 0.00 0.00 0.00% 22776.81 22776.81

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:12.91
  • if_expr:buff.doom_winds.up
    single
    [Q]:79.99
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Stormstrike (_mh) 4426 (5469) 8.6% (10.6%) 123.9 3.22sec 13235 0 Direct 123.9 (185.3) 9107 18329 10711 17.4% (11.6%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 123.87 123.87 0.00 0.00 0.00 0.0000 0.0000 1326852.69 1895552.17 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 102.32 55 159 9106.59 2775 24920 9124.57 7675 11156 931787 1331159 30.00%
crit 17.40% 21.55 5 42 18329.39 5550 49840 18369.92 12035 24541 395065 564393 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 1043 2.0% 61.4 5.47sec 5092 0 Direct 61.4 5092 0 5092 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.40 61.40 0.00 0.00 0.00 0.0000 0.0000 312638.76 312638.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.40 25 114 5091.99 1219 21883 5106.58 3867 7061 312639 312639 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2212 (2734) 4.3% (5.3%) 123.9 3.22sec 6615 0 Direct 123.9 (185.3) 4553 9165 5354 17.4% (11.6%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 123.87 123.87 0.00 0.00 0.00 0.0000 0.0000 663187.34 947434.64 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.64% 102.37 52 161 4553.22 1387 12460 4562.42 3750 5561 466121 665905 30.00%
crit 17.36% 21.50 5 43 9164.97 2775 24119 9183.63 4809 12095 197066 281530 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 521 1.0% 61.4 5.47sec 2545 0 Direct 61.4 2545 0 2545 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.40 61.40 0.00 0.00 0.00 0.0000 0.0000 156237.22 156237.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.40 25 114 2544.69 609 10725 2552.14 1977 3399 156237 156237 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1073 2.1% 6.3 49.84sec 50776 43858 Direct 6.3 43336 86767 50776 17.1% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.33 6.33 0.00 0.00 0.00 1.1579 0.0000 321565.35 321565.35 0.00% 43857.79 43857.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.87% 5.25 1 9 43336.25 27045 92728 43385.42 28397 72829 227440 227440 0.00%
crit 17.13% 1.08 0 6 86766.84 54089 162694 59397.26 0 162694 94126 94126 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [M]:1.77
  • if_expr:buff.doom_winds.up|set_bonus.tier30_2pc
    single
    [W]:4.57
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (7657) 0.0% (14.8%) 1.0 0.00sec 2291871 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 7657 14.8% 414.0 2.42sec 5536 0 Direct 414.0 4719 9454 5536 17.3% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 413.97 413.97 0.00 0.00 0.00 0.0000 0.0000 2291870.59 3274184.32 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 342.49 208 492 4718.70 1935 12743 4717.44 4061 5708 1616141 2308832 30.00%
crit 17.27% 71.47 35 126 9454.22 3870 25487 9451.31 7799 12055 675730 965353 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}
Windlash 512 1.0% 33.1 8.65sec 4627 3324 Direct 33.1 3808 7652 4628 21.3% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.13 33.13 0.00 0.00 0.00 1.3921 0.0000 153322.65 153322.65 0.00% 3324.14 3324.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.69% 26.07 0 75 3808.40 3224 6198 3802.76 0 5154 99293 99293 0.00%
crit 21.31% 7.06 0 26 7651.91 6448 12396 7576.22 0 11653 54030 54030 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 297 0.6% 38.5 7.45sec 2311 1602 Direct 38.5 1903 3825 2311 21.2% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.53 38.53 0.00 0.00 0.00 1.4420 0.0000 89023.00 89023.00 0.00% 1602.40 1602.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.78% 30.35 0 85 1902.74 1612 3099 1900.51 0 2686 57752 57752 0.00%
crit 21.22% 8.18 0 29 3824.97 3224 6128 3799.66 0 5816 31271 31271 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (6953) 0.0% (13.5%) 23.4 10.24sec 88900 77475

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.41 0.00 0.00 0.00 0.00 1.1475 0.0000 0.00 0.00 0.00% 77475.30 77475.30

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [J]:23.41
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [P]:0.01
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1713 (2051) 3.3% (4.0%) 31.2 10.24sec 19649 0 Direct 31.2 (42.8) 13985 28122 16422 17.2% (12.6%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 31.24 31.23 0.00 0.00 0.00 0.0000 0.0000 512835.09 512835.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.76% 25.84 0 80 13984.79 3964 37770 13945.49 0 22605 361437 361437 0.00%
crit 17.24% 5.38 0 23 28121.99 7928 67518 27335.62 0 59350 151398 151398 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 338 0.7% 11.5 19.85sec 8758 0 Direct 11.5 8758 0 8758 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.54 11.54 0.00 0.00 0.00 0.0000 0.0000 101032.33 101032.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.54 0 38 8758.20 2302 31056 8622.52 0 18782 101032 101032 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 856 (1024) 1.7% (2.0%) 31.2 10.24sec 9814 0 Direct 31.2 (42.8) 6991 14076 8206 17.2% (12.5%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 31.24 31.23 0.00 0.00 0.00 0.0000 0.0000 256268.07 256268.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.85% 25.87 0 78 6990.85 1982 18885 6968.82 0 11831 180864 180864 0.00%
crit 17.15% 5.36 0 21 14075.60 3964 34434 13741.96 0 29378 75404 75404 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 168 0.3% 11.5 19.85sec 4365 0 Direct 11.5 4365 0 4365 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.54 11.54 0.00 0.00 0.00 0.0000 0.0000 50358.56 50358.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.54 0 38 4365.35 1150 15529 4307.02 0 9201 50359 50359 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3878 7.5% 23.4 10.25sec 49606 0 Direct 23.4 40908 82118 49605 21.1% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.41 23.41 0.00 0.00 0.00 0.0000 0.0000 1161034.95 1161034.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.90% 18.47 0 57 40908.33 19470 71486 40801.17 0 60799 755402 755402 0.00%
crit 21.10% 4.94 0 20 82118.09 39719 142521 79941.76 0 128919 405632 405632 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 446 / 93
melee 446 0.2% 40.8 2.32sec 680 454 Direct 40.8 579 1160 680 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.83 40.83 0.00 0.00 0.00 1.4998 0.0000 27769.32 39671.46 30.00% 453.51 453.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 33.73 7 64 579.20 503 972 578.12 503 728 19535 27908 30.00%
crit 17.39% 7.10 0 18 1159.88 1005 1908 1156.98 0 1577 8234 11764 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4214 / 3087
melee 4214 6.0% 393.6 1.51sec 2349 2055 Direct 393.6 2003 4002 2349 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 393.65 393.65 0.00 0.00 0.00 1.1430 0.0000 924796.70 1321171.83 30.00% 2055.37 2055.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 325.43 196 491 2002.84 1680 3286 2003.23 1832 2233 651790 931152 30.00%
crit 17.33% 68.22 27 110 4002.01 3359 6571 4003.15 3556 4495 273007 390020 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Gamba
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 309.00sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.14 0.00 0.00 0.00 0.00 1.0054 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Y]:1.14
Feral Spirit 15.8 19.75sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.84 0.00 0.00 0.00 0.00 1.1539 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:15.84
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 307.36sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.48
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 6.5 0.0 40.7sec 40.7sec 7.4sec 16.23% 89.31% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 302.2s
  • trigger_min/max:6.0s / 302.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 60.0s

Stack Uptimes

  • ascendance_1:16.23%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.8sec 12.71% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.1s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.45%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.73%
  • crumbling_power_6:0.73%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.70%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.74%
  • crumbling_power_19:1.21%
  • crumbling_power_20:0.06%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4sec 90.4sec 7.9sec 9.88% 11.43% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.4s
  • trigger_min/max:90.0s / 92.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 15.8 0.0 24.1sec 19.4sec 18.9sec 73.21% 100.00% 0.0 (0.0) 10.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.5s / 112.1s
  • trigger_min/max:4.3s / 44.8s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 106.5s

Stack Uptimes

  • earthen_weapon_2:68.98%
  • earthen_weapon_4:4.22%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 8.4 0.0 34.0sec 34.0sec 9.8sec 27.56% 0.00% 0.0 (0.0) 8.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 277.6s
  • trigger_min/max:10.0s / 277.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_critical_strike_1:27.56%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 8.5 0.0 33.6sec 33.6sec 9.8sec 27.85% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 276.4s
  • trigger_min/max:10.0s / 276.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_haste_1:27.85%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 8.5 0.0 33.7sec 33.7sec 9.8sec 27.75% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 248.7s
  • trigger_min/max:10.0s / 248.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_mastery_1:27.75%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.4sec 97.4sec 58.4sec 24.97% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.0s

Stack Uptimes

  • elemental_chaos_air_1:24.97%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:Grants Haste and movement speed is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.4sec 100.6sec 58.1sec 25.10% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:25.11%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:Grants Mastery and damage taken reduced.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 125.3sec 99.7sec 58.5sec 24.98% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:24.98%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:Grants Critical Strike and damage dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 124.0sec 99.9sec 58.2sec 24.95% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 308.4s

Stack Uptimes

  • elemental_chaos_frost_1:24.95%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:Grants Versatility and healing dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.4sec 307.4sec 27.4sec 13.28% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.3s
  • trigger_min/max:300.0s / 329.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.28%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 11.6 4.2 26.8sec 19.8sec 18.9sec 73.21% 0.00% 64.0 (64.0) 10.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 112.1s
  • trigger_min/max:4.3s / 44.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 106.5s

Stack Uptimes

  • feral_spirit_1:73.21%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.8 386.1 6.9sec 0.7sec 5.8sec 85.35% 90.83% 386.1 (915.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 74.7s
  • trigger_min/max:0.0s / 16.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.3s

Stack Uptimes

  • flurry_1:19.98%
  • flurry_2:34.81%
  • flurry_3:30.55%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.4 120.6 17.7sec 2.2sec 14.6sec 84.78% 100.00% 57.4 (57.4) 16.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 50.6s
  • trigger_min/max:0.0s / 38.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:14.49%
  • forceful_winds_2:13.89%
  • forceful_winds_3:12.45%
  • forceful_winds_4:10.67%
  • forceful_winds_5:33.29%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=20}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.3sec 46.3sec 12.9sec 19.52% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 199.0s
  • trigger_min/max:0.1s / 196.3s
  • trigger_pct:98.85%
  • duration_min/max:0.0s / 65.6s

Stack Uptimes

  • forgestorm_ignited_1:19.52%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 19.2 1.4 15.7sec 14.7sec 8.2sec 52.36% 81.12% 1.4 (1.4) 6.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.3s / 68.9s
  • trigger_min/max:8.3s / 68.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.6s

Stack Uptimes

  • ice_strike_1:52.36%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 23.3 23.0 12.8sec 6.4sec 8.2sec 63.66% 100.00% 23.0 (23.0) 22.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 83.9s
  • trigger_min/max:0.8s / 33.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.4s

Stack Uptimes

  • legacy_of_the_frost_witch_1:63.66%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 53.1 427.5 5.7sec 0.6sec 4.9sec 87.41% 100.00% 91.2 (101.2) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 36.1s
  • trigger_min/max:0.0s / 7.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.9s

Stack Uptimes

  • maelstrom_weapon_1:8.14%
  • maelstrom_weapon_2:9.79%
  • maelstrom_weapon_3:11.28%
  • maelstrom_weapon_4:11.66%
  • maelstrom_weapon_5:8.08%
  • maelstrom_weapon_6:6.98%
  • maelstrom_weapon_7:5.54%
  • maelstrom_weapon_8:4.90%
  • maelstrom_weapon_9:4.17%
  • maelstrom_weapon_10:16.89%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.2sec 45.7sec 16.5sec 23.63% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 215.5s
  • trigger_min/max:0.0s / 215.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.0s

Stack Uptimes

  • sophic_devotion_1:23.63%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.3sec 45.7sec 32.1sec 38.17% 0.00% 25.6 (25.6) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 259.9s
  • trigger_min/max:0.1s / 214.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 205.8s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.28%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.22%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.73%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 6.5 0.0 40.7sec 40.7sec 7.4sec 16.23% 100.00% 42.2 (42.2) 6.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:6.0s / 302.2s
  • trigger_min/max:6.0s / 302.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 60.0s

Stack Uptimes

  • static_accumulation_1:16.23%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411={$s2=10}% chance to refund Maelstrom Weapon stacks spent on Lightning Bolt or Chain Lightning. While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 62.1 19.1 4.8sec 3.6sec 1.1sec 23.47% 53.09% 19.1 (19.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 67.9s
  • trigger_min/max:0.0s / 67.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • stormbringer_1:23.47%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.8 36.0 69.0 17.8s 15.0s 59.6s
Windfury-ForcefulWinds: 2 51.4 33.0 69.0 18.0s 0.4s 66.5s
Windfury-ForcefulWinds: 3 49.8 30.0 69.0 18.5s 0.6s 75.4s
Windfury-ForcefulWinds: 4 46.7 27.0 69.0 19.8s 0.5s 91.7s
Windfury-ForcefulWinds: 5 214.3 99.0 360.0 4.7s 0.0s 87.4s
windfury_totem_extra_attack_mh 28.2 9.0 48.0 10.4s 1.2s 122.8s
windfury_totem_extra_attack_oh 29.5 11.0 55.0 9.9s 0.1s 104.5s
Elemental Blast: Critical Strike 8.4 1.0 17.0 34.0s 10.0s 277.6s
Elemental Blast: Haste 8.5 0.0 19.0 33.6s 10.0s 276.4s
Elemental Blast: Mastery 8.5 1.0 19.0 33.7s 10.0s 248.7s
Windfury: Unruly Winds 138.0 86.0 202.0 2.4s 0.0s 38.5s
Maelstrom Weapon: Feral Spirit 82.3 54.0 114.0 3.7s 0.0s 29.8s
Maelstrom Weapon: Elemental Assault 116.3 74.0 162.0 2.6s 0.8s 9.9s
Maelstrom Weapon: Static Accumulation 97.1 0.0 276.0 4.9s 1.0s 297.2s
Maelstrom Weapon: Static Accumulation Refund 52.9 0.0 148.0 28.8s 0.8s 272.9s
Stormflurry 38.8 12.0 78.0 10.1s 0.8s 133.0s
Legacy of the Frost Witch: Bugged Trigger 10.6 0.0 35.0 23.1s 1.6s 309.2s
Maelstrom Weapon: Windfury Attack 83.0 32.0 134.0 4.7s 0.0s 67.6s
Maelstrom Weapon: main_hand 27.4 8.0 57.0 11.0s 1.2s 136.9s
Maelstrom Weapon: Windlash 6.6 0.0 26.0 33.3s 1.2s 327.1s
Maelstrom Weapon: offhand 27.9 11.0 51.0 10.8s 1.2s 133.2s
Maelstrom Weapon: Windlash Off-Hand 7.7 0.0 25.0 29.7s 0.3s 310.1s
Maelstrom Weapon: Doom Winds 0.7 0.0 4.0 137.3s 90.0s 273.5s
Maelstrom Weapon: Lava Lash 3.8 0.0 12.0 58.3s 8.4s 331.6s
Maelstrom Weapon: Sundering 1.3 0.0 7.0 104.0s 40.0s 348.3s
Maelstrom Weapon: Windstrike 6.2 0.0 24.0 35.2s 0.8s 330.2s
Maelstrom Weapon: Windstrike Off-Hand 6.3 0.0 25.0 35.2s 0.8s 330.2s
Maelstrom Weapon: Ice Strike 4.1 0.0 12.0 57.3s 8.3s 322.8s
Maelstrom Weapon: Stormstrike 24.8 6.0 46.0 12.5s 0.8s 130.2s
Maelstrom Weapon: Stormstrike Off-Hand 24.8 6.0 50.0 12.5s 0.8s 129.2s
Flametongue: Windfury Attack 414.0 258.0 606.0 2.4s 0.0s 38.5s
Stormbringer: Windfury Attack 43.6 17.0 79.0 7.8s 0.0s 108.8s
Flametongue: main_hand 137.1 79.0 207.0 2.6s 1.2s 68.8s
Windfury: main_hand 52.3 23.0 87.0 6.2s 1.2s 90.9s
Flametongue: Windlash 33.1 0.0 97.0 8.6s 1.2s 298.1s
Windfury: Windlash 12.5 0.0 37.0 20.1s 1.2s 303.7s
Flametongue: offhand 140.1 79.0 196.0 2.6s 1.2s 65.0s
Flametongue: Windlash Off-Hand 38.5 0.0 107.0 7.4s 0.1s 296.5s
Flametongue: Lava Lash 18.8 12.0 26.0 15.6s 8.3s 77.0s
Stormbringer: Lava Lash 2.0 0.0 10.0 77.3s 8.7s 319.6s
Flametongue: Sundering 6.3 3.0 9.0 49.8s 40.0s 161.8s
Stormbringer: Sundering 0.7 0.0 5.0 114.6s 40.0s 345.2s
Windfury: Sundering 3.2 0.0 8.0 87.5s 40.0s 344.5s
Flametongue: Windstrike 31.2 0.0 95.0 10.2s 0.8s 298.9s
Stormbringer: Windstrike 3.3 0.0 17.0 49.8s 0.8s 335.6s
Windfury: Windstrike 12.1 0.0 42.0 21.6s 0.8s 312.1s
Flametongue: Windstrike Off-Hand 31.2 0.0 95.0 10.2s 0.8s 298.9s
Stormbringer: Windstrike Off-Hand 3.3 0.0 20.0 49.8s 0.8s 316.3s
Flametongue: Ice Strike 20.6 12.0 28.0 14.7s 8.3s 68.3s
Stormbringer: Ice Strike 2.2 0.0 9.0 76.8s 8.3s 334.5s
Windfury: Ice Strike 8.1 2.0 18.0 36.5s 8.3s 272.9s
Flametongue: Stormstrike 123.9 64.0 187.0 3.2s 0.8s 62.0s
Stormbringer: Stormstrike 13.1 2.0 31.0 21.9s 0.8s 237.1s
Windfury: Stormstrike 49.8 24.0 86.0 7.0s 0.8s 104.3s
Flametongue: Stormstrike Off-Hand 123.9 64.0 187.0 3.2s 0.8s 62.0s
Stormbringer: Stormstrike Off-Hand 13.1 2.0 32.0 21.8s 0.8s 237.1s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 26.80% 15.31% 42.90% 0.8s 0.0s 19.8s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7270.0001.48711.5264.35720.311
Doom Winds0.5300.0002.3951.9790.8385.583
Lava Lash4.3890.00067.64283.53335.766153.349
Elemental Blast0.4020.00025.55510.1995.03642.086
Sundering9.4670.000121.78562.4889.778179.221
Windstrike
Stormstrike
1.0140.0005.040118.22562.788184.218
Ice Strike3.1320.00056.50665.63014.655143.187
Frost Shock13.9410.000168.944228.443141.890317.842
Flame Shock21.9280.000236.973252.425159.204350.623
Earth Elemental27.1500.000246.98732.9618.328246.987

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack63.219.813.39%19.55%
main_hand23.44.04.95%3.99%
Windlash4.91.71.05%1.68%
offhand23.44.54.97%4.43%
Windlash Off-Hand5.91.81.26%1.73%
Feral Spirit68.214.114.46%13.89%
Doom Winds0.60.10.14%0.09%
Lightning Bolt31.40.06.66%0.00%
Lava Lash3.50.30.74%0.29%
Sundering1.00.20.22%0.22%
Windstrike21.51.94.55%1.91%
Windstrike (_mh)5.50.71.17%0.70%
Windstrike Off-Hand5.50.71.17%0.72%
Ice Strike3.90.20.82%0.24%
Stormstrike73.919.015.66%18.75%
Stormstrike (_mh)20.34.54.30%4.45%
Stormstrike Off-Hand20.14.64.27%4.59%
Lightning Bolt (_ti)21.50.04.56%0.00%
Ascendance (_dre)74.023.115.69%22.79%
Overflow Stacks0.0101.20.00%17.66%
Actual Stacks472.00.082.34%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt156.733.53%
Elemental Blast202.743.36%
Lightning Bolt (_ti)108.023.11%
Total Spent467.4100.00%

Deeply Rooted Elements Proc Details

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Gamba
mana_regenMana660.41245348.78100.00%371.51234041.3648.82%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 817.83 820.45 234041.7 49213.6 42134.4 50000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement_Gamba
BloodlustMana 1.001000.000.41%1000.001000.000.00
Elemental BlastMana 25.3734885.7014.17%1375.001375.0064.98
Flame ShockMana 10.417807.063.17%750.00267.3163.20
Frost ShockMana 15.427709.513.13%500.00499.9939.30
Ice StrikeMana 20.6033995.1513.81%1650.001650.0013.22
Lava LashMana 18.807518.523.05%400.00400.0056.52
Lightning BoltMana 20.6910346.424.20%500.00499.98131.00
StormstrikeMana 123.87123874.1550.33%1000.001333.4619.85
SunderingMana 6.3318998.677.72%3000.002999.9616.93

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Gamba Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Gamba Damage Per Second
Count 7499
Mean 51581.79
Minimum 38960.58
Maximum 67919.23
Spread ( max - min ) 28958.66
Range [ ( max - min ) / 2 * 100% ] 28.07%
Standard Deviation 4016.3552
5th Percentile 45385.66
95th Percentile 58656.42
( 95th Percentile - 5th Percentile ) 13270.76
Mean Distribution
Standard Deviation 46.3800
95.00% Confidence Interval ( 51490.89 - 51672.69 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 233
0.1% Error 23290
0.1 Scale Factor Error with Delta=300 137705
0.05 Scale Factor Error with Delta=300 550818
0.01 Scale Factor Error with Delta=300 13770443
Priority Target DPS
PR_Shaman_Enhancement_Gamba Priority Target Damage Per Second
Count 7499
Mean 51581.79
Minimum 38960.58
Maximum 67919.23
Spread ( max - min ) 28958.66
Range [ ( max - min ) / 2 * 100% ] 28.07%
Standard Deviation 4016.3552
5th Percentile 45385.66
95th Percentile 58656.42
( 95th Percentile - 5th Percentile ) 13270.76
Mean Distribution
Standard Deviation 46.3800
95.00% Confidence Interval ( 51490.89 - 51672.69 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 233
0.1% Error 23290
0.1 Scale Factor Error with Delta=300 137705
0.05 Scale Factor Error with Delta=300 550818
0.01 Scale Factor Error with Delta=300 13770443
DPS(e)
PR_Shaman_Enhancement_Gamba Damage Per Second (Effective)
Count 7499
Mean 51581.79
Minimum 38960.58
Maximum 67919.23
Spread ( max - min ) 28958.66
Range [ ( max - min ) / 2 * 100% ] 28.07%
Damage
PR_Shaman_Enhancement_Gamba Damage
Count 7499
Mean 14506048.21
Minimum 9451544.33
Maximum 20900520.15
Spread ( max - min ) 11448975.82
Range [ ( max - min ) / 2 * 100% ] 39.46%
DTPS
PR_Shaman_Enhancement_Gamba Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Gamba Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Gamba Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Gamba Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Gamba Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Gamba Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_GambaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Gamba Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.48 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 invoke_external_buff,name=power_infusion,if=(talent.ascendance.enabled&talent.thorims_invocation.enabled&buff.ascendance.up)|(!talent.thorims_invocation.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.thorims_invocation.enabled&!talent.feral_spirit.enabled)|fight_remains<=20
F 15.84 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
G 3.73 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
I 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
J 23.41 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
K 12.91 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
L 2.63 ice_strike,if=buff.doom_winds.up
M 1.77 sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
N 1.19 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
0.00 frost_shock,if=buff.hailstorm.up
O 4.32 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
P 0.01 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
Q 79.99 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 25.37 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
S 6.82 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
0.00 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
T 17.98 ice_strike
U 14.48 lava_lash
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
V 13.87 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
W 4.57 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
X 15.42 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Y 1.14 earth_elemental
Z 9.22 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ACDEFGBKLKKKJJJJNFQQRQJRJTJJQQFJOJRJQQTSQSQFUWRQTXVQYXUQQQQQJJFJRQQQQORQTQQQFJJRQUTVQRQQFQGKLKKMORQXVQTXZUQQRXZTFQQQRQUXZTQRQXQQUQSQFQQRQTUVWQQRQQQTQQSFQOQRQQQQJSEDFJGKKKKKLKOQQFRQWXRTQUVQXZRQTQUVQXZQQRFQTQQRQQJOJVJRFTWQJJUJQRQTQFSQQUVXZQGKLKKKRQUXZQFQRQTQRQQUQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 2 augmentation PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
0:00.000 default C auto_attack Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, elemental_chaos_frost
0:00.000 default D use_items Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, maelstrom_weapon, elemental_chaos_frost
0:00.000 default E berserking Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, maelstrom_weapon, crumbling_power(20), elemental_chaos_frost
0:00.000 default F feral_spirit Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, berserking, maelstrom_weapon, crumbling_power(20), elemental_chaos_frost
0:00.867 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), crumbling_power(19), elemental_chaos_frost
0:01.733 default B potion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, crumbling_power(19), elemental_chaos_frost
0:01.733 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, crumbling_power(19), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:02.600 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), doom_winds, crumbling_power(18), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:03.467 single K stormstrike Fluffy_Pillow 49737.2/50000: 99% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds, ice_strike, crumbling_power(17), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:04.332 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(16), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:05.198 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(15), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.064 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, crumbling_power(14), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.931 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds, ice_strike, crumbling_power(13), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.796 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:08.662 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:09.529 single N flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:10.395 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:11.263 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:12.130 single Q stormstrike Fluffy_Pillow 49387.2/50000: 99% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:13.083 single R elemental_blast Fluffy_Pillow 49912.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.035 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(5), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.989 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(2), static_accumulation, legacy_of_the_frost_witch, crumbling_power(4), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.943 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, crumbling_power(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:16.898 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, crumbling_power(2), sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:17.853 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, crumbling_power, sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:18.806 single J windstrike Fluffy_Pillow 49874.8/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:19.757 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.710 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:21.664 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:22.617 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:23.571 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:24.525 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:25.478 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:26.432 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion, forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:27.386 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion, forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:28.340 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:29.293 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:30.247 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:31.200 single S lightning_bolt Fluffy_Pillow 49874.8/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, forgestorm_ignited, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:32.153 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
0:33.106 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
0:34.061 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
0:35.016 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
0:35.969 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(4), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, elemental_chaos_frost
0:36.922 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(4), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, elemental_chaos_frost
0:37.877 single R elemental_blast Fluffy_Pillow 48528.0/50000: 97% mana bloodlust, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, elemental_chaos_frost
0:38.831 single Q stormstrike Fluffy_Pillow 48679.4/50000: 97% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, spiraling_winds(7), sophic_devotion, elemental_chaos_frost
0:39.784 single T ice_strike Fluffy_Pillow 49204.2/50000: 98% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, spiraling_winds(7), sophic_devotion, elemental_chaos_frost
0:40.737 single X frost_shock Fluffy_Pillow 49079.0/50000: 98% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, spiraling_winds(8), sophic_devotion, elemental_chaos_frost
0:41.974 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(8), sophic_devotion, elemental_chaos_frost
0:43.214 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion, elemental_chaos_frost
0:44.453 single Y earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:45.692 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:46.929 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:48.338 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_frost
0:49.577 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_frost
0:50.815 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_frost
0:52.053 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(10), elemental_chaos_frost
0:53.291 single Q stormstrike Fluffy_Pillow 49980.8/50000: 100% mana flurry, stormbringer, maelstrom_weapon(10), elemental_chaos_frost
0:54.531 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, forceful_winds, maelstrom_weapon(10), static_accumulation, sophic_devotion, elemental_chaos_frost
0:55.770 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
0:57.009 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), forceful_winds(3), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
0:58.248 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
0:59.486 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:00.725 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion, elemental_chaos_frost
1:01.961 single Q stormstrike Fluffy_Pillow 47977.6/50000: 96% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, elemental_chaos_frost
1:03.201 single Q stormstrike Fluffy_Pillow 47961.6/50000: 96% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:04.440 single Q stormstrike Fluffy_Pillow 48944.0/50000: 98% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:05.680 single O lava_lash Fluffy_Pillow 49928.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(3), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:06.917 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(4), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:08.154 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:09.355 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, elemental_chaos_frost
1:10.558 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited, elemental_chaos_frost
1:11.760 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, elemental_chaos_frost
1:12.962 single Q stormstrike Fluffy_Pillow 47923.2/50000: 96% mana flurry, elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(7), forgestorm_ignited, elemental_chaos_frost
1:14.168 default F feral_spirit Fluffy_Pillow 48852.8/50000: 98% mana ascendance, flurry(2), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(10), static_accumulation, ice_strike, spiraling_winds(8), forgestorm_ignited, elemental_chaos_frost
1:15.370 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, spiraling_winds(8), sophic_devotion, elemental_chaos_frost
1:16.572 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, spiraling_winds(9), sophic_devotion, elemental_chaos_frost
1:17.774 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:19.013 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:20.268 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:21.507 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:22.744 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:23.984 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:25.222 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:26.460 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:27.698 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:28.936 default F feral_spirit Fluffy_Pillow 49980.8/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:30.175 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:31.413 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:32.651 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds, ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:33.888 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:35.127 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:36.366 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:37.604 single M sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:38.841 single O lava_lash Fluffy_Pillow 48979.2/50000: 98% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:40.080 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:41.320 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:42.522 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:43.723 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:44.925 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:46.128 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:47.331 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:48.534 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:49.736 Waiting     0.929 sec 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost
1:50.665 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost
1:52.118 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost
1:53.356 single Q stormstrike Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), forceful_winds(3), stormbringer, maelstrom_weapon(5), sophic_devotion, elemental_chaos_frost
1:54.594 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(6), sophic_devotion, elemental_chaos_frost
1:55.833 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(4), sophic_devotion, elemental_chaos_frost
1:57.072 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(4), sophic_devotion, elemental_chaos_frost
1:58.310 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(4), sophic_devotion, elemental_chaos_frost
1:59.588 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, stormbringer, maelstrom_weapon(4), ice_strike, sophic_devotion, elemental_chaos_frost
2:00.827 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_air
2:02.025 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_air
2:03.227 single Q stormstrike Fluffy_Pillow 48923.2/50000: 98% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_air
2:04.428 single R elemental_blast Fluffy_Pillow 49844.8/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_air
2:05.627 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:06.827 single U lava_lash Fluffy_Pillow 49920.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:08.029 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:09.230 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_air
2:10.431 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_air
2:11.632 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_air
2:12.834 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, elemental_chaos_air
2:14.284 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:15.485 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:16.684 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_air
2:17.884 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_air
2:19.086 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(7), elemental_chaos_air
2:20.285 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), stormbringer, maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_air
2:21.486 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(10), forgestorm_ignited, elemental_chaos_air
2:22.687 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
2:23.888 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(3), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
2:25.086 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
2:26.286 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
2:27.487 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_air
2:28.686 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
2:29.850 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
2:31.015 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
2:32.180 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:33.346 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, elemental_chaos_air
2:34.514 single Q stormstrike Fluffy_Pillow 48868.8/50000: 98% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, elemental_chaos_air
2:35.680 single Q stormstrike Fluffy_Pillow 49734.4/50000: 99% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, elemental_chaos_air
2:36.845 single R elemental_blast Fluffy_Pillow 49598.4/50000: 99% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, elemental_chaos_air
2:38.248 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:39.449 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:40.651 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(4), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:41.853 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(8), legacy_of_the_frost_witch, elemental_chaos_air
2:43.052 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_air
2:44.252 single Q stormstrike Fluffy_Pillow 49920.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_air
2:45.452 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(10), ice_strike, elemental_chaos_air
2:46.653 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:47.853 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:49.054 single O lava_lash Fluffy_Pillow 49921.6/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:50.255 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:51.455 single R elemental_blast Fluffy_Pillow 49920.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_air
2:52.655 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:53.856 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_air
2:55.056 single Q stormstrike Fluffy_Pillow 49920.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_air
2:56.257 single Q stormstrike Fluffy_Pillow 48841.6/50000: 98% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_air
2:57.457 single J windstrike Fluffy_Pillow 49761.6/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, spiraling_winds, elemental_chaos_air
2:58.658 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, spiraling_winds(3), elemental_chaos_air
2:59.859 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_air
3:00.000 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_frost
3:00.000 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, crumbling_power(20), spiraling_winds(3), elemental_chaos_frost
3:01.126 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, crumbling_power(19), spiraling_winds(4), elemental_chaos_frost
3:02.251 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, crumbling_power(18), spiraling_winds(5), elemental_chaos_frost
3:03.376 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, crumbling_power(18), spiraling_winds(5), elemental_chaos_frost
3:04.501 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, crumbling_power(17), spiraling_winds(6), elemental_chaos_frost
3:05.625 single K stormstrike Fluffy_Pillow 49798.4/50000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, crumbling_power(16), spiraling_winds(6), elemental_chaos_frost
3:06.751 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(15), spiraling_winds(7), elemental_chaos_frost
3:07.878 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(14), spiraling_winds(7), elemental_chaos_frost
3:09.003 single L ice_strike Fluffy_Pillow 49800.0/50000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(13), spiraling_winds(8), elemental_chaos_frost
3:10.130 single K stormstrike Fluffy_Pillow 49953.2/50000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(12), spiraling_winds(9), elemental_chaos_frost
3:11.252 single O lava_lash Fluffy_Pillow 49748.4/50000: 99% mana berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, crumbling_power(11), spiraling_winds(9), forgestorm_ignited, elemental_chaos_frost
3:12.378 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, crumbling_power(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:13.617 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, crumbling_power(9), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:14.853 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, crumbling_power(8), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:16.091 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, crumbling_power(7), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:17.330 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:18.569 single W sundering Fluffy_Pillow 49982.4/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:19.807 single X frost_shock Fluffy_Pillow 48963.2/50000: 98% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:21.047 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:22.285 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, earthen_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:23.488 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, spiraling_winds(10), elemental_chaos_frost
3:24.692 single U lava_lash Fluffy_Pillow 49926.4/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(10), elemental_chaos_frost
3:25.895 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(10), elemental_chaos_frost
3:27.097 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
3:28.300 single X frost_shock Fluffy_Pillow 49924.8/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
3:29.501 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
3:30.703 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
3:31.908 Waiting     1.012 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), spiraling_winds(10), elemental_chaos_frost
3:32.920 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), spiraling_winds(10), elemental_chaos_frost
3:34.387 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_frost
3:35.627 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(10), elemental_chaos_frost
3:36.864 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(5), ice_strike, elemental_chaos_frost
3:38.102 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, maelstrom_weapon(5), ice_strike, elemental_chaos_frost
3:39.339 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
3:40.578 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
3:41.815 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
3:43.055 Waiting     2.257 sec 50000.0/50000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
3:45.312 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(3), elemental_chaos_frost
3:46.749 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(3), stormbringer, maelstrom_weapon(5), elemental_chaos_frost
3:47.987 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(7), elemental_chaos_frost
3:49.227 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_frost
3:50.465 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
3:51.703 single T ice_strike Fluffy_Pillow 49980.8/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
3:52.939 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
3:54.177 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, elemental_chaos_frost
3:55.416 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_frost
3:56.654 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
3:57.856 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:59.058 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
4:00.260 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:01.426 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, sophic_devotion, elemental_chaos_air
4:02.592 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:03.759 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:04.924 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:06.090 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:07.292 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:08.493 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, sophic_devotion, elemental_chaos_air
4:09.692 single Q stormstrike Fluffy_Pillow 48918.4/50000: 98% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, sophic_devotion, elemental_chaos_air
4:10.894 single J windstrike Fluffy_Pillow 49841.6/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, ice_strike, sophic_devotion, elemental_chaos_air
4:12.096 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:13.297 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:14.495 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:15.696 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:16.898 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:18.099 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:19.300 single T ice_strike Fluffy_Pillow 49921.6/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_air
4:20.500 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:21.700 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:22.900 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds, elemental_chaos_air
4:24.099 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_air
4:25.299 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_air
4:26.501 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_air
4:27.703 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_air
4:28.904 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, spiraling_winds(4), elemental_chaos_air
4:30.105 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), spiraling_winds(4), elemental_chaos_air
4:31.306 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon, spiraling_winds(5), elemental_chaos_air
4:32.507 default G doom_winds Fluffy_Pillow 49921.6/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), spiraling_winds(6), elemental_chaos_air
4:33.708 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds, spiraling_winds(6), elemental_chaos_air
4:34.908 single L ice_strike Fluffy_Pillow 49920.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), doom_winds, spiraling_winds(7), elemental_chaos_air
4:36.108 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(7), elemental_chaos_air
4:37.307 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(8), elemental_chaos_air
4:38.507 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(9), elemental_chaos_air
4:39.708 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(9), elemental_chaos_air
4:40.908 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:42.074 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:43.239 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:44.404 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:45.568 Waiting     0.909 sec 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_air
4:46.477 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_air
4:47.879 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon(4), elemental_chaos_air
4:49.045 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(6), elemental_chaos_air
4:50.210 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), elemental_chaos_air
4:51.412 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_air
4:52.579 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
4:53.745 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:54.909 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:56.075 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:57.241 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:58.407 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:59.571 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 11114 10585 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 222280 211700 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 21.55% 21.55% 3663
Versatility 7.11% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Gamba"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAoEhkQCKCk0SSaICQikCC
dragonflight.player.ominous_chromatic_essence_dragonflight=obsidian
dragonflight.player.ashkandur_humanoid=

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/invoke_external_buff,name=power_infusion,if=(talent.ascendance.enabled&talent.thorims_invocation.enabled&buff.ascendance.up)|(!talent.thorims_invocation.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.thorims_invocation.enabled&!talent.feral_spirit.enabled)|fight_remains<=20
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Phys : 49352 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
49351.9 49351.9 56.4 / 0.114% 9763.4 / 19.8% 56.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
822.7 819.8 Mana 1.73% 52.2 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAoEhkQCKCk0SSaICQikGC

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Phys 49352
Ascendance 0 (343) 0.0% (0.7%) 2.0 180.44sec 50778 46865

Stats Details: Ascendance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0836 0.0000 0.00 0.00 0.00% 46864.55 46864.55

Action Details: Ascendance

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]

Action Priority List

    default
    [G]:2.00
  • if_expr:(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
    Ascendance (_damage) 343 0.7% 2.0 180.44sec 50778 0 Direct 2.0 42592 85559 50778 19.0% 0.0%

Stats Details: Ascendance Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 101555.47 101555.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.95% 1.62 0 2 42592.24 37152 55209 41006.26 0 55209 68958 68958 0.00%
crit 19.05% 0.38 0 2 85559.20 74304 109367 29425.98 0 109367 32597 32597 0.00%

Action Details: Ascendance Damage

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 82 0.2% 3.7 90.49sec 6583 6021 Direct 3.7 6583 0 6583 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.72 3.72 0.00 0.00 0.00 1.0935 0.0000 24505.75 35009.11 30.00% 6021.07 6021.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.72 3 4 6582.84 3882 13469 6602.11 5261 8739 24506 35009 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.72
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 7140 14.5% 25.0 11.66sec 85614 72640 Direct 25.0 70757 142032 85659 20.9% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.02 25.01 0.00 0.00 0.00 1.1787 0.0000 2142363.18 2142363.18 0.00% 72639.72 72639.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.09% 19.78 10 29 70756.93 46178 142837 70733.65 55121 90193 1399690 1399690 0.00%
crit 20.91% 5.23 0 14 142031.68 92355 275931 141660.31 0 224321 742673 742673 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.97

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [S]:25.02
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
Flame Shock 1649 3.3% 31.9 9.16sec 15490 33344 Direct 31.9 2854 5733 3470 21.4% 0.0%
Periodic 184.8 1708 3430 2078 21.5% 0.0% 96.1%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 31.94 31.94 184.76 184.76 30.82 0.4646 1.5600 494725.58 494725.58 0.00% 1632.41 33344.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.60% 25.10 11 43 2854.10 2403 4958 2853.74 2581 3280 71651 71651 0.00%
crit 21.40% 6.83 0 20 5732.51 4805 9771 5727.89 0 7391 39178 39178 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 78.54% 145.11 98 190 1708.15 4 2949 1707.85 1564 1927 247868 247868 0.00%
crit 21.46% 39.66 16 74 3430.19 80 5831 3429.66 3050 3985 136029 136029 0.00%

Action Details: Flame Shock

  • id:188389
  • school:firestorm
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:1.02
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:firestorm
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.{$?a137039=false}[][ If Flame Shock is dispelled, a volcanic eruption wells up beneath the dispeller, exploding for {$204395s1=0} Fire damage and knocking them into the air.]

Action Priority List

    single
    [O]:1.12
  • if_expr:!ticking
    single
    [b]:11.57
Flametongue Weapon 0 (1524) 0.0% (3.1%) 1.0 0.00sec 456550 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1524 3.1% 1077.7 0.69sec 424 0 Direct 1077.7 361 724 424 17.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1077.66 1077.66 0.00 0.00 0.00 0.0000 0.0000 456549.98 456549.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 891.66 618 1195 361.02 293 603 361.10 334 404 321912 321912 0.00%
crit 17.26% 186.00 109 278 723.86 587 1192 724.08 662 817 134638 134638 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.23

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc318038=Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][]. }
Forgestorm Ignited (_damage) 1105 2.2% 28.7 7.66sec 11544 0 Direct 28.7 9807 19715 11544 17.5% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.74 28.74 0.00 0.00 0.00 0.0000 0.0000 331728.84 331728.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.47% 23.70 3 62 9806.91 9732 10030 9806.75 9732 10030 232396 232396 0.00%
crit 17.53% 5.04 0 18 19715.13 19463 20059 19357.45 0 20059 99333 99333 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1178 2.4% 18.5 14.94sec 19107 16110 Direct 18.5 16215 32670 19107 17.6% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.51 18.51 0.00 0.00 0.00 1.1860 0.0000 353672.28 353672.28 0.00% 16110.43 16110.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.43% 15.26 4 29 16215.05 7763 32034 16259.48 12819 20950 247396 247396 0.00%
crit 17.57% 3.25 0 12 32669.69 15525 60738 31475.17 0 54519 106276 106276 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.02

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [Z]:18.51
Ice Strike 1550 3.1% 21.5 13.97sec 21577 18536 Direct 21.5 18371 36877 21577 17.3% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.55 21.55 0.00 0.00 0.00 1.1641 0.0000 464939.34 464939.34 0.00% 18536.03 18536.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.68% 17.82 9 28 18370.63 15213 31389 18368.29 16426 20991 327283 327283 0.00%
crit 17.32% 3.73 0 11 36877.45 30425 61864 36238.86 0 55556 137656 137656 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:2.64
  • if_expr:buff.doom_winds.up
    single
    [V]:18.91
Lava Lash 1434 2.9% 19.2 14.94sec 22373 18919 Direct 19.2 19012 38160 22373 17.6% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.25 19.25 0.00 0.00 0.00 1.1826 0.0000 430635.85 430635.85 0.00% 18919.07 18919.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.45% 15.87 8 25 19011.80 16021 33057 19003.64 16772 21884 301715 301715 0.00%
crit 17.55% 3.38 0 12 38159.52 32042 62679 37101.74 0 55694 128921 128921 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [P]:2.83
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [W]:16.42
Lightning Bolt 4451 9.0% 21.1 13.31sec 63325 53730 Direct 21.1 51985 104205 63323 21.7% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.11 21.11 0.00 0.00 0.00 1.1786 0.0000 1336532.27 1336532.27 0.00% 53729.94 53729.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.28% 16.52 6 30 51984.57 35046 112489 51976.52 41358 64685 858931 858931 0.00%
crit 21.72% 4.58 0 18 104204.76 70092 216811 103240.77 0 160878 477601 477601 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [T]:5.62
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [X]:15.48
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1498 3.0% 172.1 1.93sec 2614 1470 Direct 172.1 2583 5193 2614 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 172.09 172.09 0.00 0.00 0.00 1.7784 0.0000 449916.22 642753.85 30.00% 1470.15 1470.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.20% 113.92 72 160 2583.09 2257 4339 2581.91 2353 2888 294267 420391 30.00%
crit 17.42% 29.97 10 53 5192.76 4513 8580 5189.95 4668 5958 155650 222362 30.00%
miss 16.38% 28.19 9 51 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 759 1.5% 173.9 2.00sec 1312 738 Direct 173.9 1295 2604 1312 17.5% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 173.88 173.88 0.00 0.00 0.00 1.7782 0.0000 228068.67 325820.69 30.00% 737.60 737.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.16% 115.04 69 166 1295.27 1128 2145 1294.75 1185 1442 149015 212884 30.00%
crit 17.46% 30.36 9 55 2604.03 2257 4294 2602.80 2331 3016 79053 112936 30.00%
miss 16.38% 28.48 9 53 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7433) 0.0% (15.1%) 89.4 3.17sec 24989 21064

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.36 0.00 0.00 0.00 0.00 1.1863 0.0000 0.00 0.00 0.00% 21063.96 21063.96

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:5.70
  • if_expr:buff.doom_winds.up
    single
    [R]:72.42
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    single
    [U]:11.23
    Stormstrike (_mh) 4029 (4956) 8.2% (10.1%) 119.1 3.17sec 12498 0 Direct 119.1 (177.2) 8637 17375 10159 17.4% (11.7%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.12 119.12 0.00 0.00 0.00 0.0000 0.0000 1210214.97 1728922.61 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 98.37 47 161 8636.98 2775 21536 8647.79 7170 10125 849620 1213773 30.00%
crit 17.42% 20.75 2 41 17375.01 5550 42975 17400.39 11781 24562 360595 515149 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 927 1.9% 58.0 5.43sec 4801 0 Direct 58.0 4801 0 4801 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.03 58.03 0.00 0.00 0.00 0.0000 0.0000 278587.57 278587.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 58.03 22 105 4800.59 1219 19356 4809.66 3560 6652 278588 278588 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2013 (2477) 4.1% (5.0%) 119.1 3.17sec 6247 0 Direct 119.1 (177.2) 4319 8682 5078 17.4% (11.7%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 119.12 119.12 0.00 0.00 0.00 0.0000 0.0000 604858.65 864105.82 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 98.41 50 151 4319.10 1387 10768 4324.81 3665 5094 425054 607236 30.00%
crit 17.39% 20.71 5 45 8681.55 2775 21536 8691.59 5579 11811 179805 256870 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 463 0.9% 58.0 5.43sec 2400 0 Direct 58.0 2399 0 2399 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.03 58.03 0.00 0.00 0.00 0.0000 0.0000 139245.03 139245.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 58.03 22 105 2399.47 609 9834 2404.28 1735 3282 139245 139245 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1087 2.2% 6.6 47.27sec 49617 42608 Direct 6.6 42215 84526 49615 17.5% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.56 6.56 0.00 0.00 0.00 1.1646 0.0000 325696.79 325696.79 0.00% 42608.16 42608.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.51% 5.42 1 9 42215.37 27045 91933 42258.69 27872 63664 228636 228636 0.00%
crit 17.49% 1.15 0 6 84526.36 54089 179376 59576.39 0 179376 97060 97060 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [N]:1.34
  • if_expr:buff.doom_winds.up|set_bonus.tier30_2pc
    single
    [Y]:5.23
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (7618) 0.0% (15.4%) 1.0 0.00sec 2277883 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 7618 15.4% 405.5 2.47sec 5618 0 Direct 405.5 4794 9585 5618 17.2% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 405.46 405.46 0.00 0.00 0.00 0.0000 0.0000 2277882.51 3254200.85 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.80% 335.72 210 483 4793.83 1935 13012 4798.06 4232 5823 1609412 2299219 30.00%
crit 17.20% 69.74 34 118 9585.08 3870 26325 9592.38 7867 11945 668470 954982 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.][]}
Windlash 451 0.9% 24.1 10.15sec 5527 4073 Direct 24.1 4569 9178 5527 20.8% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.15 24.15 0.00 0.00 0.00 1.3572 0.0000 133473.82 133473.82 0.00% 4072.55 4072.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.20% 19.12 10 28 4568.64 3559 6128 4568.84 4125 5546 87374 87374 0.00%
crit 20.80% 5.02 0 15 9177.98 7118 12257 9135.99 0 11870 46100 46100 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 236 0.5% 25.2 9.69sec 2775 2033 Direct 25.2 2289 4605 2775 21.0% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.23 25.23 0.00 0.00 0.00 1.3650 0.0000 70005.48 70005.48 0.00% 2033.03 2033.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.02% 19.94 11 30 2289.14 1780 3064 2289.36 2075 2776 45636 45636 0.00%
crit 20.98% 5.29 0 16 4605.17 3615 6128 4590.65 0 6065 24369 24369 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (6797) 0.0% (13.6%) 18.0 11.34sec 111849 114207

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.99 0.00 0.00 0.00 0.00 0.9794 0.0000 0.00 0.00 0.00% 114206.76 114206.76

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [K]:17.88
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [Q]:0.11
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1717 (2135) 3.4% (4.3%) 24.0 11.34sec 26374 0 Direct 24.0 (35.1) 18169 36376 21213 16.7% (11.4%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.96 23.96 0.00 0.00 0.00 0.0000 0.0000 508299.10 508299.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.28% 19.96 10 36 18169.01 5150 39986 18300.25 13479 25785 362585 362585 0.00%
crit 16.72% 4.01 0 13 36376.38 10480 75874 36086.74 0 64655 145715 145715 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 418 0.8% 11.2 18.61sec 11081 0 Direct 11.2 11081 0 11081 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.16 11.16 0.00 0.00 0.00 0.0000 0.0000 123676.08 123676.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.16 3 21 11080.59 3488 34121 11062.53 7926 17198 123676 123676 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 859 (1068) 1.7% (2.1%) 24.0 11.34sec 13193 0 Direct 24.0 (35.1) 9077 18269 10609 16.7% (11.4%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.96 23.96 0.00 0.00 0.00 0.0000 0.0000 254214.78 254214.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.33% 19.97 9 36 9076.64 2575 19993 9142.16 6659 12513 181235 181235 0.00%
crit 16.67% 3.99 0 12 18268.90 5248 39230 18083.46 0 33625 72980 72980 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 209 0.4% 11.2 18.61sec 5547 0 Direct 11.2 5547 0 5547 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.16 11.16 0.00 0.00 0.00 0.0000 0.0000 61916.09 61916.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.16 3 21 5547.15 1744 18044 5540.23 3664 8654 61916 61916 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3595 7.2% 17.9 11.42sec 59500 0 Direct 17.9 49229 98566 59500 20.8% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.88 17.88 0.00 0.00 0.00 0.0000 0.0000 1063988.73 1063988.73 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.18% 14.16 7 21 49229.26 23204 71486 49216.41 40615 61441 697072 697072 0.00%
crit 20.82% 3.72 0 10 98566.29 47337 142972 96709.75 0 135541 366917 366917 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.13

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 428 / 89
melee 428 0.2% 39.6 2.37sec 669 435 Direct 39.6 570 1140 669 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.63 39.63 0.00 0.00 0.00 1.5365 0.0000 26500.98 37859.51 30.00% 435.26 435.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.71% 32.78 19 56 570.17 503 943 569.58 503 719 18688 26697 30.00%
crit 17.29% 6.85 0 18 1140.28 1005 1707 1138.60 0 1485 7813 11162 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4464 / 2927
melee 4464 5.9% 367.0 1.62sec 2385 2125 Direct 367.0 2033 4061 2385 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 366.98 366.98 0.00 0.00 0.00 1.1223 0.0000 875217.38 1250342.43 30.00% 2124.98 2124.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 303.38 215 405 2033.39 1680 3248 2033.90 1853 2357 616889 881292 30.00%
crit 17.33% 63.60 30 102 4061.50 3359 6496 4062.54 3649 4811 258328 369050 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Phys
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 180.72sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 306.82sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.14 0.00 0.00 0.00 0.00 1.0122 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [a]:1.14
Feral Spirit 14.5 22.27sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.48 0.00 0.00 0.00 0.00 1.1385 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:14.48
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.50
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 92.04% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • ascendance_1:10.14%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.7sec 180.7sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.2s / 182.7s
  • trigger_min/max:180.2s / 182.7s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.6sec 5.5sec 18.8sec 12.73% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.5s
  • trigger_min/max:0.0s / 164.2s
  • trigger_pct:100.00%
  • duration_min/max:17.0s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.45%
  • crumbling_power_4:0.72%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.70%
  • crumbling_power_7:0.70%
  • crumbling_power_8:0.68%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.71%
  • crumbling_power_18:1.23%
  • crumbling_power_19:0.84%
  • crumbling_power_20:0.01%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.5sec 90.5sec 7.9sec 9.85% 12.43% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.7s
  • trigger_min/max:90.0s / 92.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_1:9.85%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 14.5 0.0 24.7sec 21.3sec 17.7sec 65.59% 100.00% 0.0 (0.0) 10.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.4s / 82.3s
  • trigger_min/max:4.3s / 44.2s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 68.7s

Stack Uptimes

  • earthen_weapon_2:60.06%
  • earthen_weapon_4:5.51%
  • earthen_weapon_6:0.02%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 8.3 0.0 33.8sec 33.8sec 9.8sec 27.28% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 245.9s
  • trigger_min/max:10.0s / 245.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_critical_strike_1:27.28%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 8.4 0.0 33.6sec 33.6sec 9.8sec 27.39% 0.00% 0.0 (0.0) 8.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 246.3s
  • trigger_min/max:10.0s / 246.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_haste_1:27.39%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 8.3 0.0 33.8sec 33.8sec 9.8sec 27.35% 0.00% 0.0 (0.0) 8.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 243.8s
  • trigger_min/max:10.0s / 243.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_mastery_1:27.35%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.8sec 99.1sec 58.2sec 24.96% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 356.1s

Stack Uptimes

  • elemental_chaos_air_1:24.96%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:Grants Haste and movement speed is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 123.1sec 98.0sec 58.1sec 24.96% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 344.8s

Stack Uptimes

  • elemental_chaos_earth_1:24.96%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:Grants Mastery and damage taken reduced.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.9sec 100.3sec 58.0sec 25.01% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 327.7s

Stack Uptimes

  • elemental_chaos_fire_1:25.01%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:Grants Critical Strike and damage dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 125.1sec 99.1sec 58.7sec 25.08% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 355.0s

Stack Uptimes

  • elemental_chaos_frost_1:25.08%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:Grants Versatility and healing dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 308.0sec 0.0sec 27.4sec 13.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 331.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.41%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 11.1 3.4 28.3sec 22.3sec 17.7sec 65.59% 0.00% 56.3 (56.3) 10.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 82.3s
  • trigger_min/max:4.3s / 44.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.7s

Stack Uptimes

  • feral_spirit_1:65.59%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.8 367.8 6.9sec 0.7sec 5.8sec 84.49% 90.52% 367.8 (870.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 60.9s
  • trigger_min/max:0.0s / 16.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.8s

Stack Uptimes

  • flurry_1:20.34%
  • flurry_2:33.46%
  • flurry_3:30.68%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 117.9 17.8sec 2.2sec 14.6sec 84.00% 100.00% 56.4 (56.4) 16.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 49.1s
  • trigger_min/max:0.0s / 41.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:15.31%
  • forceful_winds_2:14.28%
  • forceful_winds_3:12.81%
  • forceful_winds_4:10.56%
  • forceful_winds_5:31.03%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=20}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=20}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.8sec 46.4sec 13.0sec 19.41% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 220.1s
  • trigger_min/max:0.2s / 220.1s
  • trigger_pct:98.94%
  • duration_min/max:0.0s / 58.9s

Stack Uptimes

  • forgestorm_ignited_1:19.41%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.3 1.3 14.9sec 14.0sec 7.6sec 51.64% 78.44% 1.3 (1.3) 5.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.9s / 62.9s
  • trigger_min/max:8.3s / 62.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.8s

Stack Uptimes

  • ice_strike_1:51.64%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 24.1 18.2 12.5sec 7.0sec 7.4sec 59.64% 100.00% 18.2 (18.2) 23.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 57.3s
  • trigger_min/max:0.8s / 34.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.7s

Stack Uptimes

  • legacy_of_the_frost_witch_1:59.64%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 50.6 385.4 6.0sec 0.7sec 5.1sec 86.37% 100.00% 66.8 (74.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 34.8s
  • trigger_min/max:0.0s / 7.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 34.2s

Stack Uptimes

  • maelstrom_weapon_1:9.08%
  • maelstrom_weapon_2:10.70%
  • maelstrom_weapon_3:12.30%
  • maelstrom_weapon_4:12.84%
  • maelstrom_weapon_5:8.58%
  • maelstrom_weapon_6:6.98%
  • maelstrom_weapon_7:5.29%
  • maelstrom_weapon_8:4.43%
  • maelstrom_weapon_9:3.64%
  • maelstrom_weapon_10:12.53%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage{$?a410673=false}[][ or healing] spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?a410673=false}&?s383303[ and its damage increased by]?s383303&!a410673[, damage increased by][]{$?s383303=true}&!s384149[ {$187881=}w2%]?s383303&s384149[ {$187881=}w2%][]{$?s383303=true}&!a410673[, and healing increased by][]{$?a410673=false}[]?s383303&!s384149[ {$187881=}w3%]?s383303&s384149[ {$187881=}w3%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase its damage by {$187881s2=0}% or its healing by {$187881s3=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.9sec 45.6sec 16.5sec 23.74% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 200.7s
  • trigger_min/max:0.0s / 198.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s

Stack Uptimes

  • sophic_devotion_1:23.74%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.0sec 45.4sec 32.3sec 38.47% 0.00% 26.0 (26.0) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 236.3s
  • trigger_min/max:0.0s / 208.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 188.3s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.96%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 100.00% 28.0 (28.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • static_accumulation_1:10.14%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411={$s2=10}% chance to refund Maelstrom Weapon stacks spent on Lightning Bolt or Chain Lightning. While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 59.3 18.4 5.0sec 3.8sec 1.2sec 23.04% 54.86% 18.4 (18.4) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 84.2s
  • trigger_min/max:0.0s / 84.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s

Stack Uptimes

  • stormbringer_1:23.04%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.3 36.0 66.0 17.9s 15.0s 66.1s
Windfury-ForcefulWinds: 2 50.6 33.0 69.0 18.1s 0.4s 66.9s
Windfury-ForcefulWinds: 3 48.8 27.0 69.0 18.8s 1.2s 85.9s
Windfury-ForcefulWinds: 4 45.2 24.0 72.0 20.3s 1.2s 103.1s
Windfury-ForcefulWinds: 5 209.6 105.0 348.0 4.8s 0.0s 92.3s
windfury_totem_extra_attack_mh 27.7 11.0 53.0 10.6s 1.2s 145.0s
windfury_totem_extra_attack_oh 28.2 10.0 52.0 10.4s 0.1s 122.7s
Elemental Blast: Critical Strike 8.3 1.0 18.0 33.8s 10.0s 245.9s
Elemental Blast: Haste 8.4 1.0 17.0 33.6s 10.0s 246.3s
Elemental Blast: Mastery 8.3 1.0 17.0 33.8s 10.0s 243.8s
Windfury: Unruly Winds 135.2 85.0 198.0 2.5s 0.0s 41.4s
Maelstrom Weapon: Feral Spirit 74.6 50.0 101.0 4.0s 0.0s 29.2s
Maelstrom Weapon: Elemental Assault 107.3 73.0 147.0 2.8s 0.8s 10.9s
Maelstrom Weapon: Static Accumulation 60.0 60.0 60.0 6.7s 1.0s 168.4s
Maelstrom Weapon: Static Accumulation Refund 47.9 0.0 129.0 33.8s 0.8s 329.0s
Stormflurry 35.7 10.0 77.0 10.9s 0.8s 139.9s
Legacy of the Frost Witch: Bugged Trigger 8.0 4.0 12.0 27.0s 1.6s 180.7s
Maelstrom Weapon: Windfury Attack 81.1 43.0 131.0 4.8s 0.0s 78.0s
Maelstrom Weapon: main_hand 28.7 10.0 52.0 10.2s 1.3s 122.3s
Maelstrom Weapon: Windlash 4.8 0.0 14.0 44.1s 1.2s 194.2s
Maelstrom Weapon: offhand 29.1 12.0 52.0 10.0s 1.3s 122.6s
Maelstrom Weapon: Windlash Off-Hand 5.1 0.0 14.0 41.7s 1.2s 194.6s
Maelstrom Weapon: Doom Winds 0.8 0.0 4.0 139.2s 90.0s 273.7s
Maelstrom Weapon: Lava Lash 3.8 0.0 12.0 55.9s 9.0s 299.3s
Maelstrom Weapon: Sundering 1.3 0.0 7.0 100.7s 40.0s 343.1s
Maelstrom Weapon: Windstrike 4.8 0.0 14.0 44.4s 0.8s 194.8s
Maelstrom Weapon: Windstrike Off-Hand 4.8 0.0 14.0 44.5s 0.8s 193.2s
Maelstrom Weapon: Ice Strike 4.3 0.0 12.0 54.9s 8.4s 321.6s
Maelstrom Weapon: Stormstrike 23.7 7.0 47.0 12.4s 0.9s 137.3s
Maelstrom Weapon: Stormstrike Off-Hand 23.8 7.0 48.0 12.3s 0.9s 139.3s
Flametongue: Windfury Attack 405.5 255.0 594.0 2.5s 0.0s 41.4s
Stormbringer: Windfury Attack 42.7 15.0 76.0 7.9s 0.0s 98.5s
Flametongue: main_hand 143.9 99.0 199.0 2.5s 1.3s 27.3s
Windfury: main_hand 48.8 21.0 83.0 6.3s 1.3s 76.5s
Flametongue: Windlash 24.1 19.0 33.0 10.2s 1.2s 170.3s
Windfury: Windlash 16.3 10.0 25.0 14.7s 1.2s 177.7s
Flametongue: offhand 145.4 96.0 196.0 2.4s 1.3s 29.8s
Flametongue: Windlash Off-Hand 25.2 20.0 34.0 9.7s 1.2s 168.2s
Flametongue: Lava Lash 19.2 13.0 26.0 14.9s 8.8s 52.9s
Stormbringer: Lava Lash 2.0 0.0 8.0 75.3s 8.9s 326.0s
Flametongue: Sundering 6.6 4.0 9.0 47.3s 40.0s 136.3s
Stormbringer: Sundering 0.7 0.0 5.0 116.0s 40.0s 330.9s
Windfury: Sundering 2.9 0.0 8.0 85.6s 40.0s 345.8s
Flametongue: Windstrike 24.0 14.0 41.0 11.3s 0.8s 171.7s
Stormbringer: Windstrike 2.5 0.0 11.0 60.1s 0.8s 193.6s
Windfury: Windstrike 17.0 9.0 32.0 15.5s 0.8s 177.7s
Flametongue: Windstrike Off-Hand 24.0 14.0 41.0 11.3s 0.8s 171.7s
Stormbringer: Windstrike Off-Hand 2.5 0.0 9.0 61.6s 0.8s 194.3s
Flametongue: Ice Strike 21.5 14.0 28.0 14.0s 8.3s 62.2s
Stormbringer: Ice Strike 2.3 0.0 10.0 74.7s 8.5s 338.5s
Windfury: Ice Strike 8.4 1.0 17.0 35.4s 8.4s 267.0s
Flametongue: Stormstrike 119.1 67.0 182.0 3.2s 0.9s 29.4s
Stormbringer: Stormstrike 12.5 0.0 30.0 21.6s 0.9s 242.6s
Windfury: Stormstrike 41.6 15.0 74.0 7.6s 0.9s 127.3s
Flametongue: Stormstrike Off-Hand 119.1 67.0 182.0 3.2s 0.9s 29.4s
Stormbringer: Stormstrike Off-Hand 12.5 1.0 35.0 21.7s 0.9s 255.3s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 25.45% 16.95% 33.07% 0.7s 0.0s 17.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7120.0001.51010.3294.35117.523
Ascendance0.6930.0002.4401.3860.9213.394
Doom Winds0.8630.0002.7023.2132.0886.840
Lava Lash3.9680.00040.53977.00737.968128.506
Elemental Blast0.5880.00023.57914.7238.56732.932
Sundering8.1300.00096.33154.4059.560141.020
Windstrike
Stormstrike
0.9810.0005.097105.50557.845157.778
Ice Strike2.4740.00049.86953.82817.738113.469
Frost Shock11.1160.000154.046213.053132.175297.897
Flame Shock17.8480.000199.845241.181162.367329.197
Earth Elemental29.3780.000153.01534.49917.849153.015

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack65.415.715.18%20.96%
main_hand26.02.76.02%3.66%
Windlash3.21.60.75%2.08%
offhand26.22.96.08%3.85%
Windlash Off-Hand3.61.50.83%2.00%
Feral Spirit64.210.414.88%13.95%
Ascendance41.918.19.73%24.14%
Doom Winds0.70.10.16%0.11%
Lightning Bolt31.00.07.19%0.00%
Lava Lash3.70.20.85%0.21%
Sundering1.20.10.27%0.19%
Windstrike16.01.93.72%2.60%
Windstrike (_mh)4.10.70.96%0.90%
Windstrike Off-Hand4.10.70.95%0.92%
Ice Strike4.10.20.94%0.28%
Stormstrike77.012.417.86%16.52%
Stormstrike (_mh)21.02.84.86%3.69%
Stormstrike Off-Hand20.93.04.84%3.95%
Lightning Bolt (_ti)16.90.03.91%0.00%
Overflow Stacks0.074.80.00%14.78%
Actual Stacks431.20.085.22%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt154.336.13%
Elemental Blast188.944.23%
Lightning Bolt (_ti)83.919.65%
Total Spent427.1100.00%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Phys
mana_regenMana667.11245936.46100.00%368.66233445.1248.70%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 819.79 822.67 233445.5 49135.1 42442.4 50000.0
Usage Type Count Total Tot% Avg RPE APR
PR_Shaman_Enhancement_Phys
BloodlustMana 1.001000.000.41%1000.001000.000.00
Elemental BlastMana 25.0234407.2613.94%1375.001375.0062.26
Flame ShockMana 12.699517.433.86%750.00297.9951.98
Frost ShockMana 18.519254.903.75%500.00499.9938.21
Ice StrikeMana 21.5535554.5214.41%1650.001650.0013.08
Lava LashMana 19.257699.243.12%400.00400.0055.93
Lightning BoltMana 21.1110552.534.28%500.00499.98126.66
StormstrikeMana 119.12119123.4548.27%1000.001333.1418.74
SunderingMana 6.5619692.177.98%3000.002999.9316.54

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Phys Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Phys Damage Per Second
Count 7499
Mean 49351.87
Minimum 41383.90
Maximum 60802.33
Spread ( max - min ) 19418.42
Range [ ( max - min ) / 2 * 100% ] 19.67%
Standard Deviation 2492.3538
5th Percentile 45440.33
95th Percentile 53692.63
( 95th Percentile - 5th Percentile ) 8252.31
Mean Distribution
Standard Deviation 28.7811
95.00% Confidence Interval ( 49295.46 - 49408.28 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 98
0.1% Error 9798
0.1 Scale Factor Error with Delta=300 53028
0.05 Scale Factor Error with Delta=300 212111
0.01 Scale Factor Error with Delta=300 5302774
Priority Target DPS
PR_Shaman_Enhancement_Phys Priority Target Damage Per Second
Count 7499
Mean 49351.87
Minimum 41383.90
Maximum 60802.33
Spread ( max - min ) 19418.42
Range [ ( max - min ) / 2 * 100% ] 19.67%
Standard Deviation 2492.3538
5th Percentile 45440.33
95th Percentile 53692.63
( 95th Percentile - 5th Percentile ) 8252.31
Mean Distribution
Standard Deviation 28.7811
95.00% Confidence Interval ( 49295.46 - 49408.28 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 98
0.1% Error 9798
0.1 Scale Factor Error with Delta=300 53028
0.05 Scale Factor Error with Delta=300 212111
0.01 Scale Factor Error with Delta=300 5302774
DPS(e)
PR_Shaman_Enhancement_Phys Damage Per Second (Effective)
Count 7499
Mean 49351.87
Minimum 41383.90
Maximum 60802.33
Spread ( max - min ) 19418.42
Range [ ( max - min ) / 2 * 100% ] 19.67%
Damage
PR_Shaman_Enhancement_Phys Damage
Count 7499
Mean 13867253.05
Minimum 10067463.88
Maximum 18000884.76
Spread ( max - min ) 7933420.88
Range [ ( max - min ) / 2 * 100% ] 28.60%
DTPS
PR_Shaman_Enhancement_Phys Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Phys Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Phys Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Phys Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Phys Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Phys Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_PhysTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Phys Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.50 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 invoke_external_buff,name=power_infusion,if=(talent.ascendance.enabled&talent.thorims_invocation.enabled&buff.ascendance.up)|(!talent.thorims_invocation.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.thorims_invocation.enabled&!talent.feral_spirit.enabled)|fight_remains<=20
F 14.48 feral_spirit
G 2.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
H 3.72 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
K 17.88 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
L 5.70 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
M 2.64 ice_strike,if=buff.doom_winds.up
N 1.34 sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
O 1.12 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
0.00 frost_shock,if=buff.hailstorm.up
P 2.83 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
Q 0.11 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 72.42 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
S 25.02 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
T 5.62 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
U 11.23 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
V 18.91 ice_strike
W 16.42 lava_lash
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
X 15.48 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 5.23 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
Z 18.51 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
a 1.14 earth_elemental
b 11.57 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ABCDFGEHKMKKKKFKKKKKOKFRSRVRWSRXYZaRRSRVWZbUUUTFRTRVWSZRbXRRRSRVWZbUUSUYFRRVWTRSRRXRZVWbUSZbHFLLMLLRSRRWXRVYXRZFSWRRVXRZbSRUTRVWRSRFRXXRRRSRVWXRYZbUFSVWRZbXRRRRSRDGEHKKFKKMKPKFKRSRSRRRVWXRRRRFSRRVWXYRRSRZXRRVSRRPFXXRRRSVZRWXRRRRFRSRRVWXRRRSHLLMNFTRWSRZbVXRZbSRRW

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 2 augmentation PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_fire
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
0:00.000 default B potion Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, elemental_chaos_fire
0:00.000 default C auto_attack Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:00.000 default D use_items Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, forceful_winds, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:00.000 default F feral_spirit Fluffy_Pillow 49000.0/50000: 98% mana bloodlust, flurry(2), forceful_winds, crumbling_power(20), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:00.953 default G ascendance Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), crumbling_power(19), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:01.908 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), static_accumulation, crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:01.908 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), static_accumulation, crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:02.772 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), static_accumulation, doom_winds, crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:03.639 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, doom_winds, crumbling_power(17), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:04.504 single K windstrike Fluffy_Pillow 49734.0/50000: 99% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, crumbling_power(16), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:05.370 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:06.235 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:07.100 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:07.967 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:08.867 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:09.733 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:10.600 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:11.467 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:12.334 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:13.201 single O flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:14.067 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(5), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:15.028 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, feral_spirit, earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:15.982 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, earthen_weapon(4), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(3), spiraling_winds, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:16.935 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, earthen_weapon(4), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(2), spiraling_winds, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:17.890 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, earthen_weapon(4), legacy_of_the_frost_witch, crumbling_power, spiraling_winds(2), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:18.816 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, earthen_weapon(4), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:19.742 single R stormstrike Fluffy_Pillow 49831.6/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(4), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:20.666 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(4), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:21.590 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(4), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:22.516 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(4), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:23.441 single X lightning_bolt Fluffy_Pillow 48480.0/50000: 97% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:24.366 single Y sundering Fluffy_Pillow 49460.0/50000: 99% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:25.291 single Z frost_shock Fluffy_Pillow 47940.0/50000: 96% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:26.217 single a earth_elemental Fluffy_Pillow 48921.6/50000: 98% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:27.143 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(6), sophic_devotion, forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:28.096 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), spiraling_winds(7), sophic_devotion, forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:29.050 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(7), sophic_devotion, forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:30.003 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:30.957 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:31.911 single W lava_lash Fluffy_Pillow 49876.4/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:32.866 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:33.819 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:34.772 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, maelstrom_weapon(3), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:35.727 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, forceful_winds(2), stormbringer, maelstrom_weapon(6), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:36.681 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, forceful_winds(2), stormbringer, maelstrom_weapon(8), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:37.635 single T lightning_bolt Fluffy_Pillow 49526.4/50000: 99% mana bloodlust, elemental_blast_mastery, forceful_winds(3), stormbringer, maelstrom_weapon(10), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:38.590 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, forceful_winds(3), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:39.544 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:40.498 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:41.738 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:42.977 single V ice_strike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:44.216 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:45.454 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:46.692 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:47.932 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:49.170 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:50.410 Waiting     0.186 sec 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:50.596 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:51.835 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:53.074 single R stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:54.314 single R stormstrike Fluffy_Pillow 49966.4/50000: 100% mana elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
0:55.553 single S elemental_blast Fluffy_Pillow 49948.8/50000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(9), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
0:56.790 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), legacy_of_the_frost_witch, elemental_chaos_fire
0:58.028 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
0:59.267 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:00.505 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:01.706 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), maelstrom_weapon, elemental_chaos_air
1:02.908 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(2), elemental_chaos_air
1:04.108 single U stormstrike Fluffy_Pillow 49920.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_air
1:05.310 single S elemental_blast Fluffy_Pillow 48843.2/50000: 98% mana flurry, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_air
1:06.512 single U stormstrike Fluffy_Pillow 49391.4/50000: 99% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, forgestorm_ignited, elemental_chaos_air
1:07.713 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, maelstrom_weapon, forgestorm_ignited, elemental_chaos_air
1:08.913 default F feral_spirit Fluffy_Pillow 48920.0/50000: 98% mana flurry(3), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_air
1:10.112 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_air
1:11.313 single R stormstrike Fluffy_Pillow 49921.6/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_air
1:12.513 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_air
1:13.712 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), ice_strike, forgestorm_ignited, elemental_chaos_air
1:14.912 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_air
1:16.112 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:17.314 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:18.515 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:19.680 single R stormstrike Fluffy_Pillow 49864.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:20.846 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:22.012 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:23.179 single Z frost_shock Fluffy_Pillow 49867.2/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:24.342 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_air
1:25.508 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:26.674 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon(4), ice_strike, elemental_chaos_air
1:27.840 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(4), ice_strike, elemental_chaos_air
1:29.040 single S elemental_blast Fluffy_Pillow 49920.0/50000: 100% mana flurry(3), maelstrom_weapon(6), ice_strike, elemental_chaos_air
1:30.240 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, maelstrom_weapon, ice_strike, elemental_chaos_air
1:31.441 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, maelstrom_weapon(2), elemental_chaos_air
1:32.642 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, maelstrom_weapon(2), elemental_chaos_air
1:33.843 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(2), doom_winds, elemental_chaos_air
1:35.043 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, elemental_chaos_air
1:36.245 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(5), doom_winds, elemental_chaos_air
1:37.445 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), doom_winds, elemental_chaos_air
1:38.646 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_air
1:39.845 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_air
1:41.046 single R stormstrike Fluffy_Pillow 49921.6/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_air
1:42.246 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_air
1:43.449 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:44.614 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:45.778 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:46.944 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:48.111 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:49.278 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:50.444 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:51.609 single X lightning_bolt Fluffy_Pillow 48864.0/50000: 98% mana flurry(3), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:52.775 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:53.977 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:55.178 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_air
1:56.378 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_air
1:57.579 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), elemental_chaos_air
1:58.781 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, elemental_chaos_air
1:59.982 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), elemental_chaos_air
2:01.183 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_fire
2:02.426 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, elemental_chaos_fire
2:03.665 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
2:04.903 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
2:06.143 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_fire
2:07.382 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_fire
2:08.620 Waiting     0.993 sec 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), spiraling_winds, elemental_chaos_fire
2:09.613 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), spiraling_winds(2), sophic_devotion, elemental_chaos_fire
2:11.072 single U stormstrike Fluffy_Pillow 47979.2/50000: 96% mana flurry(3), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(6), spiraling_winds(2), sophic_devotion, elemental_chaos_fire
2:12.311 single T lightning_bolt Fluffy_Pillow 47961.6/50000: 96% mana flurry, elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon(10), spiraling_winds(3), sophic_devotion, elemental_chaos_fire
2:13.550 single R stormstrike Fluffy_Pillow 49444.0/50000: 99% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), stormbringer, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:14.790 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:16.028 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:17.267 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:18.505 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(3), maelstrom_weapon(5), ice_strike, spiraling_winds(6), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:19.742 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:20.980 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:22.417 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:23.655 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(9), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:24.895 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:26.133 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:27.373 single R stormstrike Fluffy_Pillow 49984.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(9), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:28.612 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:29.853 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:31.093 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:32.331 single V ice_strike Fluffy_Pillow 49980.8/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:33.568 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:34.806 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:36.044 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:37.282 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:38.520 single Z frost_shock Fluffy_Pillow 48980.8/50000: 98% mana flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:39.758 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:40.996 Waiting     0.993 sec 50000.0/50000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_fire
2:41.989 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_fire
2:43.452 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_fire
2:44.692 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_fire
2:45.931 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), spiraling_winds(10), elemental_chaos_fire
2:47.169 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds(10), elemental_chaos_fire
2:48.408 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds(10), elemental_chaos_fire
2:49.645 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, spiraling_winds(10), elemental_chaos_fire
2:50.882 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_fire
2:52.119 Waiting     0.369 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_fire
2:52.488 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_fire
2:53.727 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
2:54.965 single R stormstrike Fluffy_Pillow 49980.8/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_fire
2:56.205 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_fire
2:57.443 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, elemental_chaos_fire
2:58.682 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), stormbringer, maelstrom_weapon(10), elemental_chaos_fire
2:59.923 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), stormbringer, legacy_of_the_frost_witch, elemental_chaos_fire
3:01.160 default D use_items Fluffy_Pillow 49979.2/50000: 100% mana elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_fire
3:01.160 default G ascendance Fluffy_Pillow 49979.2/50000: 100% mana elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(3), legacy_of_the_frost_witch, crumbling_power(20), elemental_chaos_fire
3:02.397 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, crumbling_power(19), elemental_chaos_fire
3:02.397 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, crumbling_power(19), elemental_chaos_fire
3:03.769 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(8), static_accumulation, doom_winds, crumbling_power(19), forgestorm_ignited, elemental_chaos_fire
3:04.896 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_critical_strike, forceful_winds(4), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds, crumbling_power(18), forgestorm_ignited, elemental_chaos_fire
3:06.021 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(17), forgestorm_ignited, elemental_chaos_fire
3:07.145 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(16), forgestorm_ignited, elemental_chaos_fire
3:08.270 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(15), forgestorm_ignited, elemental_chaos_fire
3:09.395 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(14), forgestorm_ignited, elemental_chaos_fire
3:10.521 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), forgestorm_ignited, elemental_chaos_fire
3:11.645 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), forgestorm_ignited, elemental_chaos_fire
3:12.771 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), forgestorm_ignited, elemental_chaos_fire
3:13.898 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), forgestorm_ignited, elemental_chaos_fire
3:15.067 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_fire
3:16.306 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(4), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_fire
3:17.543 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(4), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_fire
3:18.781 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_fire
3:19.984 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(4), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), elemental_chaos_fire
3:21.187 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:22.389 single R stormstrike Fluffy_Pillow 49923.2/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
3:23.591 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_fire
3:24.794 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_fire
3:25.996 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, sophic_devotion, elemental_chaos_fire
3:27.197 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_fire
3:28.400 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
3:29.639 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
3:30.878 single R stormstrike Fluffy_Pillow 47982.4/50000: 96% mana flurry(2), forceful_winds(3), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
3:32.116 single R stormstrike Fluffy_Pillow 48963.2/50000: 98% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
3:33.355 default F feral_spirit Fluffy_Pillow 49945.6/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_fire
3:34.595 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_fire
3:35.833 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
3:37.035 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
3:38.237 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
3:39.439 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
3:40.640 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, elemental_chaos_fire
3:41.844 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, elemental_chaos_fire
3:43.048 single R stormstrike Fluffy_Pillow 48926.4/50000: 98% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, elemental_chaos_fire
3:44.250 single R stormstrike Fluffy_Pillow 48849.6/50000: 98% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_fire
3:45.453 single S elemental_blast Fluffy_Pillow 49774.4/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(9), ice_strike, elemental_chaos_fire
3:46.692 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:47.931 single Z frost_shock Fluffy_Pillow 48982.4/50000: 98% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:49.169 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_fire
3:50.406 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(2), legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_fire
3:51.643 single R stormstrike Fluffy_Pillow 49979.2/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(4), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_fire
3:52.881 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_fire
3:54.119 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_fire
3:55.358 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_fire
3:56.561 single R stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_fire
3:57.763 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_fire
3:58.965 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_fire
4:00.167 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(6), elemental_chaos_frost
4:01.371 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(7), elemental_chaos_frost
4:02.573 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_frost
4:03.776 single R stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_frost
4:04.978 single R stormstrike Fluffy_Pillow 47848.0/50000: 96% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_frost
4:06.216 single S elemental_blast Fluffy_Pillow 48828.8/50000: 98% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_frost
4:07.456 single V ice_strike Fluffy_Pillow 49437.8/50000: 99% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), spiraling_winds(10), elemental_chaos_frost
4:08.695 single Z frost_shock Fluffy_Pillow 49770.2/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, spiraling_winds(10), elemental_chaos_frost
4:09.934 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_frost
4:11.173 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), spiraling_winds(10), elemental_chaos_frost
4:12.412 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:13.650 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:14.888 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(4), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:16.127 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(9), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:17.364 single R stormstrike Fluffy_Pillow 48979.2/50000: 98% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:18.603 default F feral_spirit Fluffy_Pillow 48961.6/50000: 98% mana flurry, forceful_winds(5), stormbringer, maelstrom_weapon(10), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:19.842 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:21.080 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:22.318 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:23.522 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:24.725 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:25.928 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:27.131 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(10), elemental_chaos_frost
4:28.335 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
4:29.539 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
4:30.741 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
4:31.943 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:33.183 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:34.386 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon(3), doom_winds, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:35.588 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon(5), doom_winds, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:36.790 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(8), doom_winds, legacy_of_the_frost_witch, elemental_chaos_frost
4:37.992 single N sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(8), doom_winds, ice_strike, elemental_chaos_frost
4:39.195 default F feral_spirit Fluffy_Pillow 48924.8/50000: 98% mana flurry(3), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_frost
4:40.397 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_frost
4:41.599 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:42.802 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:44.042 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:45.282 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:46.521 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:47.760 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_frost
4:49.000 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_frost
4:50.237 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_frost
4:51.476 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, elemental_chaos_frost
4:52.714 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, elemental_chaos_frost
4:53.953 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_frost
4:55.193 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, stormbringer, maelstrom_weapon(6), elemental_chaos_frost
4:56.431 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), stormbringer, legacy_of_the_frost_witch, elemental_chaos_frost
4:57.669 single R stormstrike Fluffy_Pillow 48980.8/50000: 98% mana flurry(3), elemental_blast_critical_strike, forceful_winds(4), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
4:58.908 single W lava_lash Fluffy_Pillow 49963.2/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_frost

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3848 0 11114 10585 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 222280 211700 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 19.25% 15.63% 1013
Haste 21.55% 21.55% 3663
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Phys"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAoEhkQCKCk0SSaICQikGC
dragonflight.player.ominous_chromatic_essence_dragonflight=obsidian
dragonflight.player.ashkandur_humanoid=

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/invoke_external_buff,name=power_infusion,if=(talent.ascendance.enabled&talent.thorims_invocation.enabled&buff.ascendance.up)|(!talent.thorims_invocation.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.thorims_invocation.enabled&!talent.feral_spirit.enabled)|fight_remains<=20
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&(talent.primordial_wave.enabled|talent.fire_nova.enabled)&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/sundering
actions.aoe+=/flame_shock,if=talent.molten_assault.enabled&!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=(talent.fire_nova.enabled|talent.primordial_wave.enabled)&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(talent.deeply_rooted_elements.enabled|buff.converging_storms.stack=6)
actions.aoe+=/crash_lightning,if=talent.crashing_storms.enabled&buff.cl_crash_lightning.up&active_enemies>=4
actions.aoe+=/windstrike
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/crash_lightning
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/frost_shock,if=!talent.hailstorm.enabled

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up|set_bonus.tier30_2pc
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5&buff.crackling_thunder.up
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 284224726
Max Event Queue: 336
Sim Seconds: 2250297
CPU Seconds: 284.2559
Physical Seconds: 142.4923
Speed Up: 7916

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.53sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 153620 512 7.65 3068 6136 38.2 38.2 30.9% 0.0% 0.0% 0.0% 6.91sec 153620 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost antimagic_shell 48707 0 0 0.00 0 0 7.4 0.0 0.0% 0.0% 0.0% 0.0% 43.45sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 145.35sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 787801 2626 38.29 3595 7191 191.4 191.4 30.8% 16.3% 0.0% 0.0% 1.83sec 1125459 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 383608 1279 37.42 1797 3595 187.1 187.1 30.8% 16.7% 0.0% 0.0% 1.83sec 548025 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost blood_draw 374606 28020 93 0.40 10757 21435 2.0 2.0 30.4% 0.0% 0.0% 0.0% 179.84sec 28020 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.52sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_tick 155166 2865210 9551 26.29 16686 33259 131.5 131.5 30.8% 0.0% 0.0% 0.0% 2.04sec 2865210 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 204969 683 0.53 59039 118247 2.8 2.7 30.2% 0.0% 0.0% 0.0% 119.19sec 204969 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay 43265 3277 11 1.24 403 807 0.6 6.2 30.6% 0.0% 0.0% 0.0% 79.47sec 3277 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 259823 866 1.20 33171 66341 6.0 6.0 30.8% 0.0% 0.0% 0.0% 48.06sec 371185 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 82.82sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 647173 2157 19.74 5021 10014 60.3 98.7 30.8% 0.0% 0.0% 0.0% 4.95sec 647173 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 49143 672498 2242 8.74 11774 23489 43.7 43.7 30.8% 0.0% 0.0% 0.0% 5.00sec 672498 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 335636 1119 8.74 5889 11735 43.7 43.7 30.6% 0.0% 0.0% 0.0% 5.00sec 335636 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 76.54sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 1788903 5963 12.06 22699 45276 60.3 60.3 30.9% 0.0% 0.0% 0.0% 4.95sec 1788903 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 374645 1249 12.06 4760 9486 60.3 60.3 30.8% 0.0% 0.0% 0.0% 4.95sec 374645 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 360057 1200 10.00 5516 11043 50.0 50.0 30.5% 0.0% 0.0% 0.0% 5.88sec 514380 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 180085 600 10.00 2758 5522 50.0 50.0 30.5% 0.0% 0.0% 0.0% 5.88sec 257271 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1509711 5032 11.16 0 27061 55.8 55.8 100.0% 0.0% 0.0% 0.0% 5.31sec 1509711 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 754856 2516 11.16 0 13530 55.8 55.8 100.0% 0.0% 0.0% 0.0% 5.31sec 754856 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 36.27sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 304.05sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.70sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 20.39sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1521948 5073 47.84 4872 9720 239.2 239.2 30.8% 0.0% 0.0% 0.0% 1.25sec 1521948 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 60361 201 4.02 2296 4593 20.1 20.1 30.8% 0.0% 0.0% 0.0% 14.52sec 86233 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 60558 202 4.03 2296 4593 20.2 20.2 30.7% 0.0% 0.0% 0.0% 14.45sec 86514 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.2 0.0 0.0% 0.0% 0.0% 0.0% 14.40sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul auto_attack 0 215375 1315 34.89 1729 3460 95.2 95.2 30.8% 0.0% 0.0% 0.0% 2.91sec 307686 163.78sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 106034 647 19.31 1538 3074 52.7 52.7 30.8% 0.0% 0.0% 0.0% 5.34sec 151481 163.78sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 194 1 1.07 51 101 2.9 2.9 31.5% 0.0% 0.0% 0.0% 120.71sec 277 163.78sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy algethar_puzzle_box_channel 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy antimagic_shell 48707 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 44.53sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 65400 218 1.37 7966 15946 6.9 6.9 19.7% 0.0% 0.0% 0.0% 46.08sec 65400 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 855920 2853 30.89 4627 9253 154.5 154.5 19.8% 0.0% 0.0% 0.0% 2.34sec 1222775 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.36sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy blood_draw 374606 26967 90 0.40 11252 22313 2.0 2.0 20.2% 0.0% 0.0% 0.0% 0.00sec 26967 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy clawing_shadows 207311 1773652 5912 14.70 20179 40359 73.5 73.5 19.6% 0.0% 0.0% 0.0% 3.94sec 1773652 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 61236 204 1.39 7356 14708 6.9 6.9 19.8% 0.0% 0.0% 0.0% 46.11sec 61236 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_and_decay 43265 70837 236 18.21 650 1299 8.4 91.0 19.8% 0.0% 0.0% 0.0% 37.29sec 70837 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 1689595 5632 19.89 14204 28388 99.5 99.4 19.7% 0.0% 0.0% 0.0% 2.99sec 1689595 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 498082 1660 27.19 3664 0 0.0 135.9 0.0% 0.0% 0.0% 0.0% 0.00sec 498082 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 280945 936 1.41 33373 66746 7.0 7.0 19.6% 0.0% 0.0% 0.0% 47.15sec 401361 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 169.33sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 329458 1098 4.99 11008 22000 25.0 25.0 19.9% 0.0% 0.0% 0.0% 11.96sec 470666 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 567982 1893 20.18 4701 9407 100.9 100.9 19.7% 0.0% 0.0% 0.0% 3.65sec 567982 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 23788 79 2.32 1710 3404 11.6 11.6 19.9% 0.0% 0.0% 0.0% 27.05sec 23788 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak_aoe 196780 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 27.05sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 173130 577 3.13 9261 18514 15.6 15.6 19.6% 0.0% 0.0% 0.0% 6.86sec 173130 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 833333 2778 3.13 44643 89385 15.6 15.6 19.4% 0.0% 0.0% 0.0% 6.87sec 833333 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.38sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 59197 197 0.73 13568 27181 3.6 3.6 19.9% 0.0% 0.0% 0.0% 91.69sec 59197 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 21.8 0.0 0.0% 0.0% 0.0% 0.0% 13.39sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 253100 844 19.90 2123 4247 11.6 99.5 19.8% 0.0% 0.0% 0.0% 27.05sec 253100 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul auto_attack 0 1362599 4542 39.08 5825 11656 195.4 195.4 19.7% 0.0% 0.0% 0.0% 1.53sec 1946619 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 101055 337 7.62 2216 4427 38.1 38.1 19.7% 0.0% 0.0% 0.0% 8.01sec 144367 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 356 1 0.75 79 159 3.7 3.7 20.1% 0.0% 0.0% 0.0% 90.14sec 508 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 435566 1452 13.84 5256 10526 69.2 69.2 19.7% 0.0% 0.0% 0.0% 4.23sec 435566 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 1404966 28099 38.40 36681 73183 32.0 32.0 19.8% 0.0% 0.0% 0.0% 6.62sec 1404966 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul auto_attack 0 1475220 24739 370.08 3350 6697 367.8 367.8 19.7% 0.0% 0.0% 0.0% 0.82sec 2107511 59.63sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 289084 4848 223.10 1089 2174 221.7 221.7 19.8% 0.0% 0.0% 0.0% 1.44sec 412988 59.63sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead frostbolt 317792 228262 2394 17.55 6844 13667 27.9 27.9 19.6% 0.0% 0.0% 0.0% 10.79sec 228262 95.35sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead shadow_bolt 317791 923317 9684 70.66 6869 13735 112.3 112.3 19.7% 0.0% 0.0% 0.0% 2.60sec 923317 95.35sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul auto_attack 0 1066930 8048 131.65 3066 6129 290.9 290.9 19.7% 0.0% 0.0% 0.0% 3.84sec 1524224 132.57sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 238955 1802 89.80 1006 2013 198.4 198.4 19.7% 0.0% 0.0% 0.0% 5.68sec 341373 132.57sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow desperate_prayer 19236 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 565888 1886 6.95 14364 28773 34.8 34.8 13.3% 0.0% 0.0% 0.0% 8.47sec 565888 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 1642425 5475 36.23 7998 16023 181.2 181.2 13.3% 0.0% 0.0% 0.0% 1.64sec 1642425 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 36169 121 6.40 1130 0 32.0 32.0 0.0% 0.0% 0.0% 0.0% 6.40sec 36169 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 149717 499 1.27 20734 41609 6.3 6.3 14.0% 0.0% 0.0% 0.0% 10.13sec 149717 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage ticks -32409 162675 542 1.25 22880 46324 6.3 6.2 13.8% 0.0% 0.0% 0.0% 10.13sec 167909 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_pain 589 58795 196 3.68 2829 5658 18.4 18.4 13.1% 0.0% 0.0% 0.0% 16.05sec 511190 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_pain ticks -589 452395 1508 37.91 2107 4218 18.4 189.6 13.3% 0.0% 0.0% 0.0% 16.05sec 511190 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowfiend 34433 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 308014 1027 15.89 3876 0 7.0 79.5 0.0% 0.0% 0.0% 0.0% 38.13sec 308014 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 536792 1789 24.04 3941 7895 12.1 120.2 13.3% 0.0% 0.0% 0.0% 23.12sec 536792 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 120.2 0.0 0.0% 0.0% 0.0% 0.0% 2.46sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_shadowfiend melee 0 140474 4014 54.86 3881 7762 32.0 32.0 13.1% 0.0% 0.0% 0.0% 6.40sec 140474 35.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 310.57sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement elemental_blast 117014 2550788 8503 4.18 100444 202462 20.9 20.9 21.1% 0.0% 0.0% 0.0% 14.25sec 2550788 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 10.7 0.0 0.0% 0.0% 0.0% 0.0% 30.06sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 709016 2363 16.80 6943 13952 84.0 84.0 21.4% 0.0% 0.0% 0.0% 3.57sec 1669197 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 960181 3201 38.47 4104 8247 84.0 192.4 21.4% 0.0% 0.0% 0.0% 3.57sec 1669197 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 315571 1052 135.47 396 796 677.3 677.3 17.4% 0.0% 0.0% 0.0% 0.71sec 315571 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 327561 1092 5.68 9807 19717 28.4 28.4 17.5% 0.0% 0.0% 0.0% 7.72sec 327561 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 1669812 5566 7.97 35586 71585 39.8 39.8 17.6% 0.0% 0.0% 0.0% 7.51sec 1669812 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 598420 1995 4.91 20737 41667 24.5 24.5 17.4% 0.0% 0.0% 0.0% 12.33sec 598420 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 2918734 9729 13.58 36559 73393 67.9 67.9 17.4% 0.0% 0.0% 0.0% 4.37sec 2918734 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 1053986 3513 3.25 53383 106858 16.3 16.3 21.4% 0.0% 0.0% 0.0% 18.71sec 1053986 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 1 519898 1733 38.71 2655 5334 193.6 193.6 17.4% 16.4% 0.0% 0.0% 1.81sec 742731 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 2 260252 868 38.73 1329 2670 193.7 193.7 17.4% 16.4% 0.0% 0.0% 1.80sec 371798 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.28sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement primordial_wave 375982 48696 162 1.41 5896 11856 7.0 7.0 17.3% 0.0% 0.0% 0.0% 45.72sec 48696 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt_pw 188196 854024 2847 1.40 100549 202335 7.0 7.0 21.1% 0.0% 0.0% 0.0% 45.90sec 854024 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 51.7 0.0 0.0% 0.0% 0.0% 0.0% 5.73sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 414412 1381 10.34 6814 13704 51.7 51.7 17.4% 0.0% 0.0% 0.0% 5.73sec 592032 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 207317 691 10.34 3406 6857 51.7 51.7 17.4% 0.0% 0.0% 0.0% 5.73sec 296174 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 247442 825 1.15 36545 73651 5.7 5.7 17.7% 0.0% 0.0% 0.0% 53.64sec 247442 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 340730 1136 30.40 1907 3831 152.0 152.0 17.4% 0.0% 0.0% 0.0% 4.06sec 486770 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 27117 438 38.82 577 1153 40.1 40.1 17.3% 0.0% 0.0% 0.0% 2.30sec 38739 61.96sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_frost_wolf melee 0 213258 5615 141.82 2023 4040 89.8 89.8 17.5% 0.0% 0.0% 0.0% 3.41sec 304661 37.98sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_lightning_wolf melee 0 212317 5552 140.15 2023 4045 89.3 89.3 17.5% 0.0% 0.0% 0.0% 3.42sec 303318 38.24sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_fiery_wolf melee 0 211733 5028 126.81 2025 4048 89.0 89.0 17.5% 0.0% 0.0% 0.0% 3.42sec 302483 42.11sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_dre 114051 0 0 0.00 0 0 8.2 0.0 0.0% 0.0% 0.0% 0.0% 31.51sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_damage_dre 344548 320251 1068 1.64 32594 65467 8.2 8.2 19.6% 0.0% 0.0% 0.0% 31.51sec 320251 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba doom_winds 384352 24708 82 0.75 6619 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.41sec 35298 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 309.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba elemental_blast 117014 2266842 7556 5.07 73871 148352 25.4 25.4 20.8% 0.0% 0.0% 0.0% 11.66sec 2266842 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba feral_spirit 51533 0 0 0.00 0 0 15.8 0.0 0.0% 0.0% 0.0% 0.0% 19.75sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock 188389 102720 342 5.84 2893 5807 29.2 29.2 21.4% 0.0% 0.0% 0.0% 10.13sec 493427 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock ticks -188389 390707 1302 37.47 1714 3443 29.2 187.4 21.5% 0.0% 0.0% 0.0% 10.13sec 493427 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_attack 10444 471826 1573 223.74 359 721 1118.7 1118.7 17.3% 0.0% 0.0% 0.0% 0.67sec 471826 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba forgestorm_ignited_damage 381700 335298 1118 5.81 9807 19716 29.0 29.0 17.6% 0.0% 0.0% 0.0% 7.57sec 335298 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba frost_shock 196840 302961 1010 3.08 16727 33586 15.4 15.4 17.3% 0.0% 0.0% 0.0% 18.11sec 302961 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ice_strike 342240 449320 1498 4.12 18536 37238 20.6 20.6 17.5% 0.0% 0.0% 0.0% 14.68sec 449320 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lava_lash 60103 424948 1416 3.76 19231 38518 18.8 18.8 17.5% 0.0% 0.0% 0.0% 15.59sec 424948 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt 188196 1355424 4518 4.14 53827 107935 20.7 20.7 21.6% 0.0% 0.0% 0.0% 13.65sec 1355424 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba main_hand 1 439613 1465 32.76 2651 5328 163.8 163.8 17.4% 16.3% 0.0% 0.0% 2.13sec 628034 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba offhand 2 225205 751 33.49 1328 2671 167.4 167.4 17.4% 16.3% 0.0% 0.0% 2.08sec 321729 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.36sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike 17364 0 0 0.00 0 0 92.9 0.0 0.0% 0.0% 0.0% 0.0% 3.22sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_mh 32175 1326853 4423 24.77 9107 18329 123.9 123.9 17.4% 0.0% 0.0% 0.0% 3.22sec 1895552 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_mh 390287 312639 1042 12.28 5092 0 61.4 61.4 0.0% 0.0% 0.0% 0.0% 5.47sec 312639 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_offhand 32176 663187 2211 24.77 4553 9165 123.9 123.9 17.4% 0.0% 0.0% 0.0% 3.22sec 947435 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_offhand 390287 156237 521 12.28 2545 0 61.4 61.4 0.0% 0.0% 0.0% 0.0% 5.47sec 156237 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba sundering 197214 321565 1072 1.27 43336 86767 6.3 6.3 17.1% 0.0% 0.0% 0.0% 49.84sec 321565 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_attack 25504 2291871 7640 82.79 4719 9454 414.0 414.0 17.3% 0.0% 0.0% 0.0% 2.42sec 3274184 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash 114089 153323 511 6.63 3808 7652 33.1 33.1 21.3% 0.0% 0.0% 0.0% 8.65sec 153323 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash_offhand 114093 89023 297 7.71 1903 3825 38.5 38.5 21.2% 0.0% 0.0% 0.0% 7.45sec 89023 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike 115356 0 0 0.00 0 0 23.4 0.0 0.0% 0.0% 0.0% 0.0% 10.24sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_mh 115357 512835 1709 6.25 13985 28122 31.2 31.2 17.2% 0.0% 0.0% 0.0% 10.24sec 512835 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_mh 390287 101032 337 2.31 8758 0 11.5 11.5 0.0% 0.0% 0.0% 0.0% 19.85sec 101032 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_offhand 115360 256268 854 6.25 6991 14076 31.2 31.2 17.2% 0.0% 0.0% 0.0% 10.24sec 256268 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_offhand 390287 50359 168 2.31 4365 0 11.5 11.5 0.0% 0.0% 0.0% 0.0% 19.85sec 50359 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt_ti 188196 1161035 3870 4.68 40908 82118 23.4 23.4 21.1% 0.0% 0.0% 0.0% 10.25sec 1161035 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_greater_earth_elemental melee 0 27769 446 39.39 579 1160 40.8 40.8 17.4% 0.0% 0.0% 0.0% 2.32sec 39671 62.19sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_spirit_wolf melee 0 924797 10864 277.46 2003 4002 393.6 393.6 17.3% 0.0% 0.0% 0.0% 1.51sec 1321172 85.13sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.44sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance_damage 344548 101555 339 0.40 42592 85559 2.0 2.0 19.0% 0.0% 0.0% 0.0% 180.44sec 101555 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.72sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys doom_winds 384352 24506 82 0.74 6583 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.49sec 35009 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 306.82sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys elemental_blast 117014 2142363 7141 5.00 70757 142032 25.0 25.0 20.9% 0.0% 0.0% 0.0% 11.66sec 2142363 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys feral_spirit 51533 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 22.27sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock 188389 110829 369 6.39 2854 5733 31.9 31.9 21.4% 0.0% 0.0% 0.0% 9.16sec 494726 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock ticks -188389 383897 1280 36.95 1708 3430 31.9 184.8 21.5% 0.0% 0.0% 0.0% 9.16sec 494726 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_attack 10444 456550 1522 215.53 361 724 1077.7 1077.7 17.3% 0.0% 0.0% 0.0% 0.69sec 456550 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys forgestorm_ignited_damage 381700 331729 1106 5.75 9807 19715 28.7 28.7 17.5% 0.0% 0.0% 0.0% 7.66sec 331729 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys frost_shock 196840 353672 1179 3.70 16215 32670 18.5 18.5 17.6% 0.0% 0.0% 0.0% 14.94sec 353672 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ice_strike 342240 464939 1550 4.31 18371 36877 21.5 21.5 17.3% 0.0% 0.0% 0.0% 13.97sec 464939 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lava_lash 60103 430636 1435 3.85 19012 38160 19.2 19.2 17.6% 0.0% 0.0% 0.0% 14.94sec 430636 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt 188196 1336532 4455 4.22 51985 104205 21.1 21.1 21.7% 0.0% 0.0% 0.0% 13.31sec 1336532 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys main_hand 1 449916 1500 34.42 2583 5193 172.1 172.1 17.4% 16.4% 0.0% 0.0% 1.93sec 642754 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys offhand 2 228069 760 34.78 1295 2604 173.9 173.9 17.5% 16.4% 0.0% 0.0% 2.00sec 325821 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike 17364 0 0 0.00 0 0 89.4 0.0 0.0% 0.0% 0.0% 0.0% 3.17sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_mh 32175 1210215 4034 23.82 8637 17375 119.1 119.1 17.4% 0.0% 0.0% 0.0% 3.17sec 1728923 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_mh 390287 278588 929 11.61 4801 0 58.0 58.0 0.0% 0.0% 0.0% 0.0% 5.43sec 278588 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_offhand 32176 604859 2016 23.82 4319 8682 119.1 119.1 17.4% 0.0% 0.0% 0.0% 3.17sec 864106 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_offhand 390287 139245 464 11.61 2399 0 58.0 58.0 0.0% 0.0% 0.0% 0.0% 5.43sec 139245 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys sundering 197214 325697 1086 1.31 42215 84526 6.6 6.6 17.5% 0.0% 0.0% 0.0% 47.27sec 325697 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_attack 25504 2277883 7593 81.09 4794 9585 405.5 405.5 17.2% 0.0% 0.0% 0.0% 2.47sec 3254201 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash 114089 133474 445 4.83 4569 9178 24.1 24.1 20.8% 0.0% 0.0% 0.0% 10.15sec 133474 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash_offhand 114093 70005 233 5.05 2289 4605 25.2 25.2 21.0% 0.0% 0.0% 0.0% 9.69sec 70005 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike 115356 0 0 0.00 0 0 18.0 0.0 0.0% 0.0% 0.0% 0.0% 11.34sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_mh 115357 508299 1694 4.79 18169 36376 24.0 24.0 16.7% 0.0% 0.0% 0.0% 11.34sec 508299 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_mh 390287 123676 412 2.23 11081 0 11.2 11.2 0.0% 0.0% 0.0% 0.0% 18.61sec 123676 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_offhand 115360 254215 847 4.79 9077 18269 24.0 24.0 16.7% 0.0% 0.0% 0.0% 11.34sec 254215 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_offhand 390287 61916 206 2.23 5547 0 11.2 11.2 0.0% 0.0% 0.0% 0.0% 18.61sec 61916 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt_ti 188196 1063989 3547 3.58 49229 98566 17.9 17.9 20.8% 0.0% 0.0% 0.0% 11.42sec 1063989 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_greater_earth_elemental melee 0 26501 429 38.45 570 1140 39.6 39.6 17.3% 0.0% 0.0% 0.0% 2.37sec 37860 61.83sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_spirit_wolf melee 0 875217 12766 321.18 2033 4061 367.0 367.0 17.3% 0.0% 0.0% 0.0% 1.62sec 1250342 68.56sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
254365.6 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.6 2.2 22.3sec 18.7sec 5.5sec 23.03% 0.00% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.4s / 210.0s
  • trigger_min/max:1.7s / 210.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 26.0s

Stack Uptimes

  • brittle_1:23.03%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.3sec 18.8sec 5.5sec 23.22% 0.00% 2.2 (2.2) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 174.0s
  • trigger_min/max:3.0s / 174.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.22%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 119.5 153.3sec 2.5sec 292.6sec 98.53% 0.00% 110.4 (110.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.3s / 321.6s
  • trigger_min/max:0.0s / 15.6s
  • trigger_pct:100.00%
  • duration_min/max:24.0s / 355.6s

Stack Uptimes

  • death_rot_1:0.28%
  • death_rot_2:0.29%
  • death_rot_3:0.89%
  • death_rot_4:0.29%
  • death_rot_5:0.67%
  • death_rot_6:0.53%
  • death_rot_7:0.49%
  • death_rot_8:0.48%
  • death_rot_9:0.50%
  • death_rot_10:94.11%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% from you for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 6.4 232.8 49.8sec 1.2sec 45.9sec 97.94% 0.00% 176.3 (176.3) 5.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 245.7s
  • trigger_min/max:0.0s / 15.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 245.4s

Stack Uptimes

  • everfrost_1:2.13%
  • everfrost_2:2.13%
  • everfrost_3:2.12%
  • everfrost_4:2.11%
  • everfrost_5:2.10%
  • everfrost_6:2.09%
  • everfrost_7:2.08%
  • everfrost_8:2.07%
  • everfrost_9:2.07%
  • everfrost_10:79.04%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 20.9 39.9 14.3sec 4.9sec 12.3sec 85.67% 0.00% 5.0 (6.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 106.7s
  • trigger_min/max:0.0s / 30.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 144.4s

Stack Uptimes

  • festering_wound_1:19.86%
  • festering_wound_2:25.62%
  • festering_wound_3:19.20%
  • festering_wound_4:9.34%
  • festering_wound_5:5.42%
  • festering_wound_6:6.22%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 66.9 1.8sec 4.4sec 295.4sec 98.45% 98.20% 66.9 (66.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 2.7s
  • trigger_min/max:0.8s / 15.5s
  • trigger_pct:100.00%
  • duration_min/max:231.3s / 358.6s

Stack Uptimes

  • lashing_flames_1:98.45%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 59.2 188.0sec 5.0sec 283.6sec 99.14% 0.00% 55.1 (55.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 354.1s
  • trigger_min/max:0.9s / 48.4s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 357.9s

Stack Uptimes

  • razorice_1:1.05%
  • razorice_2:0.87%
  • razorice_3:0.96%
  • razorice_4:0.88%
  • razorice_5:95.39%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Rotten Touch 11.6 9.4 25.7sec 13.9sec 13.8sec 53.70% 59.35% 9.4 (9.4) 11.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rotten_touch
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.3s / 100.4s
  • trigger_min/max:0.8s / 57.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 90.0s

Stack Uptimes

  • rotten_touch_1:53.70%

Spelldata

  • id:390276
  • name:Rotten Touch
  • tooltip:Scourge Strike damage taken from {$@=}auracaster is increased by {$s1=50}%.
  • description:{$@spelldesc390275=Sudden Doom causes your next Death Coil to also increase your {$?s207311=true}[Clawing Shadows][Scourge Strike] damage against the target by {$390276s1=50}% for {$390276d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 257649.67
Minimum 235424.45
Maximum 287122.50
Spread ( max - min ) 51698.05
Range [ ( max - min ) / 2 * 100% ] 10.03%
Standard Deviation 7039.8117
5th Percentile 246491.53
95th Percentile 269675.79
( 95th Percentile - 5th Percentile ) 23184.26
Mean Distribution
Standard Deviation 81.2942
95.00% Confidence Interval ( 257490.34 - 257809.01 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2868
0.1 Scale Factor Error with Delta=300 423064
0.05 Scale Factor Error with Delta=300 1692255
0.01 Scale Factor Error with Delta=300 42306370
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3754
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 60871725 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front
dragonflight.player.ominous_chromatic_essence_dragonflight=obsidian
dragonflight.player.ashkandur_humanoid=

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.